Compare commits

..
Author SHA1 Message Date
Cheng Li 38bb2bd748 remove temp fs 2021-09-08 16:31:22 -07:00
329 changed files with 27234 additions and 202162 deletions
+194
View File
@@ -0,0 +1,194 @@
# Copyright 2020 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
# We want to use LTS ubuntu from our mirror because dockerhub has a
# rate limit.
# FROM mirror.gcr.io/library/ubuntu:18.04
# However, now the above image is not working, we're using our own cache
FROM gcr.io/cloud-devrel-kokoro-resources/ubuntu:20.04
ENV DEBIAN_FRONTEND noninteractive
# Ensure local Python is preferred over distribution Python.
ENV PATH /usr/local/bin:$PATH
# http://bugs.python.org/issue19846
# At the moment, setting "LANG=C" on a Linux system fundamentally breaks
# Python 3.
ENV LANG C.UTF-8
# Install dependencies.
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
apt-transport-https \
build-essential \
ca-certificates \
curl \
dirmngr \
git \
gcc \
gpg-agent \
graphviz \
libbz2-dev \
libdb5.3-dev \
libexpat1-dev \
libffi-dev \
liblzma-dev \
libmagickwand-dev \
libmemcached-dev \
libpython3-dev \
libreadline-dev \
libsnappy-dev \
libssl-dev \
libsqlite3-dev \
portaudio19-dev \
pkg-config \
redis-server \
software-properties-common \
ssh \
sudo \
systemd \
tcl \
tcl-dev \
tk \
tk-dev \
uuid-dev \
wget \
zlib1g-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install docker
RUN curl -fsSL https://download.docker.com/linux/ubuntu/gpg | sudo apt-key add -
RUN add-apt-repository \
"deb [arch=amd64] https://download.docker.com/linux/ubuntu \
$(lsb_release -cs) \
stable"
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
docker-ce \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Bazel for compiling Tink in Cloud SQL Client Side Encryption Samples
# TODO: Delete this section once google/tink#483 is resolved
RUN apt install -y curl gpgconf gpg \
&& curl -fsSL https://bazel.build/bazel-release.pub.gpg | gpg --dearmor > bazel.gpg \
&& mv bazel.gpg /etc/apt/trusted.gpg.d/ \
&& echo "deb [arch=amd64] https://storage.googleapis.com/bazel-apt stable jdk1.8" | sudo tee /etc/apt/sources.list.d/bazel.list \
&& apt update && apt install -y bazel \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Microsoft ODBC 17 Driver and unixodbc for testing SQL Server samples
RUN curl https://packages.microsoft.com/keys/microsoft.asc | apt-key add - \
&& curl https://packages.microsoft.com/config/ubuntu/20.04/prod.list > /etc/apt/sources.list.d/mssql-release.list \
&& apt-get update \
&& ACCEPT_EULA=Y apt-get install -y --no-install-recommends \
msodbcsql17 \
unixodbc-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
COPY fetch_gpg_keys.sh /tmp
# Install the desired versions of Python.
RUN set -ex \
&& export GNUPGHOME="$(mktemp -d)" \
&& echo "disable-ipv6" >> "${GNUPGHOME}/dirmngr.conf" \
&& /tmp/fetch_gpg_keys.sh \
&& for PYTHON_VERSION in 2.7.18 3.6.13 3.7.10 3.8.8 3.9.2; do \
wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz" \
&& wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz.asc "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz.asc" \
&& gpg --batch --verify python-${PYTHON_VERSION}.tar.xz.asc python-${PYTHON_VERSION}.tar.xz \
&& rm -r python-${PYTHON_VERSION}.tar.xz.asc \
&& mkdir -p /usr/src/python-${PYTHON_VERSION} \
&& tar -xJC /usr/src/python-${PYTHON_VERSION} --strip-components=1 -f python-${PYTHON_VERSION}.tar.xz \
&& rm python-${PYTHON_VERSION}.tar.xz \
&& cd /usr/src/python-${PYTHON_VERSION} \
&& ./configure \
--enable-shared \
# This works only on Python 2.7 and throws a warning on every other
# version, but seems otherwise harmless.
--enable-unicode=ucs4 \
--with-system-ffi \
--without-ensurepip \
&& make -j$(nproc) \
&& make install \
&& ldconfig \
; done \
&& rm -rf "${GNUPGHOME}" \
&& rm -rf /usr/src/python* \
&& rm -rf ~/.cache/
# Install pip on Python 3.6 only.
# If the environment variable is called "PIP_VERSION", pip explodes with
# "ValueError: invalid truth value '<VERSION>'"
ENV PYTHON_PIP_VERSION 20.2.4
RUN wget --no-check-certificate -O /tmp/get-pip.py 'https://bootstrap.pypa.io/get-pip.py' \
&& python3.6 /tmp/get-pip.py "pip==$PYTHON_PIP_VERSION" \
# we use "--force-reinstall" for the case where the version of pip we're trying to install is the same as the version bundled with Python
# ("Requirement already up-to-date: pip==8.1.2 in /usr/local/lib/python3.6/site-packages")
# https://github.com/docker-library/python/pull/143#issuecomment-241032683
&& pip3 install --no-cache-dir --upgrade --force-reinstall "pip==$PYTHON_PIP_VERSION" \
# then we use "pip list" to ensure we don't have more than one pip version installed
# https://github.com/docker-library/python/pull/100
&& [ "$(pip list |tac|tac| awk -F '[ ()]+' '$1 == "pip" { print $2; exit }')" = "$PYTHON_PIP_VERSION" ]
# Ensure Pip for python3
RUN python3 /tmp/get-pip.py
RUN rm /tmp/get-pip.py
# Install "virtualenv", since the vast majority of users of this image
# will want it.
RUN pip install --no-cache-dir virtualenv
# Setup Cloud SDK
ENV CLOUD_SDK_VERSION 339.0.0
# Use system python for cloud sdk.
ENV CLOUDSDK_PYTHON python3.6
RUN wget https://dl.google.com/dl/cloudsdk/channels/rapid/downloads/google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN tar xzf google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN /google-cloud-sdk/install.sh
ENV PATH /google-cloud-sdk/bin:$PATH
# Enable redis-server on boot.
RUN sudo systemctl enable redis-server.service
# Create a user and allow sudo
# kbuilder uid on the default Kokoro image
ARG UID=1000
ARG USERNAME=kbuilder
# Add a new user to the container image.
# This is needed for ssh and sudo access.
# Add a new user with the caller's uid and the username.
RUN useradd -d /h -u ${UID} ${USERNAME}
# Allow nopasswd sudo
RUN echo "${USERNAME} ALL=(ALL) NOPASSWD:ALL" >> /etc/sudoers
CMD ["python3.6"]
@@ -13,22 +13,30 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import concurrent
import argparse
import dataclasses
import datetime
import functools
import os
import pathlib
import nbformat
import re
import os
import subprocess
from pathlib import Path
from typing import List, Optional
import concurrent
from tabulate import tabulate
import operator
import execute_notebook_remote
from utils import util, NotebookProcessors
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
import ExecuteNotebook
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
def format_timedelta(delta: datetime.timedelta) -> str:
@@ -54,138 +62,49 @@ def format_timedelta(delta: datetime.timedelta) -> str:
@dataclasses.dataclass
class NotebookExecutionResult:
name: str
notebook: str
duration: datetime.timedelta
is_pass: bool
log_url: str
output_uri: str
build_id: str
error_message: Optional[str]
def _process_notebook(
notebook_path: str,
def execute_notebook(
artifacts_path: str,
variable_project_id: str,
variable_region: str,
):
# Read notebook
with open(notebook_path) as f:
nb = nbformat.read(f, as_version=4)
# Create preprocessors
remove_no_execute_cells_preprocessor = NotebookProcessors.RemoveNoExecuteCells()
update_variables_preprocessor = NotebookProcessors.UpdateVariablesPreprocessor(
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
},
)
# Use no-execute preprocessor
(
nb,
resources,
) = remove_no_execute_cells_preprocessor.preprocess(nb)
(nb, resources) = update_variables_preprocessor.preprocess(nb, resources)
with open(notebook_path, mode="w", encoding="utf-8") as new_file:
nbformat.write(nb, new_file)
def _create_tag(filepath: str) -> str:
tag = os.path.basename(os.path.normpath(filepath))
tag = re.sub("[^0-9a-zA-Z_.-]+", "-", tag)
if tag.startswith(".") or tag.startswith("-"):
tag = tag[1:]
return tag
def process_and_execute_notebook(
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
should_log_output: bool,
should_use_new_kernel: bool,
notebook: str,
should_get_tail_logs: bool = False,
) -> NotebookExecutionResult:
print(f"Running notebook: {notebook}")
# Create paths
notebook_output_uri = "/".join([artifacts_bucket, pathlib.Path(notebook).name])
# Create tag from notebook
tag = _create_tag(filepath=notebook)
result = NotebookExecutionResult(
name=tag,
notebook=notebook,
duration=datetime.timedelta(seconds=0),
is_pass=False,
output_uri=notebook_output_uri,
log_url="",
build_id="",
error_message=None,
)
# TODO: Handle cases where multiple notebooks have the same name
time_start = datetime.datetime.now()
operation = None
try:
# Pre-process notebook by substituting variable names
_process_notebook(
notebook_path=notebook,
variable_project_id=variable_project_id,
variable_region=variable_region,
ExecuteNotebook.execute_notebook(
notebook_file_path=notebook,
output_file_folder=artifacts_path,
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
},
should_log_output=should_log_output,
should_use_new_kernel=should_use_new_kernel,
)
# Upload the pre-processed code to a GCS bucket
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
operation = execute_notebook_remote.execute_notebook_remote(
code_archive_uri=code_archive_uri,
notebook_uri=notebook,
notebook_output_uri=notebook_output_uri,
container_uri=container_uri,
tag=tag,
region=variable_region,
private_pool_id=private_pool_id,
)
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
result.build_id = operation_metadata.build.id
result.log_url = operation_metadata.build.log_url
# Block and wait for the result
operation_result = operation.result()
result.duration = datetime.datetime.now() - time_start
result.is_pass = True
print(f"{notebook} PASSED in {format_timedelta(result.duration)}.")
except Exception as error:
result.error_message = str(error)
if operation and should_get_tail_logs:
# Extract the logs
logs_bucket = operation_metadata.build.logs_bucket
# Download tail end of logs file
log_file_uri = f"{logs_bucket}/log-{result.build_id}.txt"
# Use gcloud to get tail
try:
result.error_message = subprocess.check_output(
["gsutil", "cat", "-r", "-1000", log_file_uri], encoding="UTF-8"
)
except Exception as error:
result.error_message = str(error)
result.duration = datetime.datetime.now() - time_start
result.is_pass = False
result.error_message = str(error)
print(
f"{notebook} FAILED in {format_timedelta(result.duration)}: {result.error_message}"
)
@@ -193,13 +112,43 @@ def process_and_execute_notebook(
return result
def get_changed_notebooks(
def run_changed_notebooks(
test_paths_file: str,
base_branch: Optional[str] = None,
) -> List[str]:
base_branch: Optional[str],
output_folder: str,
variable_project_id: str,
variable_region: str,
should_parallelize: bool,
should_use_separate_kernels: bool,
):
"""
Get the notebooks that exist under the folders defined in the test_paths_file.
It only returns notebooks that have differences from the Git base_branch.
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the output_folder.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
output_folder (str):
Required. The folder to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
should_use_separate_kernels (bool):
Note: Dependencies don't install correctly when this is set to True
See https://github.com/nteract/papermill/issues/625
Required. Should run each notebook in a separate and independent virtual environment.
"""
test_paths = []
@@ -227,47 +176,14 @@ def get_changed_notebooks(
notebooks = notebooks.decode("utf-8").split("\n")
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
notebooks = [notebook for notebook in notebooks if Path(notebook).exists()]
return notebooks
# Create paths
artifacts_path = Path(output_folder)
artifacts_path.mkdir(parents=True, exist_ok=True)
artifacts_path.joinpath("success").mkdir(parents=True, exist_ok=True)
artifacts_path.joinpath("failure").mkdir(parents=True, exist_ok=True)
def process_and_execute_notebooks(
notebooks: List[str],
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
should_parallelize: bool,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
"""
notebook_execution_results: List[NotebookExecutionResult] = []
if len(notebooks) > 0:
@@ -281,27 +197,25 @@ def process_and_execute_notebooks(
notebook_execution_results = list(
executor.map(
functools.partial(
process_and_execute_notebook,
container_uri,
staging_bucket,
artifacts_bucket,
execute_notebook,
artifacts_path,
variable_project_id,
variable_region,
private_pool_id,
False,
should_use_separate_kernels,
),
notebooks,
)
)
else:
notebook_execution_results = [
process_and_execute_notebook(
container_uri=container_uri,
staging_bucket=staging_bucket,
artifacts_bucket=artifacts_bucket,
execute_notebook(
artifacts_path=artifacts_path,
variable_project_id=variable_project_id,
variable_region=variable_region,
private_pool_id=private_pool_id,
notebook=notebook,
should_log_output=True,
should_use_new_kernel=should_use_separate_kernels,
)
for notebook in notebooks
]
@@ -310,38 +224,89 @@ def process_and_execute_notebooks(
print("\n=== RESULTS ===\n")
results_sorted = sorted(
notebooks_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
result.name,
os.path.basename(os.path.normpath(result.notebook)),
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.log_url,
result.error_message or "--",
]
for result in results_sorted
for result in notebooks_sorted
],
headers=["build_tag", "status", "duration", "log_url"],
headers=["file", "status", "duration", "error"],
)
)
print("\n=== END RESULTS===\n")
total_notebook_duration = functools.reduce(
operator.add,
[datetime.timedelta(seconds=0)]
+ [result.duration for result in results_sorted],
)
print(f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--output_folder",
type=pathlib.Path,
help="The path to the folder to store executed notebooks.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
# Note: Dependencies don't install correctly when this is set to True
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=False,
help="Should run notebooks in parallel.",
)
# Note: This isn't guaranteed to work correctly due to existing Papermill issue
# See https://github.com/nteract/papermill/issues/625
parser.add_argument(
"--should_use_separate_kernels",
type=str2bool,
nargs="?",
const=True,
default=False,
help="(Experimental) Should run each notebook in a separate and independent virtual environment.",
)
args = parser.parse_args()
run_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
output_folder=args.output_folder,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
should_parallelize=args.should_parallelize,
should_use_separate_kernels=args.should_use_separate_kernels,
)
+175
View File
@@ -0,0 +1,175 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import json
import sys
import nbformat
import os
import errno
from NotebookProcessors import RemoveNoExecuteCells, UpdateVariablesPreprocessor
from typing import Dict, Tuple
import papermill as pm
import shutil
import virtualenv
import uuid
from jupyter_client.kernelspecapp import KernelSpecManager
# This script is used to execute a notebook and write out the output notebook.
# The replaces calling the nbconvert via command-line, which doesn't write the output notebook correctly when there are errors during execution.
STAGING_FOLDER = "staging"
ENVIRONMENTS_PATH = "environments"
KERNELS_SPECS_PATH = "kernel_specs"
def create_and_install_kernel() -> Tuple[str, str]:
# Create environment
kernel_name = str(uuid.uuid4())
env_name = f"{ENVIRONMENTS_PATH}/{kernel_name}"
# venv.create(env_name, system_site_packages=True, with_pip=True)
virtualenv.cli_run([env_name, "--system-site-packages"])
# Create kernel spec
kernel_spec = {
"argv": [
f"{env_name}/bin/python",
"-m",
"ipykernel_launcher",
"-f",
"{connection_file}",
],
"display_name": "Python 3",
"language": "python",
}
kernel_spec_folder = os.path.join(KERNELS_SPECS_PATH, kernel_name)
kernel_spec_file = os.path.join(kernel_spec_folder, "kernel.json")
# Create kernel spec folder
if not os.path.exists(os.path.dirname(kernel_spec_file)):
try:
os.makedirs(os.path.dirname(kernel_spec_file))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
with open(kernel_spec_file, mode="w", encoding="utf-8") as f:
json.dump(kernel_spec, f)
# Install kernel
kernel_spec_manager = KernelSpecManager()
kernel_spec_manager.install_kernel_spec(
source_dir=kernel_spec_folder, kernel_name=kernel_name
)
return kernel_name, env_name
def execute_notebook(
notebook_file_path: str,
output_file_folder: str,
replacement_map: Dict[str, str],
should_log_output: bool,
should_use_new_kernel: bool,
):
# Create staging directory if it doesn't exist
staging_file_path = f"{STAGING_FOLDER}/{notebook_file_path}"
if not os.path.exists(os.path.dirname(staging_file_path)):
try:
os.makedirs(os.path.dirname(staging_file_path))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
file_name = os.path.basename(os.path.normpath(notebook_file_path))
# Create environments folder
if not os.path.exists(ENVIRONMENTS_PATH):
try:
os.makedirs(ENVIRONMENTS_PATH)
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
# Create and install kernel
kernel_name = next(
iter(KernelSpecManager().find_kernel_specs().keys()), None
) # Find first existing kernel and use as default
env_name = None
if should_use_new_kernel:
kernel_name, env_name = create_and_install_kernel()
# Read notebook
with open(notebook_file_path) as f:
nb = nbformat.read(f, as_version=4)
has_error = False
# Execute notebook
try:
# Create preprocessors
remove_no_execute_cells_preprocessor = RemoveNoExecuteCells()
update_variables_preprocessor = UpdateVariablesPreprocessor(
replacement_map=replacement_map
)
# Use no-execute preprocessor
(
nb,
resources,
) = remove_no_execute_cells_preprocessor.preprocess(nb)
(nb, resources) = update_variables_preprocessor.preprocess(nb, resources)
# print(f"Staging modified notebook to: {staging_file_path}")
with open(staging_file_path, mode="w", encoding="utf-8") as f:
nbformat.write(nb, f)
# Execute notebook
pm.execute_notebook(
input_path=staging_file_path,
output_path=staging_file_path,
kernel_name=kernel_name,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
)
except Exception:
# print(f"Error executing the notebook: {notebook_file_path}.\n\n")
has_error = True
raise
finally:
# Clear env
if env_name is not None:
shutil.rmtree(path=env_name)
# Copy execute notebook
output_file_path = os.path.join(
output_file_folder, "failure" if has_error else "success", file_name
)
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_path)):
try:
os.makedirs(os.path.dirname(output_file_path))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
# print(f"Writing output to: {output_file_path}")
shutil.move(staging_file_path, output_file_path)
@@ -15,7 +15,7 @@
from nbconvert.preprocessors import Preprocessor
from typing import Dict
from . import UpdateNotebookVariables as update_notebook_variables
import UpdateNotebookVariables
class RemoveNoExecuteCells(Preprocessor):
@@ -41,7 +41,7 @@ class UpdateVariablesPreprocessor(Preprocessor):
# VARIABLE_NAME = '[description]'
for variable_name, variable_value in replacement_map.items():
content = update_notebook_variables.get_updated_value(
content = UpdateNotebookVariables.get_updated_value(
content=content,
variable_name=variable_name,
variable_value=variable_value,
+22 -25
View File
@@ -1,45 +1,42 @@
from typing import List
from resource_cleanup_manager import (
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
)
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
for manager in managers:
type_name = manager.type_name
for manager in managers:
type_name = manager.type_name
print(f"Fetching {type_name}'s...")
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
print(f"Fetching {type_name}'s...")
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
try:
manager.delete(resource)
except Exception as exception:
print(exception)
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
manager.delete(resource)
print("")
print("")
is_dry_run = False
if is_dry_run:
print("Starting cleanup in dry run mode...")
print("Starting cleanup in dry run mode...")
# List of all cleanup managers
managers = [
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
]
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
@@ -1,107 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
import argparse
import pathlib
import execute_changed_notebooks_helper
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--private_pool_id",
type=str,
help="The private pool id.",
required=False,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
)
execute_changed_notebooks_helper.process_and_execute_notebooks(
notebooks=notebooks,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
private_pool_id=args.private_pool_id if not "default" else None,
should_parallelize=args.should_parallelize,
)
-40
View File
@@ -1,40 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to download (optional) and run a single notebook locally"""
import argparse
import execute_notebook_helper
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
parser.add_argument(
"--notebook_source",
type=str,
help="Local filepath or GCS URI to notebook.",
required=True,
)
parser.add_argument(
"--output_file_or_uri",
type=str,
help="Local file or GCS URI to save executed notebook to.",
required=True,
)
args = parser.parse_args()
execute_notebook_helper.execute_notebook(
notebook_source=args.notebook_source,
output_file_or_uri=args.output_file_or_uri,
should_log_output=True,
)
-91
View File
@@ -1,91 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook locally"""
import sys
import os
import errno
import papermill as pm
import shutil
from utils import util
from google.cloud.aiplatform import utils
# This script is used to execute a notebook and write out the output notebook.
def execute_notebook(
notebook_source: str,
output_file_or_uri: str,
should_log_output: bool,
):
"""Execute a single notebook using Papermill"""
file_name = os.path.basename(os.path.normpath(notebook_source))
# Download notebook if it's a GCS URI
if notebook_source.startswith("gs://"):
# Extract uri components
bucket_name, prefix = utils.extract_bucket_and_prefix_from_gcs_path(
notebook_source
)
# Download remote notebook to local file system
notebook_source = file_name
util.download_file(
bucket_name=bucket_name, blob_name=prefix, destination_file=notebook_source
)
execution_exception = None
# Execute notebook
try:
# Execute notebook
pm.execute_notebook(
input_path=notebook_source,
output_path=notebook_source,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
)
except Exception as exception:
execution_exception = exception
finally:
# Copy executed notebook
if output_file_or_uri.startswith("gs://"):
# Upload to GCS path
util.upload_file(notebook_source, remote_file_path=output_file_or_uri)
print("\n=== EXECUTION FINISHED ===\n")
print(
f"Please debug the executed notebook by downloading: {output_file_or_uri}"
)
print("\n======\n")
else:
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_or_uri)):
try:
os.makedirs(os.path.dirname(output_file_or_uri))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
print(f"Writing output to: {output_file_or_uri}")
shutil.move(notebook_source, output_file_or_uri)
if execution_exception:
raise execution_exception
-101
View File
@@ -1,101 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook on Google Cloud Build"""
from re import sub
from google.protobuf import duration_pb2
from yaml.loader import FullLoader
import google.auth
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from typing import Optional
import yaml
from google.cloud.aiplatform import utils
from google.api_core import operation, client_options
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
TIMEOUT_IN_SECONDS = 86400
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
def execute_notebook_remote(
code_archive_uri: str,
notebook_uri: str,
notebook_output_uri: str,
container_uri: str,
region: str,
private_pool_id: Optional[str],
tag: Optional[str],
) -> operation.Operation:
"""Create and execute a single notebook on Google Cloud Build"""
# Load build steps from YAML
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
substitutions = {
"_PYTHON_IMAGE": container_uri,
"_NOTEBOOK_GCS_URI": notebook_uri,
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
}
build = cloudbuild_v1.Build()
options: Optional[client_options.ClientOptions] = None
if private_pool_id:
substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
build.options = cloudbuild_config["options"]
# Switch to the regional endpoint of the pool
options = client_options.ClientOptions(
api_endpoint=f"{region}-{SERVICE_BASE_PATH}"
)
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
(
source_archived_file_gcs_bucket,
source_archived_file_gcs_object,
) = utils.extract_bucket_and_prefix_from_gcs_path(code_archive_uri)
build.source = Source(
storage_source=StorageSource(
bucket=source_archived_file_gcs_bucket,
object_=source_archived_file_gcs_object,
)
)
build.steps = cloudbuild_config["steps"]
build.substitutions = substitutions
build.timeout = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
build.queue_ttl = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
if tag:
build.tags = [tag]
operation = client.create_build(project_id=project_id, build=build)
# Print the in-progress operation
# print("IN PROGRESS:")
# print(operation.metadata)
# Print the completed status
# print("RESULT:", result.status)
return operation
@@ -1,31 +0,0 @@
steps:
# Show the gcloud info and check if gcloud exists
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'gcloud config list'
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 .cloud-build/CheckPythonVersion.py'
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
# Install Python dependencies and run testing script
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"'
env:
- 'IS_TESTING=1'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
@@ -19,20 +19,26 @@ steps:
- 'if [ -n "${_BASE_BRANCH}" ]; then git fetch origin "${_BASE_BRANCH}":refs/remotes/origin/"${_BASE_BRANCH}"; else echo "Skipping fetch."; fi'
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
entrypoint: pip
args: ['install', '--upgrade', '--user', '--requirement', '.cloud-build/requirements.txt']
# Install Python dependencies and run testing script
# TODO: Only pass in private_pool_id if it is set
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`'
- 'python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --output_folder ${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
env:
- 'IS_TESTING=1'
# Manually copy artifacts to GCS
- name: gcr.io/cloud-builders/gsutil
entrypoint: /bin/sh
args:
- -c
- 'if [ $(ls -pR "/workspace/${BUILD_ID}" | grep -v / | grep -v ^$ | wc -l) -ne 0 ]; then gsutil -m -q rsync -r "/workspace/${BUILD_ID}" "gs://${_GCS_ARTIFACTS_BUCKET}/test-artifacts/PR_${_PR_NUMBER}/BUILD_${BUILD_ID}/"; else echo "No artifacts to copy."; fi'
# Fail if there is anything in the failure folder
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'echo "Download executed notebooks with this command: \"mkdir -p artifacts && gsutil rsync -r gs://${_GCS_ARTIFACTS_BUCKET}/test-artifacts/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} artifacts/\"" && if [ "$(ls -A /workspace/${BUILD_ID}/failure | wc -l)" -ne 0 ]; then exit 1; else exit 0; fi'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
+7 -11
View File
@@ -1,12 +1,8 @@
ipython
numpy
jupyter
nbconvert
papermill
pandas
matplotlib
ipython>=7.0
jupyter>=1.0
nbconvert>=6.0
papermill>=2.3
numpy>=1.19
pandas>=1.2
matplotlib>=3.4
tabulate
google-cloud-aiplatform
google-cloud-storage
google-cloud-build
gcloud
-1
View File
@@ -1,3 +1,2 @@
notebooks/official
notebooks/notebook_template.ipynb
notebooks/community/ml_ops
-5
View File
@@ -1,5 +0,0 @@
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/matching_engine/intro-swivel.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
View File
-60
View File
@@ -1,60 +0,0 @@
from datetime import datetime
from typing import Optional
from google.cloud import storage
from google.cloud.aiplatform import utils
from google.auth import credentials as auth_credentials
import os
import subprocess
import tarfile
import uuid
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
"""Copies a remote GCS file to a local path"""
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
subprocess.check_output(
["gsutil", "cp", remote_file_path, destination_file], encoding="UTF-8"
)
return destination_file
def upload_file(
local_file_path: str,
remote_file_path: str,
) -> str:
"""Copies a local file to a GCS path"""
subprocess.check_output(
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
)
return remote_file_path
def archive_code_and_upload(staging_bucket: str):
# Archive all source in current directory
unique_id = uuid.uuid4()
source_archived_file = f"source_archived_{unique_id}.tar.gz"
git_files = subprocess.check_output(
["git", "ls-tree", "-r", "HEAD", "--name-only"], encoding="UTF-8"
).split("\n")
with tarfile.open(source_archived_file, "w:gz") as tar:
for file in git_files:
if len(file) > 0 and os.path.exists(file):
tar.add(file)
# Upload archive to GCS bucket
source_archived_file_gcs = upload_file(
local_file_path=f"{source_archived_file}",
remote_file_path="/".join(
[staging_bucket, "code_archives", source_archived_file]
),
)
print(f"Uploaded source code archive to {source_archived_file_gcs}")
return source_archived_file_gcs
+9 -10
View File
@@ -1,18 +1,17 @@
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] Passes all the required automated checks
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
+4 -4
View File
@@ -7,13 +7,13 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Set up Python
uses: actions/setup-python@v3
uses: actions/setup-python@v2
- name: Fetch pull request branch
uses: actions/checkout@v3
uses: actions/checkout@v2
with:
fetch-depth: 0
- name: Fetch base main branch
run: git fetch -u "$GITHUB_SERVER_URL/$GITHUB_REPOSITORY" main:main
- name: Fetch base master branch
run: git fetch -u "$GITHUB_SERVER_URL/$GITHUB_REPOSITORY" master:master
- name: Install requirements
run: python3 -m pip install -U -r .github/workflows/linter/requirements.txt
- name: Format and lint notebooks
+5 -5
View File
@@ -2,8 +2,8 @@ git+https://github.com/tensorflow/docs
ipython
jupyter
nbconvert
black==22.3.0
pyupgrade==2.31.1
isort==5.10.1
flake8==4.0.1
nbqa==1.3.1
black==20.8b1
pyupgrade==2.7.3
isort==5.6.4
flake8==3.9.0
nbqa==0.6.0
+7 -7
View File
@@ -13,7 +13,7 @@
# See the License for the specific language governing permissions and
# limitations under the License.
# This script automatically formats and lints all notebooks that have changed from the head of the main branch.
# This script automatically formats and lints all notebooks that have changed from the head of the master branch.
#
# Options:
# -t: Test-mode. Only test if format and linting are required but make no changes to files.
@@ -52,7 +52,7 @@ echo "Test mode: $is_test"
notebooks=()
while read -r file || [ -n "$line" ]; do
notebooks+=("$file")
done < <(git diff --name-only main... | grep '\.ipynb$')
done < <(git diff --name-only master... | grep '\.ipynb$')
problematic_notebooks=()
if [ ${#notebooks[@]} -gt 0 ]; then
@@ -80,23 +80,23 @@ if [ ${#notebooks[@]} -gt 0 ]; then
python3 -m nbqa isort "$notebook" --check
ISORT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722
FLAKE8_RTN=$?
else
echo "Running black..."
python3 -m nbqa black "$notebook"
python3 -m nbqa black "$notebook" --nbqa-mutate
BLACK_RTN=$?
echo "Running pyupgrade..."
python3 -m nbqa pyupgrade "$notebook"
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
PYUPGRADE_RTN=$?
echo "Running isort..."
python3 -m nbqa isort "$notebook"
python3 -m nbqa isort "$notebook" --nbqa-mutate
ISORT_RTN=$?
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
NBFMT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722 --nbqa-mutate
FLAKE8_RTN=$?
fi
-6
View File
@@ -1,6 +0,0 @@
# See https://help.github.com/en/articles/about-code-owners
# for more info about CODEOWNERS file.
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence.
* @GoogleCloudPlatform/vertex-ai-samples-owners
-43
View File
@@ -1,43 +0,0 @@
# Contributor Code of Conduct
As contributors and maintainers of this project,
and in the interest of fostering an open and welcoming community,
we pledge to respect all people who contribute through reporting issues,
posting feature requests, updating documentation,
submitting pull requests or patches, and other activities.
We are committed to making participation in this project
a harassment-free experience for everyone,
regardless of level of experience, gender, gender identity and expression,
sexual orientation, disability, personal appearance,
body size, race, ethnicity, age, religion, or nationality.
Examples of unacceptable behavior by participants include:
* The use of sexualized language or imagery
* Personal attacks
* Trolling or insulting/derogatory comments
* Public or private harassment
* Publishing other's private information,
such as physical or electronic
addresses, without explicit permission
* Other unethical or unprofessional conduct.
Project maintainers have the right and responsibility to remove, edit, or reject
comments, commits, code, wiki edits, issues, and other contributions
that are not aligned to this Code of Conduct.
By adopting this Code of Conduct,
project maintainers commit themselves to fairly and consistently
applying these principles to every aspect of managing this project.
Project maintainers who do not follow or enforce the Code of Conduct
may be permanently removed from the project team.
This code of conduct applies both within project spaces and in public spaces
when an individual is representing the project or its community.
Instances of abusive, harassing, or otherwise unacceptable behavior
may be reported by opening an issue
or contacting one or more of the project maintainers.
This Code of Conduct is adapted from the [Contributor Covenant](http://contributor-covenant.org), version 1.2.0,
available at [http://contributor-covenant.org/version/1/2/0/](http://contributor-covenant.org/version/1/2/0/)
-65
View File
@@ -1,65 +0,0 @@
# How to Contribute
We'd love to accept your patches and contributions to this project. There are
just a few small guidelines you need to follow.
## Contributor License Agreement
Contributions to this project must be accompanied by a Contributor License
Agreement. You (or your employer) retain the copyright to your contribution;
this simply gives us permission to use and redistribute your contributions as
part of the project. Head over to <https://cla.developers.google.com/> to see
your current agreements on file or to sign a new one.
You generally only need to submit a CLA once, so if you've already submitted one
(even if it was for a different project), you probably don't need to do it
again.
## Code Quality Checks
All notebooks in this project are checked for formatting and style, to ensure a
consistent experience. To test notebooks prior to submitting a pull request,
you can follow these steps.
From a command-line terminal (e.g. from Vertex Workbench or locally), install
the code analysis tools:
```shell
pip3 install --user -U nbqa black flake8 isort pyupgrade git+https://github.com/tensorflow/docs
```
You'll likely need to add the directory where these were installed to your PATH:
```shell
export PATH="$HOME/.local/bin:$PATH"
```
Then, set an environment variable for your notebook (or directory):
```shell
export notebook="your-notebook.ipynb"
```
Finally, run this code block to check for errors. Each step will attempt to
automatically fix any issues. If the fixes can't be performed automatically,
then you will need to manually address them before submitting your PR.
```shell
nbqa black "$notebook"
nbqa pyupgrade "$notebook"
nbqa isort "$notebook"
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
nbqa flake8 "$notebook" --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
```
## Code Reviews
All submissions, including submissions by project members, require review. We
use GitHub pull requests for this purpose. Consult
[GitHub Help](https://help.github.com/articles/about-pull-requests/) for more
information on using pull requests.
## Community Guidelines
This project follows [Google's Open Source Community
Guidelines](https://opensource.google/conduct/).
+2 -19
View File
@@ -6,32 +6,15 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
## Overview
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
## Repository structure
```bash
├── community-content - Sample code and tutorials contributed by the community
├── notebooks
│ ├── community - Notebooks contributed by the community
│ ├── official - Notebooks demonstrating use of each Vertex AI service
│ │ ├── automl
│ │ ├── custom
│ │ ├── ...
```
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks) and [Tutorials](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/tutorials) that demonstrate how to develop and manage ML workflow using Google Cloud Vertex AI.
## Contributing
Contributions welcome! See the [Contributing Guide](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/CONTRIBUTING.md).
Contributions welcome! See the [Contributing Guide](Contributions welcome! See the [Contributing Guide](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md).
## Getting help
Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) to provide feedback or submit a bug report.
## Disclaimer
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
## Feedback
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
-7
View File
@@ -1,7 +0,0 @@
# Security Policy
To report a security issue, please use [g.co/vulnz](https://g.co/vulnz).
The Google Security Team will respond within 5 working days of your report on g.co/vulnz.
We use g.co/vulnz for our intake, and do coordination and disclosure here using GitHub Security Advisory to privately discuss and fix the issue.
-6
View File
@@ -1,6 +0,0 @@
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/pluto_on_workbench @wkharold
@@ -1,824 +0,0 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "pc5-mbsX9PZC"
},
"source": [
"# AlphaFold On Vertex AI Workbench\n",
"\n",
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
"\n",
"## ![](https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/alphafold_on_workbench/vertexai_40.png) [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
"\n",
"**Differences to AlphaFold v2.1.0**\n",
"\n",
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
"\n",
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
"\n",
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
"\n",
"**Citing this work**\n",
"\n",
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
"\n",
"**Licenses**\n",
"\n",
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
"\n",
"\n",
"**More information**\n",
"\n",
"You can find more information about how AlphaFold works in the following papers:\n",
"\n",
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
"\n",
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b7a02613eb1a"
},
"source": [
"## Download AlphaFold Data"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "woIxeCPygt7K"
},
"outputs": [],
"source": [
"import os\n",
"import subprocess\n",
"import sys\n",
"\n",
"import alphafold.common\n",
"import tqdm.notebook\n",
"from IPython.utils import io\n",
"\n",
"TQDM_BAR_FORMAT = (\n",
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
")\n",
"\n",
"SOURCE_URL = (\n",
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
")\n",
"PARAMS_DIR = \"alphafold/data/params\"\n",
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
"\n",
"try:\n",
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" with io.capture_output() as captured:\n",
"\n",
" # Download and store stereo_chemical_props.txt\n",
" !mkdir -p ~/content/alphafold/alphafold/common\n",
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
" pbar.update(18)\n",
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
"\n",
" # Download alphafold_params_colab_2021-10-27.tar\n",
" !mkdir --parents \"{PARAMS_DIR}\"\n",
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
" pbar.update(27)\n",
"\n",
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
" # !rm \"{PARAMS_PATH}\"\n",
" pbar.update(55)\n",
"\n",
"except subprocess.CalledProcessError:\n",
" print(captured)\n",
" raise"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d8926b7d5529"
},
"source": [
"## Configure GPU Acceleration"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "VzJ5iMjTtoZw"
},
"outputs": [],
"source": [
"# Confirm accelerator configuration\n",
"import jax\n",
"\n",
"if jax.local_devices()[0].platform == \"tpu\":\n",
" raise RuntimeError(\n",
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
" )\n",
"elif jax.local_devices()[0].platform == \"cpu\":\n",
" print(\n",
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
" )\n",
"else:\n",
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
"\n",
"# Make sure all necessary environment variables are set.\n",
"import os\n",
"\n",
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "W4JpOs6oA-QS"
},
"source": [
"## Making a prediction\n",
"\n",
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
"\n",
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
"\n",
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
"\n",
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b310d44229d0"
},
"outputs": [],
"source": [
"# Input sequences (type: str)\n",
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
"sequence_2 = \"\"\n",
"sequence_3 = \"\"\n",
"sequence_4 = \"\"\n",
"sequence_5 = \"\"\n",
"sequence_6 = \"\"\n",
"sequence_7 = \"\"\n",
"sequence_8 = \"\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "rowN0bVYLe9n"
},
"outputs": [],
"source": [
"from alphafold.notebooks import notebook_utils\n",
"\n",
"input_sequences = (\n",
" sequence_1,\n",
" sequence_2,\n",
" sequence_3,\n",
" sequence_4,\n",
" sequence_5,\n",
" sequence_6,\n",
" sequence_7,\n",
" sequence_8,\n",
")\n",
"\n",
"# If folding a complex target and all the input sequences are\n",
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
"# otherwise or if the origin is unknown.\n",
"\n",
"is_prokaryote = False # @param {type:\"boolean\"}\n",
"\n",
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
"MAX_MULTIMER_LENGTH = 2500\n",
"\n",
"# Validate the input.\n",
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
" input_sequences=input_sequences,\n",
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "db551d4877ea"
},
"source": [
"## Search against genetic databases\n",
"\n",
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "2tTeTTsLKPjB"
},
"outputs": [],
"source": [
"import collections\n",
"import copy\n",
"import random\n",
"from concurrent import futures\n",
"from urllib import request\n",
"\n",
"import matplotlib.pyplot as plt\n",
"import numpy as np\n",
"import py3Dmol\n",
"from alphafold.common import protein\n",
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
" pipeline_multimer)\n",
"from alphafold.data.tools import jackhmmer\n",
"from alphafold.model import config, data, model\n",
"from alphafold.relax import relax, utils\n",
"from IPython import display\n",
"from ipywidgets import GridspecLayout, Output\n",
"\n",
"# Color bands for visualizing plddt\n",
"PLDDT_BANDS = [\n",
" (0, 50, \"#FF7D45\"),\n",
" (50, 70, \"#FFDB13\"),\n",
" (70, 90, \"#65CBF3\"),\n",
" (90, 100, \"#0053D6\"),\n",
"]\n",
"\n",
"# --- Find the closest source ---\n",
"test_url_pattern = (\n",
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
")\n",
"ex = futures.ThreadPoolExecutor(3)\n",
"\n",
"\n",
"def fetch(source):\n",
" request.urlretrieve(test_url_pattern.format(source))\n",
" return source\n",
"\n",
"\n",
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
"source = None\n",
"for f in futures.as_completed(fs):\n",
" source = f.result()\n",
" ex.shutdown()\n",
" break\n",
"\n",
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
"# The z_value is the number of sequences in a database.\n",
"MSA_DATABASES = [\n",
" {\n",
" \"db_name\": \"uniref90\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 59,\n",
" \"z_value\": 135_301_051,\n",
" },\n",
" {\n",
" \"db_name\": \"smallbfd\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
" \"num_streamed_chunks\": 17,\n",
" \"z_value\": 65_984_053,\n",
" },\n",
" {\n",
" \"db_name\": \"mgnify\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
" \"num_streamed_chunks\": 71,\n",
" \"z_value\": 304_820_129,\n",
" },\n",
"]\n",
"\n",
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
" MSA_DATABASES.extend(\n",
" [\n",
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
" {\n",
" \"db_name\": \"uniprot\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 98,\n",
" \"z_value\": 219_174_961 + 565_254,\n",
" },\n",
" ]\n",
" )\n",
"\n",
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
"\n",
"MAX_HITS = {\n",
" \"uniref90\": 10_000,\n",
" \"smallbfd\": 5_000,\n",
" \"mgnify\": 501,\n",
" \"uniprot\": 50_000,\n",
"}\n",
"\n",
"\n",
"def get_msa(fasta_path):\n",
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
"\n",
" # Run the search against chunks of genetic databases.\n",
" raw_msa_results = collections.defaultdict(list)\n",
" with tqdm.notebook.tqdm(\n",
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
" ) as pbar:\n",
"\n",
" def jackhmmer_chunk_callback(i):\n",
" pbar.update(n=1)\n",
"\n",
" for db_config in MSA_DATABASES:\n",
" db_name = db_config[\"db_name\"]\n",
" pbar.set_description(f\"Searching {db_name}\")\n",
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
" binary_path=JACKHMMER_BINARY_PATH,\n",
" database_path=db_config[\"db_path\"],\n",
" get_tblout=True,\n",
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
" streaming_callback=jackhmmer_chunk_callback,\n",
" z_value=db_config[\"z_value\"],\n",
" )\n",
" # Group the results by database name.\n",
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
"\n",
" return raw_msa_results\n",
"\n",
"\n",
"features_for_chain = {}\n",
"raw_msa_results_for_sequence = {}\n",
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
"\n",
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
" with open(fasta_path, \"wt\") as f:\n",
" f.write(f\">query\\n{sequence}\")\n",
"\n",
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
" if sequence not in raw_msa_results_for_sequence:\n",
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
" else:\n",
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
"\n",
" # Extract the MSAs from the Stockholm files.\n",
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
" single_chain_msas = []\n",
" uniprot_msa = None\n",
" for db_name, db_results in raw_msa_results.items():\n",
" merged_msa = notebook_utils.merge_chunked_msa(\n",
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
" )\n",
" if merged_msa.sequences and db_name != \"uniprot\":\n",
" single_chain_msas.append(merged_msa)\n",
" msa_size = len(set(merged_msa.sequences))\n",
" print(\n",
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
" )\n",
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
" uniprot_msa = merged_msa\n",
"\n",
" notebook_utils.show_msa_info(\n",
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
" )\n",
"\n",
" # Turn the raw data into model features.\n",
" feature_dict = {}\n",
" feature_dict.update(\n",
" pipeline.make_sequence_features(\n",
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
" )\n",
" )\n",
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
" feature_dict.update(\n",
" notebook_utils.empty_placeholder_template_features(\n",
" num_templates=0, num_res=len(sequence)\n",
" )\n",
" )\n",
"\n",
" # Construct the all_seq features only for heteromers, not homomers.\n",
" if (\n",
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
" and len(set(sequences)) > 1\n",
" ):\n",
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
" \"msa_uniprot_accession_identifiers\",\n",
" \"msa_species_identifiers\",\n",
" )\n",
" all_seq_features = {\n",
" f\"{k}_all_seq\": v\n",
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
" if k in valid_feats\n",
" }\n",
" feature_dict.update(all_seq_features)\n",
"\n",
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
"\n",
"\n",
"# Do further feature post-processing depending on the model type.\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
"\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" all_chain_features = {}\n",
" for chain_id, chain_features in features_for_chain.items():\n",
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
" chain_features, chain_id\n",
" )\n",
"\n",
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
"\n",
" np_example = feature_processing.pair_and_merge(\n",
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
" )\n",
"\n",
" # Pad MSA to avoid zero-sized extra_msa.\n",
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9640643486bd"
},
"source": [
"## Run AlphaFold\n",
"\n",
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "XUo6foMQxwS2"
},
"outputs": [],
"source": [
"run_relax = True\n",
"\n",
"# --- Run the model ---\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
"\n",
"output_dir = \"prediction\"\n",
"os.makedirs(output_dir, exist_ok=True)\n",
"\n",
"plddts = {}\n",
"ranking_confidences = {}\n",
"pae_outputs = {}\n",
"unrelaxed_proteins = {}\n",
"\n",
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" for model_name in model_names:\n",
" pbar.set_description(f\"Running {model_name}\")\n",
"\n",
" cfg = config.model_config(model_name)\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" cfg.data.eval.num_ensemble = 1\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" cfg.model.num_ensemble_eval = 1\n",
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
" model_runner = model.RunModel(cfg, params)\n",
" processed_feature_dict = model_runner.process_features(\n",
" np_example, random_seed=0\n",
" )\n",
" prediction = model_runner.predict(\n",
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
" )\n",
"\n",
" mean_plddt = prediction[\"plddt\"].mean()\n",
"\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" if \"predicted_aligned_error\" in prediction:\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
" else:\n",
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
" # should never get selected.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" # Multimer models are sorted by pTM+ipTM.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
"\n",
" # Set the b-factors to the per-residue plddt.\n",
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
" unrelaxed_protein = protein.from_prediction(\n",
" processed_feature_dict,\n",
" prediction,\n",
" b_factors=b_factors,\n",
" remove_leading_feature_dimension=(\n",
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
" ),\n",
" )\n",
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
"\n",
" # Delete unused outputs to save memory.\n",
" del model_runner\n",
" del params\n",
" del prediction\n",
" pbar.update(n=1)\n",
"\n",
" # --- AMBER relax the best model ---\n",
"\n",
" # Find the best model according to the mean pLDDT.\n",
" best_model_name = max(\n",
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
" )\n",
"\n",
" if run_relax:\n",
" pbar.set_description(\"AMBER relaxation\")\n",
" amber_relaxer = relax.AmberRelaxation(\n",
" max_iterations=0,\n",
" tolerance=2.39,\n",
" stiffness=10.0,\n",
" exclude_residues=[],\n",
" max_outer_iterations=3,\n",
" )\n",
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
" prot=unrelaxed_proteins[best_model_name]\n",
" )\n",
" else:\n",
" print(\"Warning: Running without the relaxation stage.\")\n",
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
" pbar.update(n=1) # Finished AMBER relax.\n",
"\n",
"# Construct multiclass b-factors to indicate confidence bands\n",
"# 0=very low, 1=low, 2=confident, 3=very high\n",
"banded_b_factors = []\n",
"for plddt in plddts[best_model_name]:\n",
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
" if plddt >= min_val and plddt <= max_val:\n",
" banded_b_factors.append(idx)\n",
" break\n",
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
"\n",
"\n",
"# Write out the prediction\n",
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
"with open(pred_output_path, \"w\") as f:\n",
" f.write(relaxed_pdb)\n",
"\n",
"\n",
"# --- Visualise the prediction & confidence ---\n",
"show_sidechains = True\n",
"\n",
"\n",
"def plot_plddt_legend():\n",
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
" thresh = [\n",
" \"Very low (pLDDT < 50)\",\n",
" \"Low (70 > pLDDT > 50)\",\n",
" \"Confident (90 > pLDDT > 70)\",\n",
" \"Very high (pLDDT > 90)\",\n",
" ]\n",
"\n",
" colors = [x[2] for x in PLDDT_BANDS]\n",
"\n",
" plt.figure(figsize=(2, 2))\n",
" for c in colors:\n",
" plt.bar(0, 0, color=c)\n",
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
" plt.xticks([])\n",
" plt.yticks([])\n",
" ax = plt.gca()\n",
" ax.spines[\"right\"].set_visible(False)\n",
" ax.spines[\"top\"].set_visible(False)\n",
" ax.spines[\"left\"].set_visible(False)\n",
" ax.spines[\"bottom\"].set_visible(False)\n",
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
" return plt\n",
"\n",
"\n",
"# Show the structure coloured by chain if the multimer model has been used.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" multichain_view = py3Dmol.view(width=800, height=600)\n",
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
" multichain_view.zoomTo()\n",
" multichain_view.show()\n",
"\n",
"# Color the structure by per-residue pLDDT\n",
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
"view = py3Dmol.view(width=800, height=600)\n",
"view.addModelsAsFrames(to_visualize_pdb)\n",
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
"if show_sidechains:\n",
" style[\"stick\"] = {}\n",
"view.setStyle({\"model\": -1}, style)\n",
"view.zoomTo()\n",
"\n",
"grid = GridspecLayout(1, 2)\n",
"out = Output()\n",
"with out:\n",
" view.show()\n",
"grid[0, 0] = out\n",
"\n",
"out = Output()\n",
"with out:\n",
" plot_plddt_legend().show()\n",
"grid[0, 1] = out\n",
"\n",
"display.display(grid)\n",
"\n",
"# Display pLDDT and predicted aligned error (if output by the model).\n",
"if pae_outputs:\n",
" num_plots = 2\n",
"else:\n",
" num_plots = 1\n",
"\n",
"plt.figure(figsize=[8 * num_plots, 6])\n",
"plt.subplot(1, num_plots, 1)\n",
"plt.plot(plddts[best_model_name])\n",
"plt.title(\"Predicted LDDT\")\n",
"plt.xlabel(\"Residue\")\n",
"plt.ylabel(\"pLDDT\")\n",
"\n",
"if num_plots == 2:\n",
" plt.subplot(1, 2, 2)\n",
" pae, max_pae = list(pae_outputs.values())[0]\n",
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
" plt.colorbar(fraction=0.046, pad=0.04)\n",
"\n",
" # Display lines at chain boundaries.\n",
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
" chain_ids = best_unrelaxed_prot.chain_index\n",
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
" if chain_boundary.size:\n",
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
"\n",
" plt.title(\"Predicted Aligned Error\")\n",
" plt.xlabel(\"Scored residue\")\n",
" plt.ylabel(\"Aligned residue\")\n",
"\n",
"# Save the predicted aligned error (if it exists).\n",
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
"if pae_outputs:\n",
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
" with open(pae_output_path, \"w\") as f:\n",
" f.write(pae_data)\n",
"\n",
"!zip -q -r {output_dir}.zip {output_dir}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lUQAn5LYC5n4"
},
"source": [
"### Interpreting the prediction\n",
"\n",
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
"\n",
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jeb2z8DIA4om"
},
"source": [
"## FAQ & Troubleshooting\n",
"\n",
"\n",
"* How do I get a predicted protein structure for my protein?\n",
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
"* How long will this take?\n",
" * The search against genetic databases can take minutes to hours.\n",
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
"* My notebook no longer seems to be doing anything, what should I do?\n",
" * Some steps may take minutes to hours to complete.\n",
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
"* How does this compare to the open-source version of AlphaFold?\n",
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
"* Does this tool install anything on my computer?\n",
" * No, everything happens in the VM instance within your Google Cloud project.\n",
"* How should I share feedback and bug reports?\n",
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
"\n",
"\n",
"## Related work\n",
"\n",
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
"\n",
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "YfPhvYgKC81B"
},
"source": [
"# License and Disclaimer\n",
"\n",
"This is not an officially-supported Google product.\n",
"\n",
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
"\n",
"Copyright 2021 DeepMind Technologies Limited.\n",
"\n",
"\n",
"## AlphaFold Code License\n",
"\n",
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
"\n",
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
"\n",
"## Model Parameters License\n",
"\n",
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
"\n",
"\n",
"## Third-party software\n",
"\n",
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
"\n",
"\n",
"## Mirrored Databases\n",
"\n",
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
]
}
],
"metadata": {
"accelerator": "GPU",
"colab": {
"collapsed_sections": [],
"name": "AlphaFold.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,82 +0,0 @@
# Copyright 2022 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
ARG CUDA_MAJOR=11
ARG CUDA_MINOR=0
FROM gcr.io/deeplearning-platform-release/base-cu110
ARG CUDA_MAJOR
ARG CUDA_MINOR
SHELL ["/bin/bash", "-c"]
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
build-essential \
cmake \
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
git \
hmmer \
kalign \
tzdata \
wget \
&& rm -rf /var/lib/apt/lists/*
# Compile HHsuite from source.
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
&& mkdir /tmp/hh-suite/build \
&& pushd /tmp/hh-suite/build \
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
&& make -j 4 && make install \
&& ln -s /opt/hhsuite/bin/* /usr/bin \
&& popd \
&& rm -rf /tmp/hh-suite
ENV PATH="/opt/conda/bin:$PATH"
RUN conda update -qy conda \
&& conda install -y -c conda-forge \
openmm=7.5.1 \
cudatoolkit==${CUDA_VERSION} \
pdbfixer \
pip \
python=3.7
COPY . /app/alphafold
# Install pip packages.
RUN pip3 install --upgrade pip \
&& pip3 install -r /app/alphafold/requirements.txt \
&& pip3 install py3Dmol tqdm \
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
https://storage.googleapis.com/jax-releases/jax_releases.html
# Install alphafold.
WORKDIR /app/alphafold
RUN python setup.py install
# Apply OpenMM patch.
WORKDIR /opt/conda/lib/python3.7/site-packages
RUN patch -p0 < /app/alphafold/docker/openmm.patch
# Creating a tmp location for jackhmmr; not mounting through to host though.
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
# details.
# ENTRYPOINT does not support easily running multiple commands, so instead we
# write a shell script to wrap them up.
WORKDIR /home/jupyter
RUN echo '#!/bin/bash\nldconfig\n\'
@@ -1,20 +0,0 @@
#!/usr/bin/env bash
set -e
# Prod (Publicly viewable)
PROJECT=cloud-devrel-public-resources
REPOSITORY=alphafold
LOCAL_IMAGE=alphafold-on-gcp
REMOTE_IMAGE=${LOCAL_IMAGE?}
TAG=latest
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
git clone https://github.com/deepmind/alphafold.git
cp Dockerfile alphafold/docker/Dockerfile
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
sudo docker push ${REGISTRY?}
Binary file not shown.

Before

Width:  |  Height:  |  Size: 3.1 KiB

@@ -1,52 +0,0 @@
# Overview
*Pluto* is a programming environment for Julia, designed to be interactive and helpful. It provides a familiar notebook interface but it is not a Jupyter notebook. The biggest difference is that Pluto notebooks are reactive, changing a variable or function in one cell causes the cells that depend on that variable or function to be reevaluated. Pluto also provides useful interaction mechanisms that allow users to dynamically interact with the notebooks computation state.
The JuliaCon 2020 presentation: [Interactive notebooks ~ Pluto.jl]() provides a good introduction to Pluto. The source is at [fonsp/Pluto.jl]()
# Install Pluto
## Create a Vertex AI JupyterLab Instance
1. From the [GCP console](https://console.cloud.google.com) "hamburger menu"
select Vertex AI > Workbench
2. Click NEW NOTEBOOK
* Choose Python 3 if you won't be using a GPU
* Choose Python 3 (CUDA Toolkit xx.y) if you do want use a GPU
3. Give the notebook an appropriate name
4. Edit Notebook properties if you have special requirements otherwise accept the defaults and click CREATE
5. When the notebook instance is ready click OPEN JUPYTERLAB
## Configure JupyterLab
1. Open a terminal by clicking the Terminal icon.
1. Install the plutoserver
pip3 install git+https://github.com/fonsp/pluto-on-jupyterlab.git
1. In a browser go to [julialang.org/downloads](https://julialang.org/downloads/)
1. In the Current stable release right click on the `Generic Linux on x86 / 64-bit (glibc)` link
Select copy link address
1. Back in the terminal switch to root via
sudo -i
1. Download the release to /opt and install julia in /usr/local/bin
```bash
cd /opt
wget <paste the release link address>
tar xf <name of the downloaded tar file>
ln -s /opt/<julia-x.y.z>/bin/julia /usr/local/bin
^d
```
1. Add the Pluto package to Julia
```bash
julia
julia> ]add Pluto
julia> bksp
julia> using Pluto
julia> ^d
```
1. From the JupyterLab menu bar select File > Shut Down
# Start Pluto
1. Click OPEN JUPYTERLAB in the Workbench
1. In the Notebook section of the Launcher click Pluto.jl
1. The welcome to Pluto.jl screen should appear
@@ -1,347 +1,391 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "20a5ea0081d0"
},
"source": [
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8752d4a255fb"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b5ae674177e"
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "19a9b3bdd553"
},
"outputs": [],
"source": [
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5307fe28b633"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "46cb58c7fbf9"
},
"source": [
"### Built Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "97e66e9f9bab"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ae9b29c4773f"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "dc1e84d5dec2"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6964be27b98e"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "594a91f438f2"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "93134273261e"
},
"outputs": [],
"source": [
"content_name = content_name + \"-gpu\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c2bd82dbcd9b"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ebc593c6472e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "0769e8e34c2f"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "023f33ece826"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 1\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"args = [\n",
" \"--backend\",\n",
" \"nccl\",\n",
" \"--batch-size\",\n",
" \"128\",\n",
" \"--epochs\",\n",
" \"25\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d4b599e726ef"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "81321e3bdf7f"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" accelerator_count=accelerator_count,\n",
" accelerator_type=accelerator_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "5100712c2c4c"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f9b77676e5a6"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0e171ce95ace"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cf1b74a12b87"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a0b15089c341"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
"nbformat": 4,
"nbformat_minor": 0
}
{
"cell_type": "markdown",
"source": [
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Built Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri=f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
},
"execution_count": null,
"outputs": []
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = content_name + \"-gpu\"\n",
"\n",
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"args = [\n",
" '--backend', 'nccl',\n",
" '--batch-size', '128',\n",
" '--epochs', '25',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
},
"execution_count": null,
"outputs": []
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_count=accelerator_count,\n",
" accelerator_type=accelerator_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -19,7 +19,7 @@ Adapted from: https://github.com/narumiruna/pytorch-distributed-example
import argparse
import os
import shutil
import tempfile
import torch
from torch import distributed
@@ -29,6 +29,8 @@ from torch.utils.tensorboard import SummaryWriter
from torchvision import datasets, transforms
import utils
def parse_args():
parser = argparse.ArgumentParser()
@@ -41,9 +43,6 @@ def parse_args():
parser.add_argument(
'--tensorboard-log-dir', default=os.getenv('AIP_TENSORBOARD_LOG_DIR'), type=str,
help='a Cloud Storage URI of a directory intended for saving TensorBoard')
parser.add_argument(
'--checkpoint-dir', default=os.getenv('AIP_CHECKPOINT_DIR'), type=str,
help='a Cloud Storage URI of a directory intended for saving checkpoints')
parser.add_argument(
'--backend', type=str, default='gloo',
@@ -69,6 +68,7 @@ def parse_args():
'-lr', '--learning-rate', type=float, default=1e-3)
parser.add_argument(
'--batch-size', type=int, default=128)
parser.add_argument(
'--local-mode', action='store_true', help='use local mode when running on your local machine')
@@ -76,12 +76,6 @@ def parse_args():
return args
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def distributed_is_initialized():
if distributed.is_available():
if distributed.is_initialized():
@@ -182,7 +176,7 @@ class Trainer(object):
for epoch in range(1, epochs + 1):
print('Epoch: {}, Training ...'.format(epoch))
print("Epoch: {}, Training ...".format(epoch))
train_loss, train_acc = self.train()
if is_chief:
@@ -248,30 +242,16 @@ def main():
local_data_dir = './tmp/data'
local_model_dir = './tmp/model'
local_tensorboard_log_dir = './tmp/logs'
local_checkpoint_dir = './tmp/checkpoints'
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
checkpoint_dir = args.checkpoint_dir or local_checkpoint_dir
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
if checkpoint_dir and checkpoint_dir.startswith(gs_prefix):
checkpoint_dir = checkpoint_dir.replace(gs_prefix, gcsfuse_prefix)
#TODO: update when gcsfuse ready
gcsfuse_ready = False
model_dir = (gcsfuse_ready and args.model_dir) or local_model_dir
tensorboard_log_dir = (gcsfuse_ready and
args.tensorboard_log_dir) or local_tensorboard_log_dir
writer = SummaryWriter(tensorboard_log_dir)
is_chief = args.rank == 0
if is_chief:
makedirs(checkpoint_dir)
print(f'Checkpoints will be saved to {checkpoint_dir}')
checkpoint_path = os.path.join(checkpoint_dir, 'checkpoint.pt')
print(f'checkpoint_path is {checkpoint_path}')
if args.world_size > 1:
print('Initializing distributed backend with {} nodes'.format(args.world_size))
@@ -281,38 +261,36 @@ def main():
world_size=args.world_size,
rank=args.rank,
)
print(f'[{os.getpid()}]: '
f'world_size = {distributed.get_world_size()}, '
f'rank = {distributed.get_rank()}, '
f'backend={distributed.get_backend()} \n', end='')
print(f"[{os.getpid()}]: "
f"world_size = {distributed.get_world_size()}, "
f"rank = {distributed.get_rank()}, "
f"backend={distributed.get_backend()} \n", end='')
if torch.cuda.is_available() and not args.no_cuda:
device = torch.device('cuda:{}'.format(args.rank))
device = torch.device("cuda:{}".format(args.rank))
else:
device = torch.device('cpu')
device = torch.device("cpu")
model = Net(device=device)
if distributed_is_initialized():
model.to(device)
model = DistributedDataParallel(model)
checkpoint_path = tempfile.gettempdir() + "/model.checkpoint"
if is_chief:
# All processes should see same parameters as they all start from same
# random parameters and gradients are synchronized in backward passes.
# Therefore, saving it in one process is sufficient.
torch.save(model.state_dict(), checkpoint_path)
print(f'Initial chief checkpoint is saved to {checkpoint_path}')
# Use a barrier() to make sure that process 1 loads the model after process
# 0 saves it.
if distributed_is_initialized():
distributed.barrier()
# configure map_location properly
model.load_state_dict(torch.load(checkpoint_path, map_location=device))
print(f'Initial chief checkpoint is saved to {checkpoint_path} with map_location {device}')
map_location = {'cuda:%d' % 0: 'cuda:%d' % args.rank}
model.load_state_dict(torch.load(checkpoint_path, map_location=map_location))
else:
model.load_state_dict(torch.load(checkpoint_path))
print(f'Initial chief checkpoint is loaded from {checkpoint_path}')
optimizer = torch.optim.Adam(model.parameters(), lr=args.learning_rate)
@@ -332,12 +310,29 @@ def main():
)
trainer.fit(args.epochs, is_chief, writer)
if model_dir == local_model_dir:
makedirs(model_dir)
if is_chief and model_dir == local_model_dir:
utils.makedirs(model_dir)
trainer.save(model_dir)
print(f'Model is saved to {model_dir}')
if is_chief and not args.local_mode:
utils.gcs_upload(
dir=model_dir,
local_dir=local_model_dir,
gcs_dir=args.model_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode,
)
print(f'Tensorboard logs are saved to: {tensorboard_log_dir}')
if is_chief and not args.local_mode:
utils.gcs_upload(
dir=tensorboard_log_dir,
local_dir=local_tensorboard_log_dir,
gcs_dir=args.tensorboard_log_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode,
)
writer.close()
@@ -0,0 +1,31 @@
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the \"License\");
# you may not use this file except in compliance with the License.\n",
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an \"AS IS\" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import os
import shutil
import subprocess
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def gcs_upload(dir, local_dir, gcs_dir, gcsfuse_ready, local_mode):
if not local_mode and dir == local_dir and not gcsfuse_ready:
subprocess.run(['gsutil', 'cp', '-r',
local_dir,
os.path.dirname(gcs_dir)])
print(f'{local_dir} is uploaded to {gcs_dir}')
return
@@ -16,7 +16,6 @@ import argparse
import copy
import os
import pathlib
import shutil
import time
import torch
@@ -25,6 +24,8 @@ from torch.utils.tensorboard import SummaryWriter
from torchvision import datasets, models, transforms
import utils
def parse_args():
parser = argparse.ArgumentParser()
@@ -61,12 +62,6 @@ def parse_args():
return args
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def download_data(data_dir):
dataset_url = 'https://download.pytorch.org/tutorial/hymenoptera_data.zip'
@@ -212,17 +207,13 @@ def main():
local_model_dir = './tmp/model'
local_tensorboard_log_dir = './tmp/logs'
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
#TODO: update when gcsfuse ready
gcsfuse_ready = False
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
model_dir = (gcsfuse_ready and args.model_dir) or local_model_dir
tensorboard_log_dir = (gcsfuse_ready and
args.tensorboard_log_dir) or local_tensorboard_log_dir
makedirs(model_dir)
writer = SummaryWriter(tensorboard_log_dir)
device = torch.device("cuda:0" if torch.cuda.is_available() else "cpu")
@@ -234,6 +225,9 @@ def main():
dataset_sizes = {x: len(image_datasets[x]) for x in ['train', 'val']}
print(f'Dataset sizes: {dataset_sizes}')
if model_dir == local_model_dir:
utils.makedirs(model_dir)
dataloaders = {
x: torch.utils.data.DataLoader(
image_datasets[x],
@@ -272,8 +266,22 @@ def main():
torch.save(model.state_dict(), model_path)
print(f'Model is saved to {model_dir}')
utils.gcs_upload(
dir=model_dir,
local_dir=local_model_dir,
gcs_dir=args.model_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode
)
print(f'Tensorboard logs are saved to: {tensorboard_log_dir}')
utils.gcs_upload(
dir=tensorboard_log_dir,
local_dir=local_tensorboard_log_dir,
gcs_dir=args.tensorboard_log_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode
)
writer.close()
@@ -0,0 +1,31 @@
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the \"License\");
# you may not use this file except in compliance with the License.\n",
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an \"AS IS\" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import os
import shutil
import subprocess
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def gcs_upload(dir, local_dir, gcs_dir, gcsfuse_ready, local_mode):
if not local_mode and dir == local_dir and not gcsfuse_ready:
subprocess.run(['gsutil', 'cp', '-r',
local_dir,
os.path.dirname(gcs_dir)])
print(f'{local_dir} is uploaded to {gcs_dir}')
return
@@ -1,431 +1,507 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d229c51d7335"
},
"source": [
"# PyTorch Image Classification Single GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "08b6ccb2de0f"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_single_gpu_with_vertex_sdk_and_torchserve/vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "410ef4707617"
},
"outputs": [],
"source": [
"content_name = \"pt-img-cls-gpu-cust-cont-torchserve\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ed102448ae75"
},
"source": [
"## Local Training"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "47dfe4e1dfe6"
},
"outputs": [],
"source": [
"! ls trainer"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "be6fcb587414"
},
"outputs": [],
"source": [
"! cat trainer/requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "060178a8ad71"
},
"outputs": [],
"source": [
"! pip install -r trainer/requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4421e56c4ee3"
},
"outputs": [],
"source": [
"! cat trainer/task.py"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4bb2f6fc75cc"
},
"outputs": [],
"source": [
"%run trainer/task.py --epochs 5 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cb748af8f2b8"
},
"outputs": [],
"source": [
"! ls ./tmp"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2ca1626c5dbd"
},
"outputs": [],
"source": [
"! rm -rf ./tmp"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "4eb55916219c"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "e61fc5c1b9e0"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c70a580cc6d4"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name_train = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri_train = f\"{hostname}/{PROJECT_ID}/{image_name_train}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e58c75158872"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri_train -f Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bde55966086a"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri_train --epochs 5 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f4a3cdb78045"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri_train"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "526115eabf35"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f026b57d265e"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "19c02e9e9b8d"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a0deece1086e"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1ec68e279ed1"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d945f0e32b02"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cb13cc82acc5"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d04453c214d2"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4b5b5dea03c8"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" \"--batch-size\",\n",
" \"256\",\n",
" \"--epochs\",\n",
" \"100\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b2073fb5824e"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri_train,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d442a02878d1"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "29b14f2289f3"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3ab127e5f2b2"
},
"source": [
"### Training Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8e0c74a00dee"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "vertex_training_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
"nbformat": 4,
"nbformat_minor": 0
}
{
"cell_type": "markdown",
"source": [
"# PyTorch Image Classification Single GPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_single_gpu_with_vertex_sdk_and_torchserve/vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"pt-img-cls-gpu-cust-cont-torchserve\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Local Training"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! ls trainer"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cat trainer/requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r trainer/requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cat trainer/task.py"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"%run trainer/task.py --epochs 5 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! ls ./tmp"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! rm -rf ./tmp"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Build Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name_train = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri_train=f\"{hostname}/{PROJECT_ID}/{image_name_train}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri_train -f Dockerfile ."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri_train --epochs 5 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri_train"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" '--batch-size', '256',\n",
" '--epochs', '100',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri_train,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix\n"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,6 +1,6 @@
# PyTorch on Google Cloud: Text Classification
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
@@ -9,7 +9,6 @@ This tutorial on text classification shows how to train a PyTorch based text cla
| <h4>Notebook</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
## Folders
@@ -1,7 +1,6 @@
# Use pytorch GPU base image
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
# set working directory
WORKDIR /app
@@ -22,18 +22,15 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
# BUCKET_NAME: Change to your bucket name.
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
# JOB_NAME: the name of your job running on AI Platform.
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# This can be a GCS location to a zipped and uploaded package
PACKAGE_PATH=./trainer
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
# or use the default '`us-central1`'. The region is where the job will be run.
REGION="us-central1"
@@ -44,8 +41,11 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
# IMAGE_TAG: an easily identifiable tag for your docker image
IMAGE_TAG=latest
# IMAGE_URI: the complete URI location for Cloud Container Registry
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
# Build the docker image
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
@@ -53,19 +53,11 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
# Deploy the docker image to Cloud Container Registry
docker push ${CUSTOM_TRAIN_IMAGE_URI}
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--worker-pool-spec="${worker_pool_spec}" \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
Binary file not shown.

Before

Width:  |  Height:  |  Size: 45 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 37 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 248 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 38 KiB

@@ -2,13 +2,10 @@
FROM pytorch/torchserve:latest-cpu
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
USER model-server
# copy model artifacts, custom handler and other dependencies
COPY ./custom_handler.py /home/model-server/
COPY ./custom_text_handler.py /home/model-server/
COPY ./index_to_name.json /home/model-server/
COPY ./model/finetuned-bert-classifier/ /home/model-server/
@@ -24,7 +21,7 @@ EXPOSE 7080
EXPOSE 7081
# create model archive file packaging model artifacts and dependencies
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
# run Torchserve HTTP serve to respond to prediction requests
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
@@ -1,37 +0,0 @@
FROM pytorch/torchserve:latest-cpu
USER root
# run and update some basic packages software packages, including security libs
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
# Install gcloud tools for gsutil as well as debugging
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
USER model-server
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
ARG MODEL_NAME=finetuned-bert-classifier
ENV MODEL_NAME="${MODEL_NAME}"
# health and prediction listener ports
ARG AIP_HTTP_PORT=7080
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
ARG MODEL_MGMT_PORT=7081
# expose health and prediction listener ports from the image
EXPOSE "${AIP_HTTP_PORT}"
EXPOSE "${MODEL_MGMT_PORT}"
EXPOSE 8080 8081 8082 7070 7071
# create torchserve configuration file
USER root
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
USER model-server
# run Torchserve HTTP serve to respond to prediction requests
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
@@ -52,8 +52,7 @@ class TransformersClassifierHandler(BaseHandler):
with open(mapping_file_path) as f:
self.mapping = json.load(f)
else:
logger.warning('Missing the index_to_name.json file. Inference output will default.')
self.mapping = {"0": "Negative", "1": "Positive"}
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
self.initialized = True
@@ -89,3 +88,4 @@ class TransformersClassifierHandler(BaseHandler):
def postprocess(self, inference_output):
return inference_output
@@ -19,19 +19,13 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
# BUCKET_NAME: Change to your bucket name
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
# The PyTorch image provided by Vertex AI Training.
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
# JOB_NAME: the name of your job running on Vertex AI.
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
@@ -41,21 +35,19 @@ REGION="us-central1"
# JOB_DIR: Where to store prepared package and upload output model.
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
executor-image-uri=${IMAGE_URI},\
python-module=trainer.task,\
local-package-path=../python_package/"
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--worker-pool-spec="${worker_pool_spec}" \
--python-package-uris=${PACKAGE_PATH} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
@@ -122,9 +122,6 @@ def run(args):
# Train / Test the model
trainer = train(args, text_classifier, train_dataset, test_dataset)
metrics = trainer.evaluate(eval_dataset=test_dataset)
trainer.save_metrics("all", metrics)
# Export the trained model
trainer.save_model(os.path.join("/tmp", args.model_name))
@@ -63,20 +63,20 @@
"- [Training](#Training)\n",
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
"- [Tuning](#Hyperparameter-Tuning) \n",
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
"- [Deploying](#Deploying)\n",
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
"\n",
"### Costs \n",
"\n",
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
"\n",
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Notebooks](https://cloud.google.com/notebooks)\n",
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Cloud Storage](https://cloud.google.com/storage)\n",
"* [Container Registry](https://cloud.google.com/container-registry)\n",
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
@@ -202,9 +202,9 @@
"id": "e0c1dcadc2c8"
},
"source": [
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"\n",
"#### Install Vertex AI SDK for Python"
"#### Install Vertex SDK for Python"
]
},
{
@@ -1199,7 +1199,7 @@
"source": [
"### Run predictions locally with sample examples\n",
"\n",
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
]
},
{
@@ -1382,7 +1382,7 @@
"id": "f7466d414a0e"
},
"source": [
"### Run Custom Job on Vertex AI Training with a pre-built container"
"### Run Custom Job on Vertex Training with a pre-built container"
]
},
{
@@ -1395,7 +1395,7 @@
"\n",
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
"\n",
"![Training with Prebuilt Containers on Vertex AI Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
"![Training with Prebuilt Containers on Vertex Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
]
},
{
@@ -1569,7 +1569,7 @@
"source": [
"#### **Run custom training job on Vertex AI**\n",
"\n",
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
]
},
{
@@ -1578,7 +1578,7 @@
"id": "5d2957ef04fd"
},
"source": [
"##### **Initialize the Vertex AI SDK for Python**"
"##### **Initialize the Vertex SDK for Python**"
]
},
{
@@ -1598,7 +1598,7 @@
"id": "6b0fed34b728"
},
"source": [
"##### **Configure and submit Custom Job to Vertex AI Training service**"
"##### **Configure and submit Custom Job to Vertex Training service**"
]
},
{
@@ -1609,7 +1609,7 @@
"source": [
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
"\n",
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
]
},
{
@@ -1686,7 +1686,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job.png)"
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job.png)"
]
},
{
@@ -1798,7 +1798,7 @@
"id": "c170d386492b"
},
"source": [
"### Run Custom Job on Vertex AI Training with custom container"
"### Run Custom Job on Vertex Training with custom container"
]
},
{
@@ -1807,7 +1807,7 @@
"id": "035227b6e581"
},
"source": [
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
"\n",
"![Training with custom containers on Vertex AI](./images/training-with-custom-containers-on-vertex-training.png)"
]
@@ -1834,7 +1834,7 @@
"%%writefile ./custom_container/Dockerfile\n",
"\n",
"# Use pytorch GPU base image\n",
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
"\n",
"# set working directory\n",
"WORKDIR /app\n",
@@ -1968,7 +1968,7 @@
"id": "a23e5e34bea9"
},
"source": [
"##### **Initialize the Vertex AI SDK for Python**"
"##### **Initialize the Vertex SDK for Python**"
]
},
{
@@ -1988,11 +1988,11 @@
"id": "abf1fa4085cb"
},
"source": [
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
"##### **Configure and submit Custom Job to Vertex Training service**\n",
"\n",
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
"\n",
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
]
},
{
@@ -2044,7 +2044,7 @@
},
"outputs": [],
"source": [
"# submit the custom job to Vertex AI training service\n",
"# submit the custom job to Vertex training service\n",
"model = job.run(\n",
" replica_count=1,\n",
" machine_type=\"n1-standard-8\",\n",
@@ -2065,7 +2065,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job-container.png)"
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job-container.png)"
]
},
{
@@ -2148,11 +2148,11 @@
"id": "ba6122f929e3"
},
"source": [
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
"\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"\n",
"![Hyperparameter Tuning with Custom Containers on Vertex AI Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
"![Hyperparameter Tuning with Custom Containers on Vertex Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
]
},
{
@@ -2163,7 +2163,7 @@
"source": [
"### How hyperparameter tuning works in Vertex AI?\n",
"\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
"\n",
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
@@ -2297,7 +2297,7 @@
"source": [
"### Run Hyperparameter Tuning Job on Vertex AI\n",
"\n",
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
]
},
{
@@ -2326,7 +2326,7 @@
"id": "f60fab07d67c"
},
"source": [
"##### **Initialize the Vertex AI SDK for Python**"
"##### **Initialize the Vertex SDK for Python**"
]
},
{
@@ -2346,7 +2346,7 @@
"id": "6652aa63ddff"
},
"source": [
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
"\n",
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
"\n",
@@ -2374,7 +2374,7 @@
"id": "9d46db3a8b23"
},
"source": [
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
]
},
{
@@ -2548,7 +2548,7 @@
"\n",
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor hyperparameter tuning job progress in Vertex AI Training](./images/vertex-training-monitor-hptuning-job-container.png)"
"![Monitor hyperparameter tuning job progress in Vertex Training](./images/vertex-training-monitor-hptuning-job-container.png)"
]
},
{
@@ -2557,7 +2557,7 @@
"id": "ba934b434f03"
},
"source": [
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
]
},
{
@@ -2612,7 +2612,7 @@
"id": "5dbccb2b7d32"
},
"source": [
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
]
},
{
@@ -2701,8 +2701,8 @@
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
"\n",
"# BUCKET_NAME is a required parameter to run the cell.\n",
"BUCKET_NAME=$1\n",
"# BUCKET_NAME: Change to your bucket name\n",
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
"\n",
"# APP_NAME: get application name\n",
"APP_NAME=$2\n",
@@ -2711,7 +2711,7 @@
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
"\n",
"# custom container image URI\n",
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"\n",
"# ========================================================\n",
"# create hyperparameter tuning configuration file\n",
@@ -2772,20 +2772,20 @@
"source": [
"## Deploying\n",
"\n",
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
"\n",
"### Deploying model on Vertex AI Predictions with custom container\n",
"### Deploying model on Vertex Predictions with custom container\n",
"\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
"\n",
"![Serving with Custom Containers on Vertex AI Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"![Serving with Custom Containers on Vertex Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"\n",
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
"\n",
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
]
},
{
@@ -2815,7 +2815,7 @@
},
"outputs": [],
"source": [
"%%writefile predictor/custom_handler.py\n",
"%%writefile predictor/custom_text_handler.py\n",
"\n",
"import os\n",
"import json\n",
@@ -2870,8 +2870,7 @@
" with open(mapping_file_path) as f:\n",
" self.mapping = json.load(f)\n",
" else:\n",
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
"\n",
" self.initialized = True\n",
"\n",
@@ -3048,13 +3047,10 @@
"FROM pytorch/torchserve:latest-cpu\n",
"\n",
"# install dependencies\n",
"RUN python3 -m pip install --upgrade pip\n",
"RUN pip3 install transformers\n",
"\n",
"USER model-server\n",
"\n",
"# copy model artifacts, custom handler and other dependencies\n",
"COPY ./custom_handler.py /home/model-server/\n",
"COPY ./custom_text_handler.py /home/model-server/\n",
"COPY ./index_to_name.json /home/model-server/\n",
"COPY ./model/$APP_NAME/ /home/model-server/\n",
"\n",
@@ -3074,7 +3070,7 @@
" --model-name=$APP_NAME \\\n",
" --version=1.0 \\\n",
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
" --handler=/home/model-server/custom_handler.py \\\n",
" --handler=/home/model-server/custom_text_handler.py \\\n",
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
" --export-path=/home/model-server/model-store\n",
"\n",
@@ -3133,7 +3129,7 @@
"source": [
"#### **Run the container locally** ***[Optional]***\n",
"\n",
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
]
},
{
@@ -3271,9 +3267,9 @@
"id": "69477b3a00c0"
},
"source": [
"#### **Deploying the serving container to Vertex AI Predictions**\n",
"#### **Deploying the serving container to Vertex Predictions**\n",
"\n",
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
]
},
{
@@ -3304,7 +3300,7 @@
"id": "a3da91e19af4"
},
"source": [
"##### **Initialize the Vertex AI SDK for Python**"
"##### **Initialize the Vertex SDK for Python**"
]
},
{
@@ -3441,7 +3437,7 @@
"id": "bc4673478269"
},
"source": [
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
]
},
{
@@ -3491,7 +3487,7 @@
"source": [
"##### **Formatting input for online prediction**\n",
"\n",
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
"\n",
"```\n",
"[\n",
@@ -3564,9 +3560,9 @@
},
"source": [
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"\n",
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
]
},
{
@@ -3657,12 +3653,12 @@
},
"outputs": [],
"source": [
"delete_custom_job = False\n",
"delete_hp_tuning_job = False\n",
"delete_custom_job = True\n",
"delete_hp_tuning_job = True\n",
"delete_endpoint = True\n",
"delete_model = False\n",
"delete_bucket = False\n",
"delete_image = False"
"delete_model = True\n",
"delete_bucket = True\n",
"delete_image = True"
]
},
{
@@ -3690,7 +3686,7 @@
"\n",
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
"\n",
"# Initialize Vertex AI SDK\n",
"# Initialize Vertex SDK\n",
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
]
},
@@ -3928,7 +3924,7 @@
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
"\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" print(\n",
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
" )\n",
@@ -3936,7 +3932,7 @@
" # uncomment below line to delete contents of the bucket\n",
" # ! gsutil rm -r $BUCKET_NAME\n",
"\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" if float(shell_output[0].split()[0]) > 0:\n",
" print(\n",
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
@@ -1,28 +0,0 @@
# Train and deploy a scikit-learn model with Vertex AI
This repository shows how to train and deploy a text classifier using scikit-learn and Vertex AI.
The main used Vertex AI features are:
- Vertex AI Custom Training
- Vertex AI Model
- Vertex AI Endpoint
Further used GCP services are:
- Google Cloud Logging
- Google Cloud Storage
## Repository
├── README.md
├── create_job.ipynb # <-- creates the training job and deploys the model
├── requirements.txt # <-- requirements for deploying the job
└── task.py # <-- contains the training application
## Training job overview
The training job performs the following steps:
1. Downloads the `NewsAggregator` dataset from the UCI Machine Learning Repository
2. Trains and evaluates a classifier using scikit-learn
3. Exports model and evaluation artifacts to GCS
4. Deploys the model as a `Vertex AI Endpoint`
@@ -1,290 +0,0 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "72b875d67303"
},
"source": [
"# Create and run a custom Vertex AI Training Job from a local script"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "398b976f501e"
},
"source": [
"## Install Vertex AI Python Client"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2162adc1d8fe"
},
"outputs": [],
"source": [
"!pip install -r requirements.txt --upgrade"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d4bf4ab70e65"
},
"source": [
"## GCP authentication"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "41084de2e96a"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"os.environ[\n",
" \"GOOGLE_APPLICATION_CREDENTIALS\"\n",
"] = \"\" # TODO: path to credentials .json file"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1ce7efb99a95"
},
"source": [
"## Create the custom Vertex AI Training Job\n",
"\n",
"1. Define the custom job parameters\n",
"2. Submit the job to create a `Vertex AI Model`"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c04b9efb5eb3"
},
"outputs": [],
"source": [
"# Import the Vertex AI SDK (Python Client)\n",
"from google.cloud import aiplatform"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b56f5fdcefd6"
},
"outputs": [],
"source": [
"# Project meta data\n",
"PROJECT_ID = \"\" # TODO\n",
"REGION = \"\" # TODO e.g. europe\n",
"ZONE = \"\" # TODO e.g. west4\n",
"LOCATION = f\"{REGION}-{ZONE}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4af8cfb1e1a1"
},
"outputs": [],
"source": [
"aiplatform.init(project=PROJECT_ID, location=LOCATION)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e23d0161b489"
},
"outputs": [],
"source": [
"# Variables for specifying the job\n",
"DISPLAY_NAME = (\n",
" \"news-classifier-training\" # TODO: How the job is displayed on Vertex AI GUI\n",
")\n",
"SCRIPT_PATH = \"./task.py\" # Path to local training script\n",
"STAGING_BUCKET = (\n",
" \"\" # TODO GCS URI where meta data and artifacts are stored for this job\n",
")\n",
"MODEL_TRAINING_IMAGE = f\"{REGION}-docker.pkg.dev/vertex-ai/training/scikit-learn-cpu.0-23:latest\" # Pre-built training image\n",
"REQUIREMENTS = [\"wget\"] # Additional requirements not already part of the base image\n",
"# !Required if the Training Pipeline produces a managed Vertex AI Model!\n",
"MODEL_SERVING_IMAGE = f\"{REGION}-docker.pkg.dev/vertex-ai/prediction/sklearn-cpu.0-23:latest\" # Pre-built serving image"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "61565ec3e6de"
},
"outputs": [],
"source": [
"# Job definition\n",
"custom_training_job = aiplatform.CustomTrainingJob(\n",
" project=PROJECT_ID,\n",
" location=LOCATION,\n",
" display_name=DISPLAY_NAME,\n",
" script_path=SCRIPT_PATH,\n",
" staging_bucket=STAGING_BUCKET,\n",
" container_uri=MODEL_TRAINING_IMAGE,\n",
" requirements=REQUIREMENTS,\n",
" model_serving_container_image_uri=MODEL_SERVING_IMAGE,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8c8d4bd78688"
},
"outputs": [],
"source": [
"# Variables for running the job\n",
"MACHINE_TYPE = \"n1-standard-4\" # Standard VM with 4 CPUs\n",
"# !Required if the Training Pipeline produces a managed Vertex AI Model!\n",
"MODEL_DISPLAY_NAME = (\n",
" \"news-classifier-model\" # TODO: Name for the resulting managed Vertex AI Model.\n",
")\n",
"# Note that a single job may produce multiple models (e.g. one per run).\n",
"# The url to download the training data from.\n",
"DATASET_URL = \"https://archive.ics.uci.edu/ml/machine-learning-databases/00359/NewsAggregatorDataset.zip\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "13d31a7d0bb5"
},
"outputs": [],
"source": [
"# Run the job\n",
"model = custom_training_job.run(\n",
" machine_type=MACHINE_TYPE,\n",
" model_display_name=MODEL_DISPLAY_NAME,\n",
" args=[f\"--dataset_url={DATASET_URL}\", f\"--project_id={PROJECT_ID}\"],\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8026ac119722"
},
"outputs": [],
"source": [
"MODEL_RESOURCE_NAME = model.resource_name"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2d985fca37f3"
},
"source": [
"## Deploy model to Vertex AI Endpoint\n",
"\n",
"1. Retrieve the registered `Vertex AI Model`\n",
"2. Deploy the model to a new `Vertex AI Endpoint`\n",
"3. Get some test predictions from the endpoint"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "58c08631f94c"
},
"outputs": [],
"source": [
"ENDPOINT_DISPLAY_NAME = \"news-classifier-endpoint\" # TODO\n",
"MACHINE_TYPE_SERVING = \"n1-standard-2\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b54867240880"
},
"outputs": [],
"source": [
"endpoint = aiplatform.Endpoint.create(\n",
" display_name=ENDPOINT_DISPLAY_NAME,\n",
" location=LOCATION,\n",
" project=PROJECT_ID,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a76e7c721b88"
},
"outputs": [],
"source": [
"model = aiplatform.Model(model_name=MODEL_RESOURCE_NAME)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d06714302f81"
},
"outputs": [],
"source": [
"model.deploy(\n",
" endpoint=endpoint,\n",
" deployed_model_display_name=MODEL_DISPLAY_NAME,\n",
" machine_type=MACHINE_TYPE,\n",
" traffic_percentage=100,\n",
" min_replica_count=1,\n",
" max_replica_count=1,\n",
" accelerator_type=None,\n",
" accelerator_count=None,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "5b7eca31d80e"
},
"outputs": [],
"source": [
"endpoint.predict(instances={\"instances\": [\"A news headline to be classified\"]})"
]
}
],
"metadata": {
"colab": {
"name": "create_job.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,2 +0,0 @@
google-cloud-aiplatform
ipykernel
@@ -1,167 +0,0 @@
import argparse
import logging
import os
import pickle
import zipfile
from typing import List, Tuple
import pandas as pd
import wget
from google.cloud import storage
from google.cloud.logging import Client as LogClient
from sklearn.feature_extraction.text import CountVectorizer, TfidfTransformer
from sklearn.model_selection import train_test_split
from sklearn.naive_bayes import MultinomialNB
from sklearn.pipeline import Pipeline
def download_dataset_from_url(url: str) -> pd.DataFrame:
"""Downloads and unzips the dataset from `url` and reads it with pandas.
Args:
url (str, optional): URL to the dataset.
"""
zip_filepath = wget.download(url, out=".")
with zipfile.ZipFile(zip_filepath, "r") as zf:
zf.extract(path=".", member="newsCorpora.csv")
COLUMN_NAMES = ["id", "title", "url", "publisher",
"category", "story", "hostname", "timestamp"]
return pd.read_csv(
"newsCorpora.csv", delimiter="\t", names=COLUMN_NAMES, index_col=0
)
def get_train_test_data(dataframe: pd.DataFrame, test_size: float = 0.2
) -> Tuple[List, List, List, List]:
"""Splits the news dataset into train and test features and labels.
Args:
news (pd.DataFrame): The dataset as pandas DataFrame.
test_size (float): The size in percent of the test data.
Returns:
Tuple[List, List, List, List]: Tuple with train and test data
"""
train, test = train_test_split(dataframe, test_size=test_size)
x_train, y_train = train["title"].values, train["category"].values
x_test, y_test = test["title"].values, test["category"].values
return x_train, y_train, x_test, y_test
def export_model_to_gcs(fitted_pipeline: Pipeline, gcs_uri: str) -> str:
"""Exports trained pipeline to GCS
Parameters:
fitted_pipeline (sklearn.pipelines.Pipeline): the Pipeline object
with data already fitted (trained pipeline object).
gcs_uri (str): GCS path to store the trained pipeline
i.e gs://example_bucket/training-job.
Returns:
export_path (str): Model GCS location
"""
artifact_filename = 'model.pkl'
# Save model artifact to local filesystem (doesn't persist)
local_path = artifact_filename
with open(local_path, 'wb') as model_file:
pickle.dump(fitted_pipeline, model_file)
# Upload model artifact to Cloud Storage
storage_path = os.path.join(gcs_uri, artifact_filename)
blob = storage.blob.Blob.from_string(storage_path, client=storage.Client())
blob.upload_from_filename(local_path)
def export_evaluation_report_to_gcs(report: str, gcs_uri: str) -> None:
"""
Exports training job report to GCS
Parameters:
report (str): Full report in text to sent to GCS
gcs_uri (str): GCS path to store the report
i.e gs://example_bucket/training-job
"""
artifact_filename = 'report.txt'
# Upload model artifact to Cloud Storage
storage_path = os.path.join(gcs_uri, artifact_filename)
blob = storage.blob.Blob.from_string(storage_path, client=storage.Client())
blob.upload_from_string(report)
def train_and_score(X_train: List, y_train: List, X_test: List, y_test: List
) -> Tuple[Pipeline, float]:
"""Trains and cross-validates a text classifier pipeline.
Args:
X_train (List): Train features as list of strings.
y_train (List): Train labels as list of strings.
X_test (List): Test labels as list of strings.
y_test (List): Test labels as list of strings.
Returns:
Tuple[Pipeline, float]: Fitted pipeline and mean accuracy.
"""
pipeline = Pipeline([
("vectorizer", CountVectorizer()),
("tfidf", TfidfTransformer()),
("naivebayes", MultinomialNB()),
])
pipeline.fit(X_train, y_train)
score = pipeline.score(X_test, y_test)
return pipeline, score
# Define all the command line arguments your model can accept for training
if __name__ == "__main__":
parser = argparse.ArgumentParser()
parser.add_argument(
"--dataset_url",
help="Download url for the training data.",
type=str
)
parser.add_argument(
"--project_id",
help="GCP project id for cloud logging.",
type=str
)
args = parser.parse_args()
arguments = args.__dict__
# set up the GCP logger
client = LogClient(project=arguments["project_id"])
client.setup_logging(log_level=logging.INFO)
logging.info("Starting custom training job.")
# download the data from url
logging.info("Downloading training data from: {}".format(arguments["dataset_url"]))
dataframe = download_dataset_from_url(arguments["dataset_url"])
train_test_data = get_train_test_data(dataframe)
# train and cross validate
logging.info("Training started ...")
model, score = train_and_score(*train_test_data)
logging.info(f"Training completed with model score: {score}")
# export model to gcs
_gcs_uri = os.environ["AIP_MODEL_DIR"]
logging.info("Exporting model artifacts ...")
export_model_to_gcs(model, _gcs_uri)
export_evaluation_report_to_gcs(str(score), _gcs_uri)
logging.info(f"Exported model artifacts to GCS bucket: {_gcs_uri}")
@@ -188,14 +188,11 @@
},
"outputs": [],
"source": [
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
"! pip3 install {USER_FLAG} --upgrade kfp\n",
"! pip3 install {USER_FLAG} numpy\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
"! pip3 install {USER_FLAG} --upgrade pillow\n",
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
"! pip3 install {USER_FLAG} --upgrade fastapi"
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow"
]
},
{
@@ -290,7 +287,7 @@
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
@@ -521,7 +518,6 @@
"import os\n",
"import sys\n",
"\n",
"from google.cloud import aiplatform\n",
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"from kfp.v2 import compiler, dsl\n",
"from kfp.v2.google.client import AIPlatformClient"
@@ -561,30 +557,6 @@
"You may use the default values below as is."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "895ac243c125"
},
"outputs": [],
"source": [
"# Dataset parameters\n",
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "62bfb9a820f6"
},
"outputs": [],
"source": [
"# Download the sample data into your RAW_DATA_PATH\n",
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -593,6 +565,9 @@
},
"outputs": [],
"source": [
"# Dataset parameters\n",
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
"\n",
"# Pipeline parameters\n",
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
@@ -660,7 +635,7 @@
"source": [
"#### Run unit tests on the Generator component\n",
"\n",
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
]
},
{
@@ -738,12 +713,12 @@
"TRAINING_ARTIFACTS_DIR = (\n",
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
")\n",
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
"TRAINING_MACHINE_TYPE = (\n",
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
")\n",
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
]
},
{
@@ -794,12 +769,8 @@
"TRAINED_POLICY_DISPLAY_NAME = (\n",
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
")\n",
"TRAFFIC_SPLIT = {\"0\": 100}\n",
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
]
},
{
@@ -929,17 +900,16 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
"from kfp.components import load_component_from_url\n",
"\n",
"generate_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
")\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -1008,7 +978,7 @@
" bigquery_location=bigquery_location,\n",
" bigquery_table_id=bigquery_table_id,\n",
" )\n",
" \n",
"\n",
" # Run the Ingester component.\n",
" ingest_task = ingest_op(\n",
" project_id=project_id,\n",
@@ -1018,16 +988,7 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" train_task = train_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -1035,10 +996,28 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1055,14 +1034,11 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" traffic_split=TRAFFIC_SPLIT,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" )"
]
},
@@ -1077,11 +1053,12 @@
"# Compile the authored pipeline.\n",
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
"\n",
"# Createa Vertex AI client.\n",
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
"\n",
"# Create a pipeline run job.\n",
"job = aiplatform.PipelineJob(\n",
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
" template_path=PIPELINE_SPEC_PATH,\n",
" pipeline_root=PIPELINE_ROOT,\n",
"response = api_client.create_run_from_job_spec(\n",
" job_spec_path=PIPELINE_SPEC_PATH,\n",
" parameter_values={\n",
" # Pipeline configs\n",
" \"project_id\": PROJECT_ID,\n",
@@ -1093,9 +1070,7 @@
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
" },\n",
" enable_caching=ENABLE_CACHING,\n",
")\n",
"\n",
"job.run()"
")"
]
},
{
@@ -1136,11 +1111,7 @@
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
")\n",
"# TF-Agents RL configs\n",
"BATCH_SIZE = 8\n",
"RANK_K = 20\n",
"NUM_ACTIONS = 20"
")"
]
},
{
@@ -1250,7 +1221,7 @@
},
"outputs": [],
"source": [
"endpoints = ! gcloud ai endpoints list \\\n",
"endpoints = ! gcloud beta ai endpoints list \\\n",
" --region=$REGION \\\n",
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
"print(\"\\n\".join(endpoints), \"\\n\")\n",
@@ -1453,11 +1424,13 @@
},
"outputs": [],
"source": [
"from kfp.components import load_component_from_url\n",
"\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -1508,16 +1481,7 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" train_task = train_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -1525,10 +1489,28 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1545,13 +1527,11 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" )"
]
},
@@ -39,15 +39,14 @@ outputs:
- {name: bigquery_table_id, type: String}
implementation:
container:
image: python:3.7
image: tensorflow/tensorflow:2.5.0
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
- sh
- -ec
- |
@@ -297,8 +296,7 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -20,7 +20,7 @@ outputs:
- {name: tfrecord_file, type: String}
implementation:
container:
image: python:3.7
image: tensorflow/tensorflow:2.5.0
command:
- sh
- -c
@@ -187,8 +187,7 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -1,4 +1,3 @@
google-cloud-bigquery==2.20.0
tensorflow==2.5.3
pillow==9.0.1
tensorflow==2.5.0
tf-agents==0.8.0
@@ -1,4 +1,2 @@
google-cloud-pubsub==2.5.0
pillow==9.0.1
tf-agents==0.8.0
tensorflow==2.5.3
tensorflow==2.5.0
@@ -1,5 +0,0 @@
dataclasses==0.6
google-cloud-aiplatform==1.8.1
tensorflow==2.5.3
pillow==9.0.1
tf-agents==0.8.0
@@ -27,14 +27,14 @@ outputs:
- {name: training_artifacts_dir, type: String}
implementation:
container:
image: python:3.7
image: tensorflow/tensorflow:2.5.0
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
- sh
- -ec
- |
@@ -270,8 +270,7 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -22,13 +22,13 @@ from src.training import task
# Paths and configurations
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
"result.json") # FILL IN
"[your-file-name].json") # FILL IN
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
# Hyperparameters
@@ -1,363 +1,423 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ac14831de120"
},
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on CPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1f2615ea7930"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_cpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b9b9229d7bc4"
},
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-cpu-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "070e602ded80"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "99b9c8546a46"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f5196e294db6"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "723478af31e6"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f cpu.Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "66ac893a871b"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d131ee61bfca"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bc5682081ee8"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8b9c18d51ddf"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cfee2f165779"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b542a33f1782"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a0f25261a58c"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "abacc13094c9"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77ca3177b71e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f1733451a790"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0d5e38fade0a"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"\n",
"container_args = [\n",
" \"--epochs\",\n",
" \"50\",\n",
" \"--batch-size\",\n",
" \"32\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "23ceccc746f5"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "469599f8b676"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e35aa8a39a11"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "40118a4bb0de"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6d414dfc4585"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77cd165390f9"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "9b73b8cb646d"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "multi_worker_vertex_training_on_cpu_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
"nbformat": 4,
"nbformat_minor": 0
}
{
"cell_type": "markdown",
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on CPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_cpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-cpu-cust-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Build Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri=f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f cpu.Dockerfile ."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"\n",
"container_args = [\n",
" '--epochs', '50',\n",
" '--batch-size', '32',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,367 +1,427 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "e8fc31cbf9f6"
},
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5825c076e0f8"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_gpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a5f0c3700b8e"
},
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-gpu-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "070e602ded80"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "99b9c8546a46"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f5196e294db6"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c24b9a97df06"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f gpu.Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "66ac893a871b"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d131ee61bfca"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bc5682081ee8"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8b9c18d51ddf"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cfee2f165779"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b542a33f1782"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a0f25261a58c"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "abacc13094c9"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77ca3177b71e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f1733451a790"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3e29b50a65d3"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" \"--epochs\",\n",
" \"50\",\n",
" \"--batch-size\",\n",
" \"32\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "23ceccc746f5"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "239e58fe141d"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e35aa8a39a11"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "40118a4bb0de"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6d414dfc4585"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77cd165390f9"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "9b73b8cb646d"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "multi_worker_vertex_training_on_gpu_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
"nbformat": 4,
"nbformat_minor": 0
}
{
"cell_type": "markdown",
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on GPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_gpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-gpu-cust-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Build Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri=f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f gpu.Dockerfile ."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" '--epochs', '50',\n",
" '--batch-size', '32',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1 +1 @@
tensorflow==2.5.3
tensorflow==2.4.1
@@ -123,16 +123,7 @@ def main():
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
checkpoint_dir = args.checkpoint_dir or local_checkpoint_dir
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
if checkpoint_dir and checkpoint_dir.startswith(gs_prefix):
checkpoint_dir = checkpoint_dir.replace(gs_prefix, gcsfuse_prefix)
checkpoint_dir = local_checkpoint_dir
num_worker, task_type, task_id = distribution_utils.setup()
print(f'task_type: {task_type}, '
@@ -21,6 +21,7 @@ from tensorflow.keras import layers, losses
from tensorflow.keras.layers.experimental.preprocessing import TextVectorization
import distribution_utils
import utils
VOCAB_SIZE = 10000
MAX_SEQUENCE_LENGTH = 250
@@ -174,18 +175,13 @@ def main():
local_checkpoint_dir = './tmp/checkpoints'
local_tensorboard_log_dir = './tmp/logs'
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
checkpoint_dir = args.checkpoint_dir or local_checkpoint_dir
#TODO: update when gcsfuse ready
gcsfuse_ready = False
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
if checkpoint_dir and checkpoint_dir.startswith(gs_prefix):
checkpoint_dir = checkpoint_dir.replace(gs_prefix, gcsfuse_prefix)
model_dir = args.model_dir or local_model_dir
checkpoint_dir = (gcsfuse_ready and
args.checkpoint_dir) or local_checkpoint_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
class_names = ['csharp', 'java', 'javascript', 'python']
class_indices = dict(zip(class_names, range(len(class_names))))
@@ -282,6 +278,13 @@ def main():
print(f'Tensorboard logs are saved to: {tensorboard_log_dir}')
print(f'Checkpoints are saved to: {checkpoint_dir}')
utils.gcs_upload(
dir=checkpoint_dir,
local_dir=local_checkpoint_dir,
gcs_dir=args.checkpoint_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode
)
return
@@ -0,0 +1,31 @@
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# https://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import os
import shutil
import subprocess
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def gcs_upload(dir, local_dir, gcs_dir, gcsfuse_ready, local_mode):
if not local_mode and dir == local_dir and not gcsfuse_ready:
subprocess.run(['gsutil', 'cp', '-r',
local_dir,
os.path.dirname(gcs_dir)])
print(f'{local_dir} is uploaded to {gcs_dir}')
return
@@ -1,380 +1,437 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "745ff8aea147"
},
"source": [
"# TF-Keras Text Classification Distributed Single Worker GPUs using Vertex Training with Local Mode Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a20c6440f341"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_text_classification_distributed_single_worker_gpus_with_gcloud_local_run_and_vertex_sdk/vertex_training_with_local_mode_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "1c71d07625f5"
},
"outputs": [],
"source": [
"content_name = \"tf-keras-txt-cls-dist-single-worker-gpus-local-mode-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "378392e0adb9"
},
"source": [
"## Local Training with Vertex Local Mode and Auto Packaging"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "05f8e4885312"
},
"outputs": [],
"source": [
"BASE_IMAGE_URI = \"us-docker.pkg.dev/vertex-ai/training/tf-gpu.2-5:latest\"\n",
"SCRIPT_PATH = \"trainer/task.py\"\n",
"OUTPUT_IMAGE_NAME = \"gcr.io/{}/{}:latest\".format(PROJECT_ID, content_name)\n",
"ARGS = \"--epochs 5 --batch-size 16 --local-mode\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b45a98212ef5"
},
"outputs": [],
"source": [
"! gcloud ai custom-jobs local-run \\\n",
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
" $ARGS"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cbd77cb4193c"
},
"source": [
"## Vertex Training using Vertex SDK and Vertex Local Mode Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "c8b69c5e3dd4"
},
"source": [
"### Container Built by Vertex Local Mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4869e0d1657b"
},
"outputs": [],
"source": [
"custom_container_image_uri = OUTPUT_IMAGE_NAME"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d53296526bde"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "eb193581654a"
},
"outputs": [],
"source": [
"! gcloud container images list --repository \"gcr.io\"/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f5b907c91ea6"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fbfec07eaea4"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8fcf24c75bcd"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b68b79268025"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "7577c86757ab"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2a327cb1722d"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2e1069a8f7e2"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d7f0043d3e9b"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-8\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_P100\"\n",
"\n",
"args = [\n",
" \"--epochs\",\n",
" \"100\",\n",
" \"--batch-size\",\n",
" \"128\",\n",
" \"--num-gpus\",\n",
" f\"{accelerator_count}\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "69c88c73bb5d"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "947dd755cdc8"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "703e297f83fe"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d459452eca40"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d02a5890a4af"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "545fe0dbe7c4"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b86c0fe8028e"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "vertex_training_with_local_mode_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
"nbformat": 4,
"nbformat_minor": 0
}
{
"cell_type": "markdown",
"source": [
"# TF-Keras Text Classification Distributed Single Worker GPUs using Vertex Training with Local Mode Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_text_classification_distributed_single_worker_gpus_with_gcloud_local_run_and_vertex_sdk/vertex_training_with_local_mode_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"tf-keras-txt-cls-dist-single-worker-gpus-local-mode-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Local Training with Vertex Local Mode and Auto Packaging"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"BASE_IMAGE_URI = 'us-docker.pkg.dev/vertex-ai/training/tf-gpu.2-5:latest'\n",
"SCRIPT_PATH = 'trainer/task.py'\n",
"OUTPUT_IMAGE_NAME = 'gcr.io/{}/{}:latest'.format(PROJECT_ID, content_name)\n",
"ARGS = '--epochs 5 --batch-size 16 --local-mode'"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud beta ai custom-jobs local-run \\\n",
" --base-image=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
" $ARGS"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Vertex Local Mode Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Container Built by Vertex Local Mode"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_image_uri = OUTPUT_IMAGE_NAME"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository \"gcr.io\"/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-8\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_P100\"\n",
"\n",
"args = [\n",
" '--epochs', '100',\n",
" '--batch-size', '128',\n",
" '--num-gpus', f'{accelerator_count}',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
+28
View File
@@ -0,0 +1,28 @@
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence,
# Our Global Owners: @andrewferlitsch @aribray @dizcology @ivanmkc @morgandu @telpirion @vinnysenthil
* @GoogleCloudPlatform/cloudml-samples-owners
# Notebooks
/notebooks @ivanmkc
# Official Notebooks
notebooks/official/model_monitoring/model_monitoring.ipynb @mco-gh
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-custom-jobs.ipynb @jialuzh
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb @jialuzh
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb @halio-g
notebooks/official/feature_store/gapic-feature-store.ipynb @protorganizer
# Community Notebooks
/notebooks/community/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
# Community Content
/community-content @morgandu
/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/community-content/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
# Official Community Content
+93
View File
@@ -0,0 +1,93 @@
# Code of Conduct
## Our Pledge
In the interest of fostering an open and welcoming environment, we as
contributors and maintainers pledge to making participation in our project and
our community a harassment-free experience for everyone, regardless of age, body
size, disability, ethnicity, gender identity and expression, level of
experience, education, socio-economic status, nationality, personal appearance,
race, religion, or sexual identity and orientation.
## Our Standards
Examples of behavior that contributes to creating a positive environment
include:
* Using welcoming and inclusive language
* Being respectful of differing viewpoints and experiences
* Gracefully accepting constructive criticism
* Focusing on what is best for the community
* Showing empathy towards other community members
Examples of unacceptable behavior by participants include:
* The use of sexualized language or imagery and unwelcome sexual attention or
advances
* Trolling, insulting/derogatory comments, and personal or political attacks
* Public or private harassment
* Publishing others' private information, such as a physical or electronic
address, without explicit permission
* Other conduct which could reasonably be considered inappropriate in a
professional setting
## Our Responsibilities
Project maintainers are responsible for clarifying the standards of acceptable
behavior and are expected to take appropriate and fair corrective action in
response to any instances of unacceptable behavior.
Project maintainers have the right and responsibility to remove, edit, or reject
comments, commits, code, wiki edits, issues, and other contributions that are
not aligned to this Code of Conduct, or to ban temporarily or permanently any
contributor for other behaviors that they deem inappropriate, threatening,
offensive, or harmful.
## Scope
This Code of Conduct applies both within project spaces and in public spaces
when an individual is representing the project or its community. Examples of
representing a project or community include using an official project e-mail
address, posting via an official social media account, or acting as an appointed
representative at an online or offline event. Representation of a project may be
further defined and clarified by project maintainers.
This Code of Conduct also applies outside the project spaces when the Project
Steward has a reasonable belief that an individual's behavior may have a
negative impact on the project or its community.
## Conflict Resolution
We do not believe that all conflict is bad; healthy debate and disagreement
often yield positive results. However, it is never okay to be disrespectful or
to engage in behavior that violates the project’s code of conduct.
If you see someone violating the code of conduct, you are encouraged to address
the behavior directly with those involved. Many issues can be resolved quickly
and easily, and this gives people more control over the outcome of their
dispute. If you are unable to resolve the matter for any reason, or if the
behavior is threatening or harassing, report it. We are dedicated to providing
an environment where participants feel welcome and safe.
Reports should be directed to *[PROJECT STEWARD NAME(s) AND EMAIL(s)]*, the
Project Steward(s) for *[PROJECT NAME]*. It is the Project Steward’s duty to
receive and address reported violations of the code of conduct. They will then
work with a committee consisting of representatives from the Open Source
Programs Office and the Google Open Source Strategy team. If for any reason you
are uncomfortable reaching out to the Project Steward, please email
opensource@google.com.
We will investigate every complaint, but you may not receive a direct response.
We will use our discretion in determining when and how to follow up on reported
incidents, which may range from not taking action to permanent expulsion from
the project and project-sponsored spaces. We will notify the accused of the
report and provide them an opportunity to discuss it before any action is taken.
The identity of the reporter will be omitted from the details of the report
supplied to the accused. In potentially harmful situations, such as ongoing
harassment or threats to anyone's safety, we may take action without notice.
## Attribution
This Code of Conduct is adapted from the Contributor Covenant, version 1.4,
available at
https://www.contributor-covenant.org/version/1/4/code-of-conduct.html
+28
View File
@@ -0,0 +1,28 @@
# How to Contribute
We'd love to accept your patches and contributions to this project. There are
just a few small guidelines you need to follow.
## Contributor License Agreement
Contributions to this project must be accompanied by a Contributor License
Agreement. You (or your employer) retain the copyright to your contribution;
this simply gives us permission to use and redistribute your contributions as
part of the project. Head over to <https://cla.developers.google.com/> to see
your current agreements on file or to sign a new one.
You generally only need to submit a CLA once, so if you've already submitted one
(even if it was for a different project), you probably don't need to do it
again.
## Code Reviews
All submissions, including submissions by project members, require review. We
use GitHub pull requests for this purpose. Consult
[GitHub Help](https://help.github.com/articles/about-pull-requests/) for more
information on using pull requests.
## Community Guidelines
This project follows [Google's Open Source Community
Guidelines](https://opensource.google/conduct/).
-5
View File
@@ -1,5 +0,0 @@
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product.
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that aren't officially supported by Google.
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
-23
View File
@@ -1,23 +0,0 @@
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence,
# @global-owner1 and @global-owner2 will be requested for
# review when someone opens a pull request.
/sdk/sdk_* @andrewferlitsch
/gapic @andrewferlitsch
/ml_ops @andrewferlitsch
/model_monitoring/* @mco-gh
/structured_data/rapid_prototyping_* @rafael-carvalho
/managed_notebooks/
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
/tensorboard @yfang1
/feature_store @nayaknishant @morgandu
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
/vertex_endpoints/optimized_tensorflow_runtime @vlasenkoalexey
/notebooks/community/ml_ops/stage2/get_started_with_visionapi_and_automl.ipynb @mansari
Binary file not shown.

Before

Width:  |  Height:  |  Size: 83 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 141 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 230 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 122 KiB

Binary file not shown.

Before

Width:  |  Height:  |  Size: 140 KiB

File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -480,7 +480,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1495,8 +1496,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1516,7 +1518,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -505,7 +505,8 @@
"\n",
"import google.cloud.aiplatform_v1beta1 as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1520,8 +1521,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`).\n",
"\n",
@@ -1550,7 +1552,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -482,7 +482,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1497,8 +1498,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1518,7 +1520,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -483,7 +483,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1709,7 +1710,7 @@
"outputs": [],
"source": [
"import tensorflow as tf\n",
"from tensorflow.keras import Model\n",
"from tensorflow.keras import Input, Model\n",
"from tensorflow.keras.layers import Lambda\n",
"\n",
"softmax = model_A.outputs[0]\n",
@@ -1760,8 +1761,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1781,7 +1783,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -1821,15 +1824,16 @@
"CONCRETE_INPUT = \"numpy_inputs\"\n",
"\n",
"\n",
"def _preprocess(bytes_input): # noqa: 811\n",
"def _preprocess(bytes_input):\n",
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
"def preprocess_fn(bytes_inputs): # noqa: 811\n",
"def preprocess_fn(bytes_inputs):\n",
" decoded_images = tf.map_fn(\n",
" _preprocess, bytes_inputs, dtype=tf.float32, back_prop=False\n",
" )\n",
@@ -482,7 +482,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1599,8 +1600,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1620,7 +1622,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -507,7 +507,8 @@
"\n",
"import google.cloud.aiplatform_v1beta1 as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1522,8 +1523,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`).\n",
"\n",
@@ -1552,7 +1554,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -484,7 +484,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -2102,8 +2103,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -2123,7 +2125,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(128, 128))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -483,7 +483,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1246,6 +1247,9 @@
},
"outputs": [],
"source": [
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value\n",
"\n",
"MODEL_NAME = \"custom_pipeline-\" + TIMESTAMP\n",
"PIPELINE_DISPLAY_NAME = \"custom-training-pipeline\" + TIMESTAMP\n",
"\n",
@@ -1563,8 +1567,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1584,7 +1589,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -482,7 +482,8 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.struct_pb2 import Value"
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
]
},
{
@@ -1558,8 +1559,9 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1579,7 +1581,8 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" return resized\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",

Some files were not shown because too many files have changed in this diff Show More