Compare commits

...
Author SHA1 Message Date
Andrew Ferlitsch 69aa45293d fix: git rendering issue 2023-05-25 16:45:26 +00:00
genquan9andGitHub e78068bb79 Update Keras stable diffusion notebooks with cloud notebook template and fix bugs (#1894)
* Update Keras stable diffusion notebooks with cloud notebook template style and fix bugs.

* fix minor typos
2023-05-19 16:21:26 +00:00
d940c93f47 Add new notebook to community folder for BQML inference engine / Vertex AI API integration (#1820)
* Added new bq_ml_with_vision_translation_nlp notebook. Added README. Updated community CODEOWNERS file

* review comment changes - renamed folder, updated headers, reformatted to be more in line with template

* review comment changes - renamed folder, updated headers, reformatted to be more in line with template

* lint formatting fixes

---------

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2023-05-18 18:12:53 +00:00
genquan9andGitHub 9b336a72f3 Add Keras stable diffusion notebook for model garden (#1891)
* Add Keras stable diffusion notebook for model garden

* Fix minor typos in Keras Stable Diffusion

* Fix format after minor typo fixes

* Update the objective structure

* update minor comments
2023-05-17 23:36:12 +00:00
dstnluong-googleandGitHub dfec25bde7 Add a local inference section to model_garden_pytorch_timm.ipynb (#1888)
* add local inference section to timm notebook

* Lint
2023-05-15 17:12:23 +00:00
Ivan NardiniandGitHub 3fe0889b9a feat: Add custom training integration with experiments notebook (#1887)
* add notebook. linter test passed

* add codeower and fix a typo

* linter test passed

* adding andy reviews

* linter passed
2023-05-15 17:10:28 +00:00
Andrew FerlitschandGitHub 5df1dfcc37 fix: boilerplate reduction 43 (#1874)
* fix: boilerplate reduction 43

* fix: install

* fix: install

* fix: install

* fix: install
2023-05-15 16:28:23 +00:00
Ivan CheungGitHubivanmkc@google.com <ivanmkc@google.com>
2303f110da Fixed incorrect text (#1886)
Co-authored-by: ivanmkc@google.com <ivanmkc@google.com>
2023-05-12 23:56:48 +00:00
Ivan CheungGitHubivanmkc@google.com <ivanmkc@google.com>
9ba17b5227 Added Matching Engine + "Vertex Text Embedding API" notebook (#1876)
* Added PaLM ME notebook

* Fixed import error and linted

* More cleanup

* Fixed embedding model

* Added comments

* Renamed and fixed links

* Linted

---------

Co-authored-by: ivanmkc@google.com <ivanmkc@google.com>
2023-05-12 22:41:08 +00:00
Andrew FerlitschandGitHub 6ea28621ac feat: read accumulative result files (#1837)
* feat: read accumulative result files

* fix: build results dir

* fix: build results dir

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: selection algo

* fix: debug

* fix: debug

* fix: debug

* fix: debug

* fix: debug

* fix: debug

* fix: debug select algo

* fix: debug select algo

* fix: debug select algo

* fix: debug select algo

* fix: filtering

* fix: review comments

* fix: rm test_filter
2023-05-12 17:44:54 +00:00
Andrew FerlitschandGitHub 5c2bd2a13a fix: boilerplate reduction 50 (#1885) 2023-05-12 17:09:22 +00:00
Andrew FerlitschandGitHub 675a98a005 fix: boilerplate reduction 48 (#1880)
* fix: boilerplate reduction 48

* fix: os

* fix: lint

* fix: import
2023-05-12 14:11:33 +00:00
Andrew FerlitschandGitHub 3d2518b177 fix: boilerplate reduction 47 (#1879)
* fix: boilerplate reduction 47

* fix: dependency
2023-05-12 14:10:34 +00:00
Andrew FerlitschandGitHub cc1a25733b fix: boilerplate reduction 46 (#1878)
* fix: boilerplate reduction 46

* fix: os
2023-05-12 14:09:14 +00:00
Andrew FerlitschandGitHub 2ac6a917af fix: boilerplate reduction 45 (#1877)
* fix: boilerplate reduction 45

* fix: os

* fix: colab
2023-05-12 14:08:05 +00:00
Andrew FerlitschandGitHub 3440690fa8 fix: boilerplate reduction 44 (#1875) 2023-05-12 14:06:19 +00:00
Andrew FerlitschandGitHub 1a4373c3c4 fix: boilerplate reduction 42 (#1872)
* fix: boilerplate reduction 42

* fix: install
2023-05-12 14:05:21 +00:00
Andrew FerlitschandGitHub 529ad0dd8e fix: bolierplate reduction 40 (#1869) 2023-05-12 12:39:32 +00:00
Andrew FerlitschandGitHub beaef16d62 fix: bolierplate reduction 39 (#1868)
* fix: bolierplate reduction 39

* fix: missing os

* fix: missing sys
2023-05-12 12:37:49 +00:00
Andrew FerlitschandGitHub 80d25ef87f upgrade: boilerplate reduction 37 (#1866)
* upgrade: boilerplate reduction 37

* fix: UUID
2023-05-12 12:36:58 +00:00
Andrew FerlitschandGitHub f21ac67fb2 upgrade: boilerplate reduction 36 (#1864)
* upgrade: boilerplate reduction 36

* missing import
2023-05-12 12:35:50 +00:00
Andrew FerlitschandGitHub 8be5a069eb update: boilerplate reduction 35 (#1863) 2023-05-12 12:34:53 +00:00
Andrew FerlitschandGitHub 721269538d Reduction 24 (#1851)
* fix: boilerplate reduction 23

* fix: boilerplate reduction 24
2023-05-10 12:47:10 +00:00
Andrew FerlitschandGitHub 240811979e fix: boilerplate reduction 25 (#1852)
* fix: boilerplate reduction 25

* fix: import

* fix: experiment name

* fix: experiment name

* fix: experiment name

* fix: delete

* fix: log link
2023-05-10 12:45:44 +00:00
Andrew FerlitschandGitHub 435e58884d fix: boiletplate reduction 25 (#1853) 2023-05-10 12:44:33 +00:00
Andrew FerlitschandGitHub f716600b44 fix: boilerplate reduction 30 (#1857)
* fix: boilerplate reduction 30

* fix:missing os
2023-05-10 12:43:27 +00:00
Andrew FerlitschandGitHub c7c573bae3 fix: boilerplate reduction 31 (#1859)
* fix: boilerplate reduction 31

* fix: bucket name
2023-05-10 12:42:44 +00:00
Andrew FerlitschandGitHub ee7dd9b5d8 fix: boilerplate reduction 32 (#1861)
* fix: boilerplate reduction 32

* fix: missing os
2023-05-10 12:41:38 +00:00
Andrew FerlitschandGitHub 42956223f2 fix: boilerplate reduction 23 (#1850) 2023-05-10 12:40:47 +00:00
Andrew FerlitschandGitHub 3b736a24a9 fix: boilerplate reduction 21 (#1848) 2023-05-10 12:39:15 +00:00
henrytanandGitHub 1ab839ac47 Text embedding api (#1858)
* Add text_embedding_api_semantic_search_with_scann notebook.

* Linted version.

* Updating the cell moving the pip install to the top

* Adding shapely<2.0.0.
2023-05-10 00:20:02 +00:00
Mend RenovateandGitHub fe7d3e4b8e chore(deps): update dependency pyupgrade to v3 (#1346) 2023-05-09 21:37:29 +00:00
Andrew FerlitschandGitHub 2c987c1949 fix: boilerplate reduction 20 (#1846) 2023-05-09 21:16:52 +00:00
Andrew FerlitschandGitHub 3f7b3292c1 fix: reduction 17 (#1842)
* fix: reduction 17

* fix: missing installs

* fix: missing installs
2023-05-09 21:16:00 +00:00
Andrew FerlitschandGitHub aaba9fe4e1 fix: reduction 16 (#1841)
* fix: reduction 16

* fix: exception
2023-05-09 21:15:03 +00:00
henrytanandGitHub aa04d7a60d Add text_embedding_api_semantic_search_with_scann notebook. (#1847)
* Add text_embedding_api_semantic_search_with_scann notebook.

* Linted version.
2023-05-09 20:57:10 +00:00
b17709785d Add Dataflow Flex Template component sample (#1839)
* Add Dataflow Flex Template component notebook

* Add get_started_with_dataflow_flex_template_component.ipynb to CODEOWNERS

---------

Co-authored-by: Win Woo <wwoo@google.com>
2023-05-09 19:27:00 +00:00
Andrew FerlitschandGitHub 5362c4ff61 fix: reduction 15 (#1840)
* fix: reduction 15

* fix: reduction 15

* fix: UUID issue
2023-05-09 18:37:54 +00:00
Andrew FerlitschandGitHub 4ce6dbc450 upgrade: boilerplate reduction 6 (#1827)
* upgrade: boilerplate reduction 6

* fix: install

* fix: install

* fix: install

* fix: rm output
2023-05-09 14:52:19 +00:00
Andrew FerlitschandGitHub a5270054b2 update: boilerplate reduction 13 (#1834)
* update: boilerplate reduction 13

* fix: bucket var
2023-05-09 13:12:44 +00:00
Andrew FerlitschandGitHub 30fe41eb2e upgrade: boilerplate reduction #1 (#1822)
* upgrade: boilerplate reduction

* add missing import

* missing DATAREGION

* fix: lint

* fix: unique job id
2023-05-09 13:10:59 +00:00
Xiang XuandGitHub 17b898bd15 fix controlnet (#1838) 2023-05-08 20:44:56 +00:00
Andrew FerlitschandGitHub 6415b1406d update: boilerplate reduction 12 (#1833)
* update: boilerplate reduction 12

* fix: missing bucket
2023-05-08 20:35:45 +00:00
Xiang XuandGitHub bbfddc2dfe fix controlnet (#1836) 2023-05-08 20:14:31 +00:00
Andrew FerlitschandGitHub 59da0b7fa4 update: boilerplate reduction 14 (#1835) 2023-05-08 19:03:10 +00:00
Andrew FerlitschandGitHub 321a7c7deb update: boilerplate reduction 11 (#1832) 2023-05-08 19:02:15 +00:00
Andrew FerlitschandGitHub 386c2f7ab9 update: boiler plate reduction 10 (#1831) 2023-05-08 19:01:07 +00:00
Andrew FerlitschandGitHub feb14aa36c update: boiler plate reduction 9 (#1830)
* update: boiler plate reduction 9

* fix: UUID
2023-05-08 19:00:01 +00:00
Andrew FerlitschandGitHub 44e0c77ddb update: boiler plate reduction 8 (#1829)
* update: boiler plate reduction 8

* fix: rm TIMESTAMP

* fix: import
2023-05-08 18:58:38 +00:00
Andrew FerlitschandGitHub cec6321027 upgrade: boilerplate reduction 7 (#1828) 2023-05-08 18:57:18 +00:00
Andrew FerlitschandGitHub 3cde0c8eab upgrade: boilerplate reduction 2 (#1823)
* upgrade: boilerplate reduction 2

* fix import os
2023-05-08 18:53:29 +00:00
Andrew FerlitschandGitHub 16c010a859 upgrade: boilerplate reduction 5 (#1826) 2023-05-06 00:37:10 +00:00
Andrew FerlitschandGitHub 11bad82468 upgrade: boilerplate reduction 4 (#1825)
* upgrade: boilerplate reduction 4

* fix: os
2023-05-06 00:36:49 +00:00
Andrew FerlitschandGitHub 9a7197a774 upgrade: boilerplate reduction 3 (#1824) 2023-05-06 00:36:05 +00:00
Andrew FerlitschandGitHub c638e6d983 fix: add test percent param (#1821) 2023-05-05 23:07:13 +00:00
dstnluong-googleandGitHub 5651427a97 Update stable_diffusion notebook with steps for local inference. (#1813)
* Update stable_diffusion notebook with steps for local inference.

* Lint

* Move comments to top and shorten line.

* Lint

* Make code comment titles, add print statements, and update Objective

* change print to display

* lint

* change training dockers to serving dockers
2023-05-05 20:04:46 +00:00
Andrew FerlitschandGitHub 6195e7bbf9 Ci cd 2 (#1802)
* update: record tallied results to GCS bucket

* fix: test percent

* update: accumulator support

* fix: use args for where to store results

* fix: args for results file

* fix: gs bucket ptrfix

* fix: tuning args

* fix: ci/cd test on openin artifacts bucket

* fix: 2nd try at bucket issue

* fix: 2nd try at bucket issue

* debug: bucket issue

* debug: bucket issue

* debug: bucket issue

* debug: bucket issue

* debug: bucket issue

* debug: bucket issue

* debug: no entries written

* debug: no entries written

* debug: not accumulating

* debug: not accumulating

* debug: not accumulating

* debug: not accumulating

* Update requirements.txt

* debug: not accumulating

* debug: not accumulating

* debug: matching notebook name

* debug: pandas problem

* debug: import issues

* debug: load

* Update requirements.txt

* Update requirements.txt

* debug: read csv

* debug: read csv

* debug: read csv

* debug: indxer

* debug: indexer

* debug: accum

* debug: accum

* debug: accum

* debug: accum

* debug: accum

* debug: accum

* debug: accum

* debug: casting

* debug: casting

* debug: casting

* debug: casting

* debug: duration nit

* debug: duration nit

* fix: flaky

* fix: BUILD_ID

* fix: BUILD_ID

* fix: BUILD_ID

* fix: BUILD_ID

* fix: BUILD_ID

* fix: BUILD_ID

* fix: BUILD_ID

* fix: review

* fix: review

* fix: review

* fix: biz logic

* fix: biz logic

* fix: review

* fix: build_id required

* fix: use json format

* review: JSON simplifing

* review: JSON simplifing

* update: NotbookExecutionResult updates

* fix: revert to JSON

* update: use util to read from bucket

* fix: remove pandas inmport
2023-05-05 20:03:49 +00:00
Andrew FerlitschandGitHub 2b4f7834b8 feat: MG notebook to finetune BERT (#1815)
* feat: MG notebook to finetune BERT

* review updates
2023-05-05 18:23:48 +00:00
Andrew FerlitschandGitHub 6eadb9199d feat: MG notebook to finetune T5X (#1816)
* feat: MG notebook to finetune T5X

* fix: review comments
2023-05-05 18:23:06 +00:00
Bernie OngeweandGitHub cf9ba17c7d Update tabular_optimized_online_prediction.ipynb (#1819)
Can only set up one Service Networking configuration per _network_. However, we can have multiple VPC networks per project, each with its own Service Networking configuration
2023-05-05 15:22:31 +00:00
KCFindstrandGitHub 384fa2c1b6 Add service account config to TIMM notebook (#1818) 2023-05-05 14:55:29 +00:00
Xiang XuandGitHub 4d24324cc6 fix controlnet (#1817) 2023-05-04 22:45:16 +00:00
Lav RaiandGitHub b1331406a0 Fix format-check and size-check error for detectron2. (#1814)
* Fix format-check and size-check error for detectron2.

* Fix format-check and size-check error for detectron2.
2023-05-04 19:02:19 +00:00
KCFindstrandGitHub cf00491bdc Update Model Garden TFVision notebooks. (#1808)
* Update #ModelGarden TFVision notebooks.

1. Added checkpoints for resnet-50, scaled_yolov4, deeplabv3+
2. Supported launching dockers in europe and asia region.

* Use a smaller batch size to resolve OOM issue
2023-05-04 15:39:53 +00:00
Huguens JeanandGitHub b24de2c375 Add notebook to trigger model garden training with model descriptions. (#1792)
* Trigger Model Garden Training

* Add notebook to trigger model garden training with model descriptions for ip sensitive checkpoints.

* Remove notebook in official folder.

* Fix type in notebook filename.

* Updated notebook description to reflect ip sensitive model garden training for EFFICIENTNET v2 using CLOUD key.

* Updated notebook with model garden specific configs for proprietary checkpoints.

* Linter check.

* Clear notebook's output.
2023-05-04 15:39:24 +00:00
Lav RaiandGitHub 79d80a1f4f Fix format-check and size-check error for stable diffusion inpainting. (#1812) 2023-05-04 00:01:31 +00:00
Xiang XuandGitHub de3e31e037 fix serve (#1811) 2023-05-03 23:20:00 +00:00
Andrew FerlitschandGitHub d45d5fad51 fix links (#1807) 2023-05-01 15:59:33 +00:00
Andrew FerlitschandGitHub 10a9e776b7 there is a regression in later packages (#1809) 2023-04-28 16:37:14 +00:00
Andrew FerlitschandGitHub db80aa4953 Revert "outdated (#1798)" (#1806)
This reverts commit 3d461a8458.
2023-04-27 21:07:59 +00:00
Xiang XuandGitHub f4345ed935 fix gs (#1804) 2023-04-26 22:00:11 +00:00
Lav RaiandGitHub b191b93c7e Fix detectron2 permission errors. (#1803) 2023-04-26 19:55:37 +00:00
gericdongandGitHub 8acf15cccb feat: notebook for text models for explainable AI feature attribution - sampled shapley (#1801)
* feat:notebook for text models for explanable AI feature attribution - sampled shapley

* addressed review comments
2023-04-25 17:52:39 +00:00
Andrew FerlitschandGitHub 8cd372c2d1 fix: nan (#1799)
* fix: nan

* fix: syntax error

* fix: syntax error

* fix: syntax error
2023-04-25 17:31:09 +00:00
Xiang XuandGitHub 447d79a165 add feature to clip (#1800) 2023-04-24 23:58:06 +00:00
Andrew FerlitschandGitHub 3d461a8458 outdated (#1798) 2023-04-24 23:54:49 +00:00
228e2034f7 Add detectron2 notebook (#1783)
* Add model garden pytorch detectron2 notebook

* Add model garden pytorch detectron2 notebook

* Add model garden pytorch detectron2 notebook

* Add model garden pytorch detectron2 notebook

---------

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2023-04-24 22:03:56 +00:00
Andrew FerlitschandGitHub fd3cc2a2cc update: test_percent and dry_run for weekly regr (#1795)
* update: test_percent for weekly regr

* update: add dry_run and test_percent

* fix: review comment
2023-04-24 21:41:21 +00:00
Andrew FerlitschandGitHub 76a1f49aaa improve install (#1797) 2023-04-24 19:49:46 +00:00
Andrew FerlitschandGitHub cb41dfc8bd test: flaky script (#1794) 2023-04-22 14:53:19 +00:00
Andrew FerlitschandGitHub 9b5e734dca test: list of passing notebooks (#1785)
* test: list of passing notebooks

* test: list of failing notebooks
2023-04-21 19:17:43 +00:00
Andrew FerlitschandGitHub 274ed4ef49 update: search index for migration (#1793) 2023-04-21 15:45:13 +00:00
dstnluong-googleandGitHub 92498e8148 Add 5 additional models to list of verified models. (#1791) 2023-04-21 15:23:50 +00:00
Andrew FerlitschandGitHub ce48820cc1 fix: links after rename UJ7 (#1789) 2023-04-21 12:46:03 +00:00
Andrew FerlitschandGitHub b59e74be8a fix: links after rename UJ9 (#1780) 2023-04-21 12:45:28 +00:00
Andrew FerlitschandGitHub 47579bdb10 fix: links after rename UJ10 (#1779) 2023-04-21 12:44:57 +00:00
Andrew FerlitschandGitHub 761ffc7b17 fix: links after rename UJ2 (#1778) 2023-04-21 12:44:23 +00:00
Andrew FerlitschandGitHub 99cd99b385 fix: links after rename UJ3 (#1777) 2023-04-21 12:43:48 +00:00
Andrew FerlitschandGitHub be783a2ed1 fix: links after rename UJ6 (#1776) 2023-04-21 12:43:25 +00:00
Andrew FerlitschandGitHub 7523b575ab fix: links after rename UJ4 (#1775) 2023-04-21 12:42:39 +00:00
Andrew FerlitschandGitHub 4f5a637cd0 fix: links after rename UJ5 (#1773) 2023-04-21 12:42:06 +00:00
Andrew FerlitschandGitHub 0701ca01a8 fix: links after rename 1 (#1772) 2023-04-21 12:41:39 +00:00
Andrew FerlitschandGitHub 78e0a67cd9 fix: links after rename UJ11 (#1781) 2023-04-20 22:59:08 +00:00
KCFindstrandGitHub 4ef75656a1 Fix typos and invalid properties in TIMM notebook (#1786) 2023-04-20 22:38:43 +00:00
Xiang XuandGitHub f5299da9b0 fix notes (#1787) 2023-04-20 22:37:19 +00:00
Andrew FerlitschandGitHub b986daa72d update: searchable index (#1784) 2023-04-20 20:46:54 +00:00
KCFindstrandGitHub e987dce2ad Add Model Garden Pytorch TIMM notebook (#1760)
* Add model garden pytorch timm notebook

* Add CODEOWNERS for model garden timm notebook

* Fix lint errors on TIMM notebook

* Fix TIMM notebook
2023-04-20 20:02:22 +00:00
Andrew FerlitschandGitHub f2f98cc8ed update: next round of index (#1782) 2023-04-20 19:57:30 +00:00
Xiang XuandGitHub 0661fcc121 fix blip2 (#1771) 2023-04-20 19:20:47 +00:00
Andrew FerlitschandGitHub f4c0fc7781 fix: rename UJ1 (#1757)
* fix: rename UJ1

* fix: lint
2023-04-20 18:22:47 +00:00
Andrew FerlitschandGitHub 8e3db693cb fix: UJ9 (#1770) 2023-04-20 18:22:15 +00:00
Andrew FerlitschandGitHub 0349a9552d fix: UJ8 (#1769) 2023-04-20 18:21:45 +00:00
Andrew FerlitschandGitHub ac1f03dd71 fix: rename UJ7 (#1768) 2023-04-20 18:21:16 +00:00
Andrew FerlitschandGitHub cb18a37b0a fix: rename UJ6 (#1767) 2023-04-20 18:20:51 +00:00
Andrew FerlitschandGitHub 4c8ec05f22 fix: rename UJ5 (#1766) 2023-04-20 18:20:28 +00:00
Andrew FerlitschandGitHub c17df33c7c fix: rename UJ4 (#1765)
* fix: rename UJ4

* fix: lint
2023-04-20 18:20:03 +00:00
Andrew FerlitschandGitHub 543cd66c16 fix: rename UJ3 (#1764) 2023-04-20 18:19:36 +00:00
Andrew FerlitschandGitHub f50dac63eb fix: rename UJ2 (#1763) 2023-04-20 18:19:08 +00:00
Andrew FerlitschandGitHub df979c1c65 fix: rename UJ15 (#1762) 2023-04-20 18:18:21 +00:00
Andrew FerlitschandGitHub 7b49c23eb6 fix: rename UJ14 (#1761)
* fix: rename UJ14

* fix: lint
2023-04-20 18:17:51 +00:00
Andrew FerlitschandGitHub 965835122b fix: rename UJ11 (#1759) 2023-04-20 18:17:22 +00:00
Andrew FerlitschandGitHub 54a34a7122 fix: rename UJ10 (#1758) 2023-04-20 18:17:00 +00:00
Xiang XuandGitHub a701f3b08c fix controlnet (#1756) 2023-04-20 04:44:53 +00:00
59a220cb58 fix: pin kfp and gcpc < 2.0 in rapid_prototyping_bqml_automl (#1755)
* pin kfp in rapid_prototyping_bqml_automl

* downgrade component version

---------

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
2023-04-20 04:36:39 +00:00
Connor McCarthyandGitHub 098ad42f70 pin kfp in google_cloud_pipeline_components_automl_text (#1748) 2023-04-19 23:01:21 +00:00
Connor McCarthyandGitHub 1f141d0059 pin kfp in google_cloud_pipeline_components_automl_images (#1746) 2023-04-19 19:29:50 +00:00
Andrew FerlitschandGitHub e0a1608783 fix: pin kfp and gcpc < 2.0 (#1738) 2023-04-19 18:37:16 +00:00
Connor McCarthyandGitHub 1a469a09df pin kfp in google_cloud_pipeline_components_automl_tabular (#1747) 2023-04-19 18:14:04 +00:00
Connor McCarthyandGitHub bc3f6d3819 pin kfp in custom_model_training_and_batch_prediction (#1741) 2023-04-19 16:53:23 +00:00
Andrew FerlitschandGitHub f088a3ce69 update (#1736) 2023-04-19 16:52:34 +00:00
Connor McCarthyandGitHub 863660042b pin kfp in custom_tabular_train_batch_pred_bq_pipeline (#1742) 2023-04-19 16:51:11 +00:00
Connor McCarthyandGitHub 7162248267 pin kfp in google_cloud_pipeline_components_model_train_upload_deploy (#1749) 2023-04-19 16:50:43 +00:00
Connor McCarthyandGitHub 2e908a8efa pin kfp in get_started_with_hpt_pipeline_components (#1743) 2023-04-19 16:50:13 +00:00
Connor McCarthyandGitHub 588d2c880e pin kfp in get_started_with_machine_management (#1745) 2023-04-19 16:49:12 +00:00
Connor McCarthyandGitHub 54f10c7411 pin kfp in google_cloud_pipeline_components_model_upload_predict_evaluate (#1750) 2023-04-19 16:48:46 +00:00
Connor McCarthyandGitHub 0c2b9e9f45 pin kfp in multicontender_vs_champion_deployment_method (#1753) 2023-04-19 16:48:21 +00:00
Connor McCarthyandGitHub fe07d416e5 pin kfp in challenger_vs_blessed_deployment_method (#1739) 2023-04-19 16:04:05 +00:00
Connor McCarthyandGitHub 9c69cbfd54 pin kfp in control_flow_kfp (#1740) 2023-04-19 16:03:33 +00:00
Connor McCarthyandGitHub 2a25be6af2 pin kfp in lightweight_functions_component_io_kfp (#1751) 2023-04-19 16:02:52 +00:00
Connor McCarthyandGitHub 9680a7e772 pin kfp in metrics_viz_run_compare_kfp (#1752) 2023-04-19 16:02:03 +00:00
Connor McCarthyandGitHub 30527875ed pin kfp in pipelines_intro_kfp (#1754) 2023-04-19 16:01:36 +00:00
8c11e19d86 Update service accounts and permissions info in the Wide and Deep notebook (#1737)
Co-authored-by: Yishan Pu <yishanpu@google.com>
2023-04-19 15:24:34 +00:00
f44f51c06d Update the service accounts and permissions info in the TabNet notebook (#1734)
Co-authored-by: Yishan Pu <yishanpu@google.com>
2023-04-18 16:06:42 +00:00
840b537ea6 Update the E2E AutoML Notebook regarding the service accounts and permissions info (#1731)
Co-authored-by: Yishan Pu <yishanpu@google.com>
2023-04-17 23:16:28 +00:00
Xiang XuandGitHub d2602b944f Add blip2 notebook (#1730)
* add blip2

* resolve comments
2023-04-17 23:14:34 +00:00
Xiang XuandGitHub bb39135946 fix owlvit (#1729) 2023-04-17 15:19:36 +00:00
gericdongandGitHub cb72a56e55 feat: PyTorch train and deploy E2E with pre-built containers (#1728)
* feat: PyTorch train and deploy E2E with pre-built containers

* address review comments

* address review comment 2

* suppress gsutil warning messags

* Use unique names

* Corrected the project id template
2023-04-17 14:56:43 +00:00
Andrew FerlitschandGitHub eee97362d0 fix: migrate tabnet (#1727)
* fix: migrate tabnet

* fix: describe

* updates from review
2023-04-13 21:09:23 +00:00
Ivan NardiniandGitHub a92c5be0e9 feat: delete outdated tensorboard experiments (#1723)
* add delete outdated tensorboard experiments notebook

* update CODEOWNERS

* fix aiplatform import

* linter passed

* set a flag varible to pass test

* linter passed

* add andy review

* linter passed
2023-04-13 15:57:43 +00:00
Xiang XuandGitHub 80707a3ba7 fix clean (#1725) 2023-04-12 20:28:00 +00:00
903f69b81c feat: PyTorch training with GCS data (#1705)
* feat: PyTorch training with GCS data

* fix kernel restart

* per reviewer

* Added requirements section

* fixes for build

* lint, build

* per reviewer

* linter again

* per reviewer

* per reviewer, linter

---------

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2023-04-12 17:39:39 +00:00
Andrew FerlitschandGitHub 40a31daaef Revert "update: thread safe limiter (#1718)" (#1724)
This reverts commit 37ba322412.
2023-04-12 16:33:16 +00:00
Andrew FerlitschandGitHub 37ba322412 update: thread safe limiter (#1718)
* update: thread safe limiter

* update: thread safe limiter

* fix: missing install
2023-04-12 00:05:36 +00:00
Xiang XuandGitHub ee43400e89 fix clean (#1719) 2023-04-11 22:59:00 +00:00
Xiang XuandGitHub 176c3721fd fix pytorch notebooks (#1717) 2023-04-11 22:01:56 +00:00
Andrew FerlitschandGitHub 1d6f9bc36b fix: exception (#1714)
* fix: exception

* fix: exception

* fix: exception

* fix: exception
2023-04-11 20:40:22 +00:00
dstnluong-googleandGitHub 973ecf95e7 Fix retinanet_spinenet143 experiment args in IOD notebook to use correct config file. (#1716)
* Minor nit fixes for model garden tfvision IOD notebook.

* Sync

* Lint

* Fix retinanet_spinenet143 experiment args in IOD notebook to use correct config file.
2023-04-11 20:22:29 +00:00
Xiang XuandGitHub 1f2adec703 fix prediction routes (#1715) 2023-04-11 19:33:17 +00:00
Xiang XuandGitHub 9843c1f063 fix image url (#1711) 2023-04-11 16:06:14 +00:00
KCFindstrandGitHub 5afdc3524a Add a trailing slash to Model Garden ICN notebook checkpoint destination URI (#1710) 2023-04-11 16:04:58 +00:00
Andrew FerlitschandGitHub 770508b4f0 fix: delete experiment and fs (#1709)
* fix: delete experiment and fs

* fix False typo

* fix: 2nd try at Falsee typo

* fix: update_time
2023-04-10 21:56:20 +00:00
Xiang XuandGitHub 987881e887 fix links (#1708) 2023-04-10 14:44:21 +00:00
Andrew FerlitschandGitHub 8e53b623e5 fix: migrate vizier notebook (#1706)
* fix: migrate vizier notebook

* fix: review comment
2023-04-07 06:55:57 +00:00
Andrew FerlitschandGitHub 948537e1d4 fix: migrate machine management (#1707)
* fix: migrate machine management

* remove not per review
2023-04-06 20:57:29 +00:00
Andrew FerlitschandGitHub 4338b1d90b fix: unique str (#1692)
* fix: unique str

* fix: lint

* fix cleanup
2023-04-06 12:43:38 +00:00
Andrew FerlitschandGitHub b7a41637ea fix: unique str (#1693)
* fix: unique str

* Fix cleanup
2023-04-06 12:43:03 +00:00
Andrew FerlitschandGitHub c8f7b910f2 fix: add back missing not (#1687) 2023-04-05 22:48:40 +00:00
Andrew FerlitschandGitHub 1e226a3419 fix: unique str (#1701) 2023-04-05 20:38:22 +00:00
Andrew FerlitschandGitHub 287f70abc2 fix: unique dtr (#1700) 2023-04-05 20:37:37 +00:00
Andrew FerlitschandGitHub 8e9d664d88 fix: unique dtr (#1699) 2023-04-05 20:36:29 +00:00
Andrew FerlitschandGitHub 166a407b8d fix: unique str (#1698) 2023-04-05 20:35:29 +00:00
Andrew FerlitschandGitHub 72f9ba7647 fix: unique str (#1697) 2023-04-05 20:34:41 +00:00
Andrew FerlitschandGitHub 24549bc506 fix: unique str (#1696) 2023-04-05 20:33:46 +00:00
Andrew FerlitschandGitHub dc4efb0c63 fix: unique str (#1694) 2023-04-05 20:33:04 +00:00
Andrew FerlitschandGitHub b8c6cc29b4 fix: unique str (#1702) 2023-04-05 20:31:59 +00:00
Andrew FerlitschandGitHub 3b6d2e02d0 fix: unique str (#1703) 2023-04-05 20:31:18 +00:00
Andrew FerlitschandGitHub f33adcea80 fix: fine tune unique (#1704) 2023-04-05 20:30:51 +00:00
Andrew FerlitschandGitHub 5b6063b8a8 fix: unique str (#1695) 2023-04-05 18:56:37 +00:00
Andrew FerlitschandGitHub 1857b23556 fix: unique str (#1691) 2023-04-05 18:55:52 +00:00
Andrew FerlitschandGitHub 86d85ca555 fix: unique str (#1690) 2023-04-05 18:55:18 +00:00
Andrew FerlitschandGitHub 67b50fda2c fix: update unique str (#1689) 2023-04-05 18:54:34 +00:00
dstnluong-googleandGitHub 0d5cb22491 Minor nit fixes for model garden tfvision IOD notebook. (#1684)
* Minor nit fixes for model garden tfvision IOD notebook.

* Sync

* Lint
2023-04-05 16:52:32 +00:00
c030d1d79c Undeploy endpoint before deleting a model. (#1685)
Co-authored-by: minwoopark <minwoopark@google.com>
2023-04-04 20:53:53 +00:00
Andrew FerlitschandGitHub 702e6fc262 feat: migrate custom train XGBoost (#1665)
* feat: migrate custom train XGBoost

* fix: review comments
2023-04-04 20:47:49 +00:00
Andrew FerlitschandGitHub 3b2c58821e feat: migrate hpt pipeline components (#1673) 2023-04-04 19:28:52 +00:00
Aaron DietzandGitHub 6b302d6ac8 Updated BigQuery ML link to be more targeted (#1683) 2023-04-04 17:00:48 +00:00
Andrew FerlitschandGitHub 78b2aa87f3 Cleanup bucket (#1682)
* fix: cleanup buckets

* fix: review comments

* fix: review comments

* fix: delete only vertex notebook testing buckets

* fix: fine tune

* fix: fine tune
2023-04-03 22:38:31 +00:00
Andrew FerlitschandGitHub 0b9582341c fix: cleanup buckets (#1679)
* fix: cleanup buckets

* fix: review comments

* fix: review comments

* fix: delete only vertex notebook testing buckets

* fix: fine tune
2023-04-03 21:29:35 +00:00
Andrew FerlitschandGitHub 2869cdb021 feat: migrate hpt distributed (#1672)
* feat: migrate hpt distributed

* fix: lint

* Update distributed_hyperparameter_tuning.ipynb
2023-04-03 19:10:34 +00:00
Xiang XuandGitHub 7b2e54bbfb fix broken names (#1681) 2023-04-03 19:04:10 +00:00
KCFindstrandGitHub 32ada1378b Make #ModelGarden TF Vision notebooks compatible with Python 3.7. (#1678) 2023-04-03 16:13:16 +00:00
Aaron DietzandGitHub 2581d90588 Updated link for BQ ML. (#1677) 2023-04-03 16:06:42 +00:00
Xiang XuandGitHub aa3aa7335f fix links (#1676) 2023-04-03 16:05:57 +00:00
Andrew FerlitschandGitHub 7028fa896e feat: migrate hpt for XGBoost (#1671) 2023-03-31 18:01:46 +00:00
Xiang XuandGitHub 9e599ac03f add clip notebooks (#1674) 2023-03-31 17:33:35 +00:00
Xiang XuandGitHub 284fabb30e add image-captioning and vqa notebooks (#1669) 2023-03-30 20:48:29 +00:00
genquan9andGitHub aee8d9fa86 Fix workbench links for icn/iod/isg notebooks (#1670)
* fix workbench links for iod/isg notebooks

* update icn workbench links as well
2023-03-30 20:46:28 +00:00
KCFindstrandGitHub 91606af0f0 Add init_checkpoints to the Model Garden TF Vision ICN notebook. (#1667) 2023-03-30 18:33:09 +00:00
Andrew FerlitschandGitHub 81ffae5a44 feat: migrate custom train and model registry (#1666) 2023-03-30 17:38:24 +00:00
KCFindstrandGitHub c1c95e5e3c Add different model configs to the Model Garden TF Vision ICN notebook. (#1662) 2023-03-30 17:04:17 +00:00
Andrew FerlitschandGitHub 7bd3814dd9 quotas still exceeded, reduce rate limit (#1661) 2023-03-30 17:03:53 +00:00
genquan9andGitHub 66f3d8497d Add model garden isg notebooks (#1654)
* add model garden isg notebooks

* fix minor style issues
2023-03-30 17:03:30 +00:00
Alexander BieniekandGitHub 8d80062253 Specifying Python Version and Pinning Dependencies for pytorch_image_classification_with_prebuilt_serving_containers.ipynb (#1649)
* specifying python version and pinning dependencies

* running linter
2023-03-30 17:03:04 +00:00
Andrew FerlitschandGitHub b9fff2e5e8 feat: migrate AutoML TSE for batch (#1663) 2023-03-30 17:02:19 +00:00
Andrew FerlitschandGitHub df6ffb7a48 feat: migrate AutoML TEE for batch (#1664) 2023-03-30 17:02:19 +00:00
Ivan CheungandGitHub 84d7b17098 Merge pull request #1660 from GoogleCloudPlatform/imkc--matching-engine-analytics
Added tracking pixels to matching engine notebooks
2023-03-27 19:00:25 +00:00
ivanmkc@google.com 7ce3015958 Ran linter 2023-03-27 14:36:32 -04:00
ivanmkc@google.com 0aafebdff3 Added tracking pixels 2023-03-27 14:34:12 -04:00
Andrew FerlitschandGitHub eaddeb62d7 Merge pull request #1653 from aarondietz234/notebook-updates
Updated Vertex AI Workbench link
2023-03-24 22:29:20 +00:00
Andrew FerlitschandGitHub 3b919c1e7d Merge pull request #1651 from genquan9/mg
Add model garden iod notebook
2023-03-24 22:28:30 +00:00
Andrew FerlitschandGitHub ff6a43cbad Merge branch 'main' into mg 2023-03-24 15:27:30 -07:00
genquan9 c03b0343d0 remove redundant headers 2023-03-24 22:10:35 +00:00
genquan9 bbabed68b8 delete custom and hpt jobs 2023-03-24 22:03:28 +00:00
Aaron Dietz 858fed1b07 Updated Vertex AI Workbench link 2023-03-24 22:01:53 +00:00
genquan9 2bbb773eef Fix IOD notebook comments 2023-03-24 21:50:09 +00:00
genquan9 0d8df106ef Add more comments and model selections 2023-03-24 20:02:53 +00:00
genquan9 749eb6eb74 add model garden iod notebook 2023-03-24 16:04:14 +00:00
Andrew FerlitschandGitHub 71d01b8dcd Merge pull request #1650 from xiangxu-google/xiangxu_controlnet
Add controlnet notebook for model garden
2023-03-24 15:35:47 +00:00
Andrew FerlitschandGitHub 56a0605ba1 Merge pull request #1615 from GoogleCloudPlatform/eval_steps_fix
fix: tabular to text
2023-03-24 15:32:07 +00:00
Andrew FerlitschandGitHub 368152fdcb Merge pull request #1647 from gericdong/b1454
chore: cleanup distributed training notebook
2023-03-24 15:31:32 +00:00
gericdong 86e9323847 addressed review comments 2023-03-24 08:33:20 -04:00
xiangxu ce90f9b07d add controlnet 2023-03-24 03:21:14 +00:00
Andrew Ferlitsch a6450646bd fix: get eval by id 2023-03-24 02:01:18 +00:00
Andrew FerlitschandGitHub 7117ab3023 Merge pull request #1639 from GoogleCloudPlatform/automl_iod_predict
feat: automl object detection predict
2023-03-23 22:00:04 +00:00
gericdong 5486fae2e6 chore: cleanup distributed training notebook 2023-03-23 17:04:43 -04:00
Andrew FerlitschandGitHub 83047c3604 Merge pull request #1646 from xiangxu-google/fix_link
Fix links for pytorch OSS notebooks
2023-03-23 20:50:21 +00:00
Andrew FerlitschandGitHub 416ec5081c Merge pull request #1645 from genquan9/mg
fix colab/workbench links for icn notebooks
2023-03-23 20:49:46 +00:00
xiangxu 72cd14c7f9 fix links 2023-03-23 20:30:23 +00:00
genquan9 23f7217a5e fix colab/workbench links 2023-03-23 20:17:12 +00:00
Andrew FerlitschandGitHub 81df7b2103 Merge pull request #1644 from genquan9/mg
Remove reductant information, and fix typo for ICN notebooks
2023-03-23 19:36:05 +00:00
genquan9 db8e4aa3b1 Remove reductant information, and fix typo for ICN notebooks 2023-03-23 18:57:24 +00:00
gericdongandGitHub 5834bdf57b Merge pull request #1640 from GoogleCloudPlatform/automl_iod_edge
feat: automl object detection edge
2023-03-23 18:41:45 +00:00
Andrew FerlitschandGitHub 25484d8244 fix spelling 2023-03-23 11:12:21 -07:00
Andrew FerlitschandGitHub 77b33d1f54 fix link 2023-03-23 11:09:31 -07:00
Andrew FerlitschandGitHub 71376764a4 Merge pull request #1641 from GoogleCloudPlatform/andrewferlitsch-patch-11
remove invalid property
2023-03-23 16:07:39 +00:00
Andrew FerlitschandGitHub 5252708bff remove invalid property 2023-03-23 08:21:00 -07:00
Andrew FerlitschandGitHub 58fe261d12 Merge pull request #1469 from GoogleCloudPlatform/dependabot/pip/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/trainer/torch-1.13.1
Build(deps): Bump torch from 1.8.1 to 1.13.1 in /community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/trainer
2023-03-23 01:12:53 +00:00
Andrew FerlitschandGitHub 3932db4033 Merge pull request #1638 from genquan9/mg
Fix input train and val data path in ICN notebook
2023-03-23 01:11:21 +00:00
Andrew FerlitschandGitHub 3d276d9bd4 Merge pull request #1637 from xiangxu-google/xiangxu_instructpix2pix
Add instruct-pix2pix notebook to model garden
2023-03-23 01:10:31 +00:00
Andrew Ferlitsch 3a09e269a8 feat: automl object detection edge 2023-03-23 01:07:25 +00:00
Andrew Ferlitsch 50efecfaab feat: automl object detection predict 2023-03-23 01:00:32 +00:00
xiangxu 4c68aff8b3 add instruct-pix2pix notebook 2023-03-23 00:10:20 +00:00
genquan9 1f8f05d6d9 fix input train and val data path 2023-03-22 23:46:23 +00:00
Andrew FerlitschandGitHub bd03ae7831 fix for CI/CD testing 2023-03-22 16:17:25 -07:00
Andrew FerlitschandGitHub d131ab5874 Merge pull request #1636 from genquan9/mg
Set default model garden dockers for ICN notebooks
2023-03-22 22:57:36 +00:00
Andrew FerlitschandGitHub 865c2fb868 Merge pull request #1634 from xiangxu-google/xiangxu_stable_diffusion
Add stable diffusion notebooks to community model garden
2023-03-22 22:56:08 +00:00
Andrew FerlitschandGitHub 5cca6edccd Merge pull request #1537 from GoogleCloudPlatform/doc_tag_12
update tag/linkback #12 b/270404719
2023-03-22 22:53:31 +00:00
xiangxu ccdb24c145 add stable diffusion notebooks 2023-03-22 21:21:38 +00:00
genquan9 90480c3be5 reset default dockers 2023-03-22 20:45:21 +00:00
Andrew FerlitschandGitHub 943df70b47 Merge pull request #1635 from gericdong/b262311942
chore: update the feature store notebook to the template
2023-03-22 20:43:47 +00:00
gericdong 3637c8b3d7 chore: update feature store notebook to the latest template 2023-03-22 16:22:47 -04:00
Andrew FerlitschandGitHub 80fe1e5e02 Merge pull request #1632 from GoogleCloudPlatform/andrewferlitsch-patch-8
fix install
2023-03-22 17:29:34 +00:00
Andrew FerlitschandGitHub 1a59543d01 Merge pull request #1631 from GoogleCloudPlatform/andrewferlitsch-patch-7
fix install
2023-03-22 17:29:19 +00:00
Andrew FerlitschandGitHub e99629c42e Merge pull request #1621 from GoogleCloudPlatform/automl_image_batch
feat: automl image batch predict
2023-03-22 16:48:46 +00:00
Andrew FerlitschandGitHub dd774e1f02 Merge pull request #1620 from GoogleCloudPlatform/automl_icn_online
feat: automl image prediction
2023-03-22 16:47:55 +00:00
Andrew FerlitschandGitHub 31dd31e3d4 Merge pull request #1630 from GoogleCloudPlatform/andrewferlitsch-patch-6
fix --user in template
2023-03-21 22:29:09 +00:00
Andrew FerlitschandGitHub ca61199c03 Merge pull request #1633 from GoogleCloudPlatform/andrewferlitsch-patch-9
further lower rate limit
2023-03-21 22:28:20 +00:00
Andrew FerlitschandGitHub 3e0a6634a6 further lower rate limit 2023-03-21 15:03:37 -07:00
Andrew FerlitschandGitHub e45cfa6d16 fix install 2023-03-21 14:43:30 -07:00
Andrew FerlitschandGitHub dfabe38846 fix install 2023-03-21 14:38:27 -07:00
Andrew Ferlitsch 6b9a54d59e fix: lint 2023-03-21 21:35:48 +00:00
Andrew FerlitschandGitHub 2b1f97b1da fix --user in template 2023-03-21 14:18:01 -07:00
Ivan CheungandGitHub 65f5a95ac5 Merge pull request #1629 from GoogleCloudPlatform/revert-1627-imkc--tracking-pixel
Revert "WIP analytics"
2023-03-21 20:57:33 +00:00
Ivan CheungandGitHub 0441a3792e Revert "WIP analytics" 2023-03-21 16:46:06 -04:00
Andrew FerlitschandGitHub 3828455354 Merge pull request #1628 from rastringer/patch-1
Update sdk_matching_engine_create_stack_overflow_embeddings.ipynb
2023-03-21 17:51:58 +00:00
Andrew FerlitschandGitHub d38dfe79d9 Merge pull request #1627 from GoogleCloudPlatform/imkc--tracking-pixel
WIP analytics
2023-03-21 17:51:29 +00:00
Andrew FerlitschandGitHub 4ccc40db70 Merge pull request #1624 from GoogleCloudPlatform/imkc--text-to-image-matching-engine-safe-search
Matching engine text-to-image: Added explicit image detection
2023-03-21 17:50:29 +00:00
ivanmkc@google.com 330886448b Tweak 2023-03-21 13:12:28 -04:00
ivanmkc@google.com 1990422749 Ran linter 2023-03-21 13:07:24 -04:00
Andrew FerlitschandGitHub 34eda2a7ca Merge pull request #1625 from genquan9/mg
Add a notebook for model garden tfvision image classification.
2023-03-21 16:42:02 +00:00
rastringerandGitHub f5e380a08e Update sdk_matching_engine_create_stack_overflow_embeddings.ipynb 2023-03-21 11:17:06 +00:00
rastringerandGitHub 4b173f1f6f Update sdk_matching_engine_create_stack_overflow_embeddings.ipynb
Small text fix for introductory paragraph.
2023-03-21 11:15:05 +00:00
ivanmkc@google.com 752be49136 Added analytics test file 2023-03-20 20:51:11 -04:00
ivanmkc@google.com 282ecdfd39 Added periods 2023-03-20 19:45:31 -04:00
genquan9 802357f65b fix style issuese in model_garden_tfvision_image_classification.ipynb 2023-03-20 23:24:03 +00:00
ivanmkc@google.com e11598ca5a Addressed comments 2023-03-20 18:01:44 -04:00
genquan9 bf72ac6312 Merge branch 'mg' of https://github.com/genquan9/vertex-ai-samples into mg 2023-03-20 20:37:06 +00:00
genquan9 f9019ed15e Merge remote-tracking branch 'upstream/main' into mg 2023-03-20 20:34:18 +00:00
Andrew FerlitschandGitHub 20dcdd3054 fix BUCKET_URI 2023-03-20 12:44:57 -07:00
Andrew FerlitschandGitHub b566021678 missing tf 2023-03-20 12:41:59 -07:00
genquan9 5b2f4c2534 Add initial model garden tfvision image classification notebooks 2023-03-20 19:32:33 +00:00
ivanmkc@google.com 9a61e3c722 Added safety detection 2023-03-20 15:03:05 -04:00
gericdongandGitHub a56efdcec7 Merge pull request #1622 from GoogleCloudPlatform/pytorch_nccl
fix: missing code for nccl version
2023-03-20 19:01:55 +00:00
genquan9 c98d3df75a Add initial model garden tfvision image classification notebooks 2023-03-20 18:44:17 +00:00
Andrew FerlitschandGitHub 6247fbb96f Merge pull request #1516 from sarahcdugan/patch-2
Update bqml_vertexai_model_registry.ipynb
2023-03-20 18:02:17 +00:00
Andrew Ferlitsch ad339286b0 fix: missing code for nccl version 2023-03-20 17:56:18 +00:00
Andrew Ferlitsch 430d789c8f feat: automl image batch predict 2023-03-20 16:18:20 +00:00
sarahcdugan 94eef657ee Removed an incorrect comma 2023-03-20 16:17:05 +00:00
Andrew Ferlitsch 4b5ada9a44 fix: grammar 2023-03-20 16:15:08 +00:00
Andrew Ferlitsch 5c22ed4eaa fix: learn more 2023-03-20 16:00:51 +00:00
Andrew Ferlitsch 36fcc6355c fix: workbench link 2023-03-20 15:55:02 +00:00
Andrew Ferlitsch 4c881849e2 fix: workbench link 2023-03-20 15:53:25 +00:00
Andrew Ferlitsch 7d1f7650b9 feat: automl image prediction 2023-03-20 15:49:06 +00:00
Andrew FerlitschandGitHub 0183abfdd2 Update automl_text_classification_model_evaluation.ipynb 2023-03-20 08:44:59 -07:00
gericdongandGitHub b92337699a Merge pull request #1619 from GoogleCloudPlatform/sklearn_sa
fix: add missing set sa
2023-03-17 19:27:19 +00:00
gericdongandGitHub 4dcc5413cf Merge pull request #1618 from GoogleCloudPlatform/xgboost_sa_2
fix: add missing set sa
2023-03-17 18:52:15 +00:00
gericdongandGitHub 5f47ba8023 Merge pull request #1617 from GoogleCloudPlatform/xgboost_sa
fix: add missing set sa
2023-03-17 16:51:01 +00:00
Andrew Ferlitsch 698503e73d fix: add missing set sa 2023-03-17 16:14:55 +00:00
Andrew Ferlitsch e1a15c4bc9 fix: add missing set sa 2023-03-17 16:11:08 +00:00
Andrew Ferlitsch 0260d79703 fix: add missing set sa 2023-03-17 16:07:35 +00:00
Eric SchmidtandGitHub 16712e53ba Merge pull request #1614 from GoogleCloudPlatform/hier_pred
fix: correct the steps
2023-03-17 16:02:07 +00:00
gericdongandGitHub 401064a06c Merge pull request #1616 from GoogleCloudPlatform/project_id
fix: remove hw project id
2023-03-17 15:47:20 +00:00
Ivan CheungandGitHub 28d29b4691 Merge pull request #1613 from GoogleCloudPlatform/imkc--stackoverflow-redis
Added redis support to stackoverflow matching engine demo
2023-03-17 15:43:14 +00:00
ivanmkc@google.com 20902244de Ran linter 2023-03-16 23:49:17 -04:00
Andrew Ferlitsch ff5939aa8b fix: remove hw project id 2023-03-16 19:47:36 +00:00
Andrew Ferlitsch ea23ffd42a fix: tabular to text 2023-03-16 18:12:12 +00:00
sarahcduganandGitHub fb6527f66a Update bqml_vertexai_model_registry.ipynb 2023-03-16 12:59:55 -05:00
Andrew FerlitschandGitHub 55f8a6f78a Merge pull request #1608 from iversonic/patch-2
Fix a typo in the title of the tutorial
2023-03-16 17:50:59 +00:00
Andrew FerlitschandGitHub 397285f4bf Update custom_tabular_train_batch_pred_bq_pipeline.ipynb 2023-03-16 09:49:44 -07:00
Andrew Ferlitsch ea3167b8f7 fix: correct the steps 2023-03-15 20:56:43 +00:00
ivanmkc@google.com c3526504d8 Added redis info 2023-03-15 14:54:42 -04:00
Andrew FerlitschandGitHub 9a409b9011 Merge pull request #1610 from GoogleCloudPlatform/sklearn_2
fix: issue 1251
2023-03-15 17:33:11 +00:00
Andrew FerlitschandGitHub c9cca725c6 Merge pull request #1609 from GoogleCloudPlatform/sklearn_1
fix: issue 1251
2023-03-15 17:32:54 +00:00
Andrew FerlitschandGitHub 3ddc77293b Merge pull request #1612 from GoogleCloudPlatform/rate_limit
fix: lower rate limit
2023-03-15 17:32:21 +00:00
Andrew FerlitschandGitHub 7fa90ee179 Merge pull request #1607 from GoogleCloudPlatform/contributing
fix: one notebook rule
2023-03-15 16:11:02 +00:00
Andrew Ferlitsch b88a775d33 fix: lower rate limit 2023-03-15 15:52:39 +00:00
Andrew FerlitschandGitHub d58718ce27 Merge pull request #1611 from btrinh69/fs-integration-notebook
modify protobuf docs and add instructions
2023-03-15 15:48:01 +00:00
btrinh69 f380b42d49 format the notebook 2023-03-14 22:24:24 +00:00
btrinh69 98be4d8cb4 fix linter 2023-03-14 22:18:51 +00:00
Andrew Ferlitsch 765d6ee296 fix: issue 1251 2023-03-14 22:10:48 +00:00
btrinh69 d08959b1a0 modify protobuf docs and add instructions 2023-03-14 22:09:33 +00:00
Andrew Ferlitsch aec5fbfd6f fix: issue 1251 2023-03-14 22:06:54 +00:00
Mark IversonandGitHub bcba9b5ea2 Fix a typo in the title of the tutorial 2023-03-14 14:52:25 -07:00
Andrew Ferlitsch fe42cb6ebd fix: one notebook rule 2023-03-14 21:46:43 +00:00
Andrew FerlitschandGitHub 7c90baf6e3 Merge pull request #1606 from GoogleCloudPlatform/contributing
fix: simplified linter step
2023-03-14 21:34:36 +00:00
Andrew Ferlitsch f9be4f470d fix: use public image 2023-03-14 21:29:54 +00:00
Andrew Ferlitsch 309889bf6b fix: simplified linter step 2023-03-14 20:55:44 +00:00
gericdongandGitHub 8eabca5939 Merge pull request #1605 from GoogleCloudPlatform/andrewferlitsch-patch-5
obsolete
2023-03-14 20:35:55 +00:00
Andrew FerlitschandGitHub 830a762d2d obsolete 2023-03-14 13:31:32 -07:00
Ivan CheungandGitHub be95016723 Merge pull request #1604 from GoogleCloudPlatform/resource_reaper_official
fix: add more cleanup
2023-03-14 20:20:44 +00:00
Andrew Ferlitsch 0a7a2f6eeb fix: add more cleanup 2023-03-14 20:06:07 +00:00
gericdongandGitHub c0196a16b8 Merge pull request #1602 from GoogleCloudPlatform/issue_1599
fix: issue 1599
2023-03-14 16:44:17 +00:00
Andrew Ferlitsch 8e53879df1 fix: issue 1599 2023-03-14 01:47:48 +00:00
Andrew FerlitschandGitHub 8ecc2c25c6 Merge pull request #1591 from GoogleCloudPlatform/multicontender_vs_champion
feat: notebook for multicontender vs champion deployment
2023-03-14 01:31:18 +00:00
Andrew FerlitschandGitHub d98d427271 Merge pull request #1600 from iversonic/patch-1
Fix typo in title
2023-03-13 22:11:53 +00:00
Mark IversonandGitHub b35c2a89cb Fix typo in title 2023-03-13 14:15:02 -07:00
gericdongandGitHub bc93be1651 Merge pull request #1598 from gericdong/b267510213
chore: updated the XGBoost Dask notebook subject and text to be more specific
2023-03-13 18:01:07 +00:00
gericdong baa9c06cf7 Updated the objective 2023-03-13 13:55:35 -04:00
gericdongandGitHub 3f3ef75aba Merge pull request #1593 from GoogleCloudPlatform/bad_links_blessed
fix: bad links
2023-03-13 17:49:18 +00:00
Andrew FerlitschandGitHub 1a2a0f1d50 Update multicontender_vs_champion_deployment_method.ipynb 2023-03-13 09:07:53 -07:00
Andrew FerlitschandGitHub 93a099f65b Update challenger_vs_blessed_deployment_method.ipynb 2023-03-13 09:06:40 -07:00
gericdong b6804cdf78 chore: updated the notebook text to be more specific 2023-03-13 10:54:22 -04:00
Andrew FerlitschandGitHub b641e0857e Merge pull request #1371 from btrinh69/prediction-featurestore-integration
add an E2E notebook for Prediction and Featurestore integration
2023-03-11 01:48:11 +00:00
Andrew FerlitschandGitHub e12faf03ed Merge pull request #1597 from btrinh69/fs-integration-notebook
Add an introduction section and more details to the doc
2023-03-11 01:46:32 +00:00
btrinh69 d24f0d0f21 fix linter 2023-03-10 23:58:27 +00:00
btrinh69 c50d38e82f Add an introduction section and more details to the doc 2023-03-10 23:44:36 +00:00
gericdongandGitHub 52f458fd7d Merge pull request #1596 from gericdong/b269273823-2
fix: Incorporated Tech Writer's feedback on the PyTorch container notebook
2023-03-10 19:16:28 +00:00
gericdong eeaf34aa3b fix: address tech writer feedback on the PyTorch container notebook 2 2023-03-10 14:13:54 -05:00
gericdong 705f64dc32 fix: address tech writer feedback on the PyTorch container notebook 2023-03-10 14:04:25 -05:00
Eric SchmidtandGitHub 3830e14fd6 Merge pull request #1595 from GoogleCloudPlatform/cohost_linkback
fix: linkback
2023-03-10 18:09:11 +00:00
Eric SchmidtandGitHub bd55db1efc Merge pull request #1594 from GoogleCloudPlatform/linkback_mm
fix: linkback
2023-03-10 17:21:42 +00:00
Andrew Ferlitsch 07c0f3710f fix: linkback 2023-03-10 17:16:00 +00:00
Andrew Ferlitsch f9de0b6315 fix: linkback 2023-03-10 16:55:09 +00:00
Andrew Ferlitsch 5052d1f44d fix: bad links 2023-03-10 16:48:54 +00:00
Andrew Ferlitsch 35fbd744e2 fix: bad links 2023-03-10 16:43:30 +00:00
Andrew Ferlitsch 6d394e639c fix: bad links 2023-03-10 16:41:11 +00:00
Andrew Ferlitsch 540410ba89 fix: kfp install 2023-03-10 16:16:19 +00:00
Andrew FerlitschandGitHub 26e6548988 Merge pull request #1592 from gericdong/b269273823
feat: add a notebook sample for PyTorch image models with prebuilt containers
2023-03-09 21:34:49 +00:00
Andrew Ferlitsch 16de6f1b99 fix: review comments 2023-03-09 21:29:47 +00:00
gericdong 8cb2e868ce Updated with review commentss 2 2023-03-09 15:59:44 -05:00
gericdong 3153e24e57 Updated with review commentss 2023-03-09 15:55:08 -05:00
Andrew FerlitschandGitHub f40a81dda7 Merge pull request #1574 from inardini/inardini--experiments-autologging
feat: add notebook for experiments autologging
2023-03-09 20:45:17 +00:00
Andrew Ferlitsch 1590d1cc6f fix: install gcpc 2023-03-09 20:44:43 +00:00
gericdong 6b065f1c5a feat: add notebook for PyTorch image models with prebuilt containers 2023-03-09 15:23:41 -05:00
Andrew Ferlitsch b88fddd6bb fix: install kfp 2023-03-09 20:21:14 +00:00
Andrew Ferlitsch 22454b5318 fix: install kfp 2023-03-09 19:54:13 +00:00
Andrew FerlitschandGitHub e26190b5e3 Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-09 11:49:37 -08:00
Andrew Ferlitsch e6ecd23556 feat: notebook for multicontender vs champion deployment 2023-03-09 19:17:15 +00:00
Andrew FerlitschandGitHub a342923353 Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-09 10:59:34 -08:00
Andrew FerlitschandGitHub 0adcf3d60c Merge pull request #1584 from GoogleCloudPlatform/reznitskii-patch-19
Fixed title and grammar mistakes
2023-03-08 16:36:17 +00:00
Andrew FerlitschandGitHub 49547be529 Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-07 17:37:33 -08:00
Andrew FerlitschandGitHub 9dbd6303b0 Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-07 16:55:59 -08:00
Andrew FerlitschandGitHub ac049f3de1 Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-07 16:45:16 -08:00
Andrew FerlitschandGitHub 3bca163dea Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-07 16:32:06 -08:00
Andrew FerlitschandGitHub 8904b43308 Merge pull request #1580 from GoogleCloudPlatform/reznitskii-patch-15
Fixed title
2023-03-08 00:26:54 +00:00
Andrew FerlitschandGitHub 828926e9ab Update UJ15 Vertex SDK AutoML Object Tracking.ipynb 2023-03-07 16:26:15 -08:00
Ivan CheungandGitHub 851dfb72c1 Merge pull request #1590 from GoogleCloudPlatform/imkc--matching-engine-text-to-image-fix
Fixed broken markdown in matching engine notebooks
2023-03-08 00:06:42 +00:00
Andrew FerlitschandGitHub dea652ceca Merge pull request #1589 from GoogleCloudPlatform/reznitskii-patch-23
Fixed title
2023-03-08 00:06:08 +00:00
Andrew FerlitschandGitHub 56310240b3 Merge pull request #1587 from GoogleCloudPlatform/reznitskii-patch-22
Fixed title and grammar
2023-03-08 00:05:31 +00:00
Andrew FerlitschandGitHub d828534f28 Merge pull request #1586 from GoogleCloudPlatform/reznitskii-patch-21
Fixed title and grammar
2023-03-07 21:35:10 +00:00
Andrew FerlitschandGitHub 5b6340a15e Merge pull request #1585 from GoogleCloudPlatform/reznitskii-patch-20
Fixed title
2023-03-07 21:34:39 +00:00
Andrew FerlitschandGitHub 2d3a490aca Merge pull request #1583 from GoogleCloudPlatform/reznitskii-patch-18
Fixed title and grammar mistakes
2023-03-07 21:34:08 +00:00
Andrew FerlitschandGitHub 764ea292e5 Merge pull request #1582 from GoogleCloudPlatform/reznitskii-patch-17
Fixed title and typos
2023-03-07 21:33:28 +00:00
Andrew FerlitschandGitHub 867410462e Merge pull request #1581 from GoogleCloudPlatform/reznitskii-patch-16
Update UJ10 Vertex SDK Custom Scikit-Learn with pre-built training co…
2023-03-07 21:33:00 +00:00
Andrew FerlitschandGitHub 1874743d19 Merge pull request #1579 from GoogleCloudPlatform/reznitskii-patch-14
Added link
2023-03-07 21:32:17 +00:00
Andrew FerlitschandGitHub b19fcc9f66 Merge pull request #1578 from GoogleCloudPlatform/reznitskii-patch-13
Added link
2023-03-07 21:31:38 +00:00
Andrew FerlitschandGitHub 12db1f9e05 Merge pull request #1588 from GoogleCloudPlatform/autoindex_march_update
update: March update of index
2023-03-07 21:30:58 +00:00
ivanmkc@google.com 853b5c0a97 Fixed broken markdown 2023-03-07 15:40:35 -05:00
reznitskiiandGitHub 00aa9a2672 Update UJ5 Vertex SDK AutoML Image Object Detection.ipynb 2023-03-07 15:09:55 -05:00
Andrew Ferlitsch 7eb4eea074 update: march update of index 2023-03-07 20:06:00 +00:00
reznitskiiandGitHub 4b8b1e503b Update UJ4 Vertex SDK AutoML Tabular Binary Classification.ipynb 2023-03-07 14:34:47 -05:00
reznitskiiandGitHub db0f7fb6d7 Update UJ3 Vertex SDK Custom Image Classification with custom training container.ipynb 2023-03-07 14:30:15 -05:00
reznitskiiandGitHub cd04f66ac0 Update UJ2,12 Vertex SDK Custom Image Classification with pre-built training container.ipynb 2023-03-07 14:24:54 -05:00
reznitskiiandGitHub 419e01d1d3 Update UJ15 Vertex SDK AutoML Object Tracking.ipynb 2023-03-07 14:23:06 -05:00
reznitskiiandGitHub e7a51b394b Update UJ14 Vertex SDK AutoML Video Classification.ipynb 2023-03-07 14:22:16 -05:00
reznitskiiandGitHub fdfec862be Update UJ11 Vertex SDK Hyperparameter Tuning.ipynb 2023-03-07 14:21:24 -05:00
reznitskiiandGitHub 6da196a80b Update UJ10 Vertex SDK Custom Scikit-Learn with pre-built training container.ipynb 2023-03-07 14:19:24 -05:00
reznitskiiandGitHub 280f62a1d3 Update UJ1 Vertex SDK AutoML Image Classification.ipynb 2023-03-07 14:18:13 -05:00
reznitskiiandGitHub 20e524dda5 Update get_started_bq_datasets.ipynb 2023-03-07 14:16:48 -05:00
reznitskiiandGitHub b0c7c70b81 Update prophet_on_vertex_pipelines.ipynb 2023-03-07 14:14:03 -05:00
Andrew FerlitschandGitHub dcfc30edab Merge pull request #1576 from GoogleCloudPlatform/imkc--matching-engine-clip
Added matching engine CLIP notebook
2023-03-07 18:41:46 +00:00
Andrew FerlitschandGitHub 03fea0608d Merge pull request #1575 from GoogleCloudPlatform/imkc--matching-engine-stackoverflow
Added stackoverflow embeddings notebook
2023-03-07 18:03:52 +00:00
Andrew FerlitschandGitHub 6c15941242 Merge pull request #1577 from kthytang/fs-integration
fix: copy CPR model server to users project before using
2023-03-07 17:58:47 +00:00
kthytang 1bd5c364f5 fix: copy CPR model server to users project before using 2023-03-07 09:49:36 -08:00
Andrew FerlitschandGitHub 1c6e4a36c1 Update get_started_with_vertex_experiments_autologging.ipynb 2023-03-07 09:32:20 -08:00
ivanmkc@google.com 080d1819ed Addressed TW comments 2023-03-07 12:07:46 -05:00
ivanmkc@google.com 5679e46a12 Addressed TW comments 2023-03-07 12:01:41 -05:00
ivanmkc@google.com d54b3845fe Fixed notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb 2023-03-07 10:45:42 -05:00
ivanmkc@google.com 6a2d06f8f4 Fixed sigfig 2023-03-07 10:23:12 -05:00
ivanmkc@google.com 38a37ae8b9 Added plots 2023-03-07 10:14:40 -05:00
ivanmkc@google.com be20a635e4 Fixed missing dependency 2023-03-07 08:42:35 -05:00
ivanmkc@google.com db06465158 Added matching engine CLIP notebook 2023-03-07 08:40:49 -05:00
ivanmkc@google.com b42b6c6fb8 Added missing cells 2023-03-06 23:34:27 -05:00
ivanmkc@google.com 73fbc762fe Added tqdm to requirements.txt 2023-03-06 20:00:53 -05:00
ivanmkc@google.com 994a86d07a Fixed bugs 2023-03-06 16:53:46 -05:00
ivanmkc@google.com 71c1eca210 Fixed predictions 2023-03-06 16:16:39 -05:00
inardini 20cdcefea3 linter passed 2023-03-06 20:47:57 +00:00
inardini 26db26d100 add andy reviews 2023-03-06 20:47:26 +00:00
Andrew FerlitschandGitHub 01575ae76d Merge pull request #1570 from GoogleCloudPlatform/blessed_vs_challenger
feat: challenger vs blessed deployment method
2023-03-06 20:04:40 +00:00
ivanmkc@google.com 1c431bdb85 Updated links 2023-03-06 14:41:50 -05:00
ivanmkc@google.com 096a5d069e Linted 2023-03-06 14:38:29 -05:00
Andrew Ferlitsch d795b6e1f5 fix:missing install 2023-03-06 19:11:08 +00:00
Andrew FerlitschandGitHub 34eaf50f2c Merge pull request #1573 from kthytang/fs-integration
fix: update the cpr image used in the feature store prediction integr…
2023-03-06 17:57:14 +00:00
Andrew Ferlitsch 08ffe85ddf fix:missing install 2023-03-06 17:19:30 +00:00
ivanmkc@google.com 3ade1ab265 Added stackoverflow embeddings notebook 2023-03-06 10:45:06 -05:00
inardini 6e71605669 linter passed 2023-03-06 12:55:26 +00:00
inardini f8af22386c comment colab 2023-03-06 12:54:57 +00:00
inardini 9d7a744924 update codeowners 2023-03-06 08:56:07 +00:00
inardini 4f8a527f5c linter passed 2023-03-06 08:50:24 +00:00
inardini 4a987f5dcb fix linter 2023-03-06 08:49:59 +00:00
inardini a2a3de5767 add new autologging notebook tutorial 2023-03-06 08:45:18 +00:00
kthytang 3ca5d6cad6 fix: update the cpr image used in the feature store prediction integration notebook 2023-03-05 20:09:05 -08:00
Andrew Ferlitsch 9117fbbb71 fix:missing install 2023-03-04 01:57:32 +00:00
Andrew Ferlitsch 607c2605fa fix:missing install 2023-03-03 23:10:37 +00:00
Andrew Ferlitsch 3509bbc383 fix:missing install 2023-03-03 22:31:34 +00:00
Andrew FerlitschandGitHub 8593308244 Merge pull request #1569 from ninataneja/final-doc-change
Update dashboard instructions
2023-03-03 22:29:28 +00:00
Nina Taneja 806801b4ea Fix print error 2023-03-03 21:15:33 +00:00
Andrew Ferlitsch a1b1ff9a6b feat: challenger vs blessed deployment method 2023-03-03 21:05:35 +00:00
Nina Taneja 3acd72ec81 Fix lint error 2023-03-03 20:49:42 +00:00
Nina Taneja 12347f3ce2 Add error handling for delete job 2023-03-03 20:45:29 +00:00
Nina Taneja f9c4e32088 Add sleep for async job 2023-03-03 20:11:00 +00:00
Nina Taneja 78da2206b0 Update dashboard instructions 2023-03-03 18:50:21 +00:00
gericdongandGitHub 46fa993732 Merge pull request #1559 from GoogleCloudPlatform/ml_ops_registry
feat: add notebook for model versioning
2023-03-03 18:43:05 +00:00
Andrew FerlitschandGitHub df0c0d209b Merge pull request #1568 from kthytang/fs-integration
feat: notebook for prediction feature store integration
2023-03-03 18:32:05 +00:00
kthytang 2e8d6239df chore: run python3.9 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook" 2023-03-03 10:02:46 -08:00
Andrew Ferlitsch 1841201fee fix: dep issue 2023-03-03 17:20:44 +00:00
kthytang f10857f299 chore: address comments 2023-03-03 07:17:50 -08:00
btrinh69 1e4b3aefdb address comments 2023-03-03 00:55:11 +00:00
kthytang e3bcff62fc chore: fix lint 2023-03-02 14:18:47 -08:00
kthytang ce3a439d06 feat: notebook for prediction feature store integration 2023-03-02 14:04:38 -08:00
Andrew FerlitschandGitHub b47d4b46f3 Merge pull request #1567 from GoogleCloudPlatform/reznitskii-patch-12
Fixed typo
2023-03-02 21:40:56 +00:00
Andrew FerlitschandGitHub 1cc87860c4 Merge pull request #1566 from GoogleCloudPlatform/reznitskii-patch-11
Fixed typo and link
2023-03-02 21:40:06 +00:00
reznitskiiandGitHub 5d6aa4479d Update automl_video_classification_model_evaluation.ipynb 2023-03-02 15:11:07 -05:00
reznitskiiandGitHub 5a25b06f2d Update UJ14 Vertex SDK AutoML Video Classification.ipynb 2023-03-02 15:09:45 -05:00
Andrew Ferlitsch bb055ed061 fix: cleanup 2023-03-02 18:26:45 +00:00
Andrew FerlitschandGitHub 974610a555 Merge pull request #1562 from GoogleCloudPlatform/reznitskii-patch-8
Updated link
2023-03-02 08:25:51 +00:00
Andrew FerlitschandGitHub d78574e640 Merge pull request #1565 from ninataneja/dask-sdk
Add SDK support for Dask dashboard to Training
2023-03-02 08:25:22 +00:00
Nina Taneja ff367ae9f5 Fixed formatting problem 2023-03-02 01:34:46 +00:00
Nina Taneja 40b5e74645 Addressed formatting and wording changes 2023-03-02 01:26:52 +00:00
Nina Taneja dee509e8d7 Add SDK support for Dask dashboard to Training 2023-03-01 23:39:06 +00:00
Andrew Ferlitsch fd5921fa32 fix: invalid alias 2023-03-01 22:55:39 +00:00
reznitskiiandGitHub c74a44a4a8 Update sdk_automl_tabular_classification_online_explain.ipynb 2023-03-01 17:22:30 -05:00
Andrew FerlitschandGitHub 367c985642 Merge pull request #1560 from GoogleCloudPlatform/autoindex_tensorboard
fix: tensorboard branding
2023-03-01 22:03:24 +00:00
Andrew Ferlitsch f7a970e15b fix: TIMESTAMP 2023-03-01 21:53:51 +00:00
Andrew Ferlitsch 9a914a5af4 fix: tensorboard branding 2023-03-01 21:46:57 +00:00
Andrew Ferlitsch e5315be85a feat: add notebook for model versioning 2023-03-01 20:54:17 +00:00
Andrew FerlitschandGitHub 6daf663a69 Merge pull request #1557 from GoogleCloudPlatform/custom_eval
feat: notebook for custom evaluations
2023-03-01 20:15:56 +00:00
Andrew Ferlitsch 45a65f1db8 fix: install issue 2023-03-01 20:05:54 +00:00
Andrew Ferlitsch 240c291728 feat: add eval on versioned model 2023-03-01 19:21:21 +00:00
gericdongandGitHub 4aec14c576 Merge pull request #1558 from GoogleCloudPlatform/andrewferlitsch-patch-4
tmp file added by mistake
2023-03-01 18:34:45 +00:00
Andrew FerlitschandGitHub f7d4d3a9c3 tmp file added by mistake 2023-03-01 10:08:20 -08:00
Andrew Ferlitsch 3c64a8aa58 fix: review nits 2023-03-01 18:04:34 +00:00
Andrew Ferlitsch 5f692ea299 fix: missing installs 2023-03-01 16:06:54 +00:00
Andrew FerlitschandGitHub ab1e97ac18 Merge pull request #1553 from GoogleCloudPlatform/autoindex_max_3
fix: 5 branding bugs
2023-03-01 16:04:23 +00:00
Andrew FerlitschandGitHub 78630ae2c0 Merge pull request #1552 from GoogleCloudPlatform/reznitskii-patch-3
Fixed typo
2023-03-01 16:03:51 +00:00
Andrew Ferlitsch 0f48628782 feat: notebook for custom evaluations 2023-03-01 00:52:20 +00:00
Andrew Ferlitsch 93e9fbac92 fix: 5 branding bugs 2023-02-28 20:42:03 +00:00
Andrew FerlitschandGitHub 231b2ef02b Merge pull request #1556 from GoogleCloudPlatform/reznitskii-patch-6
Fixed typo
2023-02-28 20:40:04 +00:00
Andrew FerlitschandGitHub 7132c12831 Merge pull request #1555 from GoogleCloudPlatform/reznitskii-patch-5
Fixed typos
2023-02-28 20:31:30 +00:00
reznitskiiandGitHub 2b547e8279 Update forecasting-retail-demand.ipynb 2023-02-28 15:24:25 -05:00
reznitskiiandGitHub 8b84524244 Update ai-explanations-tabnet-algorithm.ipynb 2023-02-28 15:21:53 -05:00
Andrew Ferlitsch 60fe1bd2c6 fix: 5 branding bugs 2023-02-28 20:16:57 +00:00
reznitskiiandGitHub 0edea80ffa Update custom_tabular_regression_model_evaluation.ipynb 2023-02-28 15:02:47 -05:00
Yvonne LiandGitHub 493e50a999 Merge pull request #1550 from GoogleCloudPlatform/autoindex_max_2
fix: extra period in link
2023-02-28 19:50:08 +00:00
Andrew Ferlitsch 8440e7f164 fix: extra period in link 2023-02-28 19:44:33 +00:00
gericdongandGitHub 906aa91fe7 Merge pull request #1549 from GoogleCloudPlatform/mv_pytorch
fix: reorg
2023-02-28 18:41:15 +00:00
gericdongandGitHub 34e282172f Merge pull request #1548 from GoogleCloudPlatform/rm_pytorch_folder
fix: reorg
2023-02-28 18:29:13 +00:00
Andrew Ferlitsch bddf642b58 fix: reorg 2023-02-28 18:24:55 +00:00
Andrew Ferlitsch 25b89c497f fix: reorg 2023-02-28 18:19:55 +00:00
Andrew FerlitschandGitHub 23a51dbcaa Merge pull request #1526 from GoogleCloudPlatform/doc_tag_1
update tag/linkback #1 AutoML Video
2023-02-28 18:15:56 +00:00
Andrew FerlitschandGitHub 26761198d7 Merge pull request #1547 from GoogleCloudPlatform/autoindex_max_1
fix: web index tune
2023-02-28 17:39:34 +00:00
Andrew Ferlitsch 5b4e88e791 fix: web index tune 2023-02-28 17:29:45 +00:00
Andrew Ferlitsch 83cc796687 fix: workaround for running > 24hrs 2023-02-28 17:05:34 +00:00
Andrew FerlitschandGitHub 3e29cc62c7 Merge pull request #1536 from GoogleCloudPlatform/doc_tag_11
update tag/linkback #11 AutoML Video
2023-02-28 17:02:09 +00:00
Andrew FerlitschandGitHub 2b1bb77f4b Merge pull request #1535 from GoogleCloudPlatform/doc_tag_10
update tag/linkback #10 AutoMLVideo
2023-02-28 16:55:55 +00:00
Andrew Ferlitsch 7144b87f01 fix: workaround for running > 24hrs 2023-02-28 16:50:51 +00:00
Andrew Ferlitsch ebf4d6d8be fix: workaround for running > 24hrs 2023-02-28 16:47:14 +00:00
Andrew FerlitschandGitHub 2ccd913e2e Merge pull request #1528 from GoogleCloudPlatform/doc_tag_3
update tag/linkback #3 AutoML Video
2023-02-28 16:45:02 +00:00
Andrew Ferlitsch d777dd8625 fix: workaround for running > 24hrs 2023-02-28 16:32:16 +00:00
Andrew FerlitschandGitHub d912d3d4d8 Merge pull request #1545 from GoogleCloudPlatform/reznitskii-patch-1
Fixed typo
2023-02-28 02:29:29 +00:00
reznitskiiandGitHub bafe623590 Update automl_tabular_regression_model_evaluation.ipynb 2023-02-27 17:34:34 -05:00
gericdongandGitHub 152077a823 Merge pull request #1543 from GoogleCloudPlatform/guidelines
feat: add authoring guidelines
2023-02-27 20:43:43 +00:00
Andrew Ferlitsch 81c94f9711 feat: add authoring guidelines 2023-02-27 19:53:10 +00:00
Andrew FerlitschandGitHub 897e8e3e47 Merge pull request #1541 from GoogleCloudPlatform/template_linkback
fix: add tag/linkback
2023-02-27 18:06:24 +00:00
Andrew Ferlitsch ddc125da69 fix: smaller dataset 2023-02-27 16:16:13 +00:00
Eric SchmidtandGitHub abb66ade41 Merge pull request #1542 from gericdong/b270683209
fix: bad links in notebook
2023-02-24 17:06:07 +00:00
gericdong 2915824641 Lint 2023-02-24 09:03:19 -05:00
gericdong 44447637bd fixed bad links 2023-02-24 08:59:24 -05:00
Andrew FerlitschandGitHub 6a8345446d Merge pull request #1504 from reznitskii/b267661933-2
Replaced Vertex AI Training linkbacks with Custom training
2023-02-24 02:13:42 +00:00
Andrew Ferlitsch 27a7b8b1da fix: add tag/linkback 2023-02-24 00:22:18 +00:00
Andrew FerlitschandGitHub 04471e7104 Merge pull request #1540 from GoogleCloudPlatform/issue_1522
fix: link
2023-02-23 17:43:06 +00:00
Andrew FerlitschandGitHub e78ea4e805 Merge pull request #1538 from wintwoo/dataproc
Specify Dataproc Serverless Runtime version to use for batch workloads.
2023-02-23 04:14:06 +00:00
Andrew Ferlitsch 7487a14783 fix: link 2023-02-22 23:07:37 +00:00
Andrew FerlitschandGitHub 757d0c5087 change copyright back to 2022. Policy is year is the year first authored 2023-02-22 15:00:49 -08:00
Andrew FerlitschandGitHub 60cb93a9a9 Delete pytorch-text-sentiment-classification-custom-train-deploy.ipynb 2023-02-22 14:43:12 -08:00
Andrew FerlitschandGitHub 0fb72773f4 Merge pull request #1533 from GoogleCloudPlatform/doc_tag_8
update tag/linkback #8
2023-02-22 22:21:16 +00:00
Andrew FerlitschandGitHub 5d2fc74f78 Merge pull request #1532 from GoogleCloudPlatform/doc_tag_7
update tag/linkback #7
2023-02-22 22:20:58 +00:00
Andrew FerlitschandGitHub 1cc26481b2 Merge pull request #1531 from GoogleCloudPlatform/doc_tag_6
update tag/linkback #6
2023-02-22 22:20:50 +00:00
Andrew FerlitschandGitHub 85b0346eab Merge pull request #1530 from GoogleCloudPlatform/doc_tag_5
update tag/linkback #5
2023-02-22 22:20:24 +00:00
Andrew FerlitschandGitHub 910cbacb54 Merge pull request #1529 from GoogleCloudPlatform/doc_tag_4
update tag/linkback #4
2023-02-22 22:19:44 +00:00
Andrew FerlitschandGitHub c7206e3cc8 Merge pull request #1527 from GoogleCloudPlatform/doc_tag_2
update tag/linkback #2
2023-02-22 21:46:40 +00:00
Win Woo 12d721d33e Specify Dataproc runtime versions to use for batch jobs 2023-02-22 02:46:00 +00:00
Andrew FerlitschandGitHub 16df2216d1 Merge pull request #1525 from GoogleCloudPlatform/triton_ensenble_2
feat: triton ensemble
2023-02-21 21:32:16 +00:00
Andrew Ferlitsch fb26b7213c fix: links 2023-02-21 21:30:12 +00:00
Andrew Ferlitsch d90f52e122 fix: links 2023-02-21 19:47:23 +00:00
Andrew Ferlitsch 17f42b3044 update tag/linkback 2023-02-21 18:46:12 +00:00
Andrew Ferlitsch 652f34b814 update tag/linkback 2023-02-21 18:37:09 +00:00
Andrew Ferlitsch c84f8738f8 update tag/linkback 2023-02-21 18:16:13 +00:00
Andrew Ferlitsch 9d72bbf237 update tag/linkback 2023-02-21 18:02:11 +00:00
Andrew Ferlitsch 85df50d06f update tag/linkback 2023-02-21 17:39:51 +00:00
Andrew Ferlitsch 9ab6cddade update tag/linkback 2023-02-21 17:33:56 +00:00
Andrew Ferlitsch 02ffffaeb7 update tag/linkback 2023-02-21 17:30:03 +00:00
Andrew Ferlitsch dfc5635d34 update tag/linkback 2023-02-21 17:25:40 +00:00
Andrew Ferlitsch 90b686cf69 update tag/linkback 2023-02-21 17:02:33 +00:00
Andrew Ferlitsch ad63153778 update tag/linkback 2023-02-21 16:58:56 +00:00
Andrew Ferlitsch 7858f8644e update tag/linkback 2023-02-21 16:55:10 +00:00
Andrew Ferlitsch 3df4098364 update tag/linkback 2023-02-21 16:46:03 +00:00
Andrew Ferlitsch ae3c1877e4 update tag/linkback 2023-02-21 16:41:17 +00:00
Andrew FerlitschandGitHub 2798ab1e02 set timeout 2023-02-21 08:33:40 -08:00
Andrew FerlitschandGitHub 7bd2c567a1 Merge pull request #1490 from GoogleCloudPlatform/imkc--matching-engine-embedding-tweak
Fixed typo in sdk_matching_engine_for_indexing.ipynb
2023-02-18 00:48:17 +00:00
Andrew Ferlitsch 56503cce6a feat: triton ensemble 2023-02-17 22:10:20 +00:00
Andrew FerlitschandGitHub a5a9f53a32 Merge pull request #1515 from junyanxu/add_experimental_info_to_automl_image_montioring_notebook
Add experimental information to automl image classifcation monitoring…
2023-02-17 15:52:07 +00:00
Junyan Xu 469e8436e9 Format the automl image online for model monitoring 2023-02-16 22:37:50 +00:00
Junyan Xu e9f9a5c29b Merge branch 'add_experimental_info_to_automl_image_montioring_notebook' of https://github.com/junyanxu/vertex-ai-samples into add_experimental_info_to_automl_image_montioring_notebook 2023-02-16 17:19:49 +00:00
Junyan Xu 102400a67f update online pip install package 2023-02-16 17:19:00 +00:00
Andrew FerlitschandGitHub 0ae53f47d4 Update get_started_with_model_monitoring_automl_image_batch.ipynb 2023-02-16 08:27:40 -08:00
Eric SchmidtandGitHub ff3e0b4784 Merge pull request #1519 from GoogleCloudPlatform/autoindex_official_6
tune: web index
2023-02-15 21:03:10 +00:00
Andrew Ferlitsch 0f4546c18c tune: web index 2023-02-15 20:56:47 +00:00
Andrew FerlitschandGitHub ee381e15f5 Update get_started_with_model_monitoring_automl_image_batch.ipynb 2023-02-15 12:13:36 -08:00
Andrew FerlitschandGitHub 4ddeeb290d Merge pull request #1295 from Ark-kun/Train_tabular_models
Train tabular models with many frameworks and import to Vertex AI using Pipelines
2023-02-15 19:54:11 +00:00
Andrew FerlitschandGitHub 7e99b07440 Merge branch 'main' into Train_tabular_models 2023-02-15 11:53:17 -08:00
Andrew FerlitschandGitHub bc1ecd6260 Merge pull request #1334 from renovate-bot/renovate/isort-5.x
chore(deps): update dependency isort to v5.12.0
2023-02-15 19:49:21 +00:00
Andrew FerlitschandGitHub f662ffb3e1 Merge pull request #1328 from renovate-bot/renovate/black-22.x
chore(deps): update dependency black to v22.12.0
2023-02-15 19:48:46 +00:00
Andrew FerlitschandGitHub c40c0e5247 Merge pull request #1227 from sudarshan-SpringML/auto_tab_on_vertex_pipeline
Update the file automl_tabular_on_vertex_pipelines
2023-02-15 19:32:19 +00:00
Eric SchmidtandGitHub bd3a0f5af0 Merge pull request #1518 from GoogleCloudPlatform/issue_265061259
fix: issue
2023-02-15 17:46:37 +00:00
Andrew Ferlitsch 99f318333b fix: issue 2023-02-15 17:10:28 +00:00
dependabot[bot]andGitHub 9d36e837bb Build(deps): Bump torch
Bumps [torch](https://github.com/pytorch/pytorch) from 1.8.1 to 1.13.1.
- [Release notes](https://github.com/pytorch/pytorch/releases)
- [Changelog](https://github.com/pytorch/pytorch/blob/master/RELEASE.md)
- [Commits](https://github.com/pytorch/pytorch/compare/v1.8.1...v1.13.1)

---
updated-dependencies:
- dependency-name: torch
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>
2023-02-15 16:55:38 +00:00
Andrew FerlitschandGitHub 11e7ba47a4 Merge pull request #1470 from GoogleCloudPlatform/dependabot/pip/community-content/pytorch_image_classification_single_gpu_with_vertex_sdk_and_torchserve/trainer/torch-1.13.1
Build(deps): Bump torch from 1.8.1 to 1.13.1 in /community-content/pytorch_image_classification_single_gpu_with_vertex_sdk_and_torchserve/trainer
2023-02-15 16:54:21 +00:00
Andrew FerlitschandGitHub 399427c2de Merge pull request #1495 from TheMichaelHu/mh-prophet
Reduce cost of running prophet notebook
2023-02-15 15:43:17 +00:00
Andrew FerlitschandGitHub 1a3cbb4cf0 fix corrupted format 2023-02-15 07:24:17 -08:00
gericdongandGitHub 0f116ab253 Merge pull request #1517 from GoogleCloudPlatform/stable-diffusion-fixes
chore: revisions to Stable Diffusion and TorchServe nb
2023-02-15 13:33:54 +00:00
Michael Hu 304000d719 use n1-standard-2s 2023-02-14 22:18:13 -05:00
Eric Schmidt 36df462615 chore: revisions to Stable Diffusion and TorchServe nb 2023-02-15 02:32:02 +00:00
Andrew FerlitschandGitHub 909f771bfd Merge pull request #1514 from abcdefgs0324/pytorch_ga
Update wording for pre-built pytorch images on Vertex Prediction.
2023-02-14 17:07:03 +00:00
Eric SchmidtandGitHub e9bef3542d Merge pull request #1510 from GoogleCloudPlatform/stable-diffusion-try2
feat: adds stable diffusion notebook with PyTorch serving
2023-02-13 20:33:24 +00:00
Eric Schmidt 037a3b041a linting 2023-02-13 20:31:22 +00:00
Eric Schmidt f55e6c60cd per reviewer 2023-02-13 18:11:09 +00:00
sarahcduganandGitHub e7e7a8e22c Update bqml_vertexai_model_registry.ipynb
XAI is now available for BQML models added to the Vertex AI Model Registry
2023-02-11 13:19:46 -06:00
Eric Schmidt 2cd815c640 light edit 2023-02-10 23:00:11 +00:00
Eric Schmidt b1c0cc9a9d linter 2023-02-10 22:44:33 +00:00
Eric Schmidt af63d1c0e2 Revised notebook to use existing model 2023-02-10 22:40:38 +00:00
Junyan Xu c51a82febb format notebook 2023-02-10 19:15:15 +00:00
Junyan Xu 8e6e4729aa Add experimental information to automl image classifcation monitoring notebook 2023-02-10 18:48:09 +00:00
Eric Schmidt 0e97a83836 revisions 2023-02-10 17:06:33 +00:00
Eric Schmidt f6645e0125 moved notebook 2023-02-10 17:01:13 +00:00
Chun-Hsiang Wang 52385a6071 samples: Updated wording and removed preview email. 2023-02-10 00:43:43 +00:00
Chun-Hsiang WangandGitHub 2365d733c4 Merge branch 'GoogleCloudPlatform:main' into pytorch_ga 2023-02-09 12:55:15 -08:00
Eric Schmidt 71e6423066 iter 2023-02-09 18:06:24 +00:00
Eric Schmidt 139ed95ffc iter 2023-02-09 18:02:07 +00:00
Eric Schmidt cafd192417 deleted notebooks from old location 2023-02-09 17:32:32 +00:00
Eric Schmidt 0d7ec7cd60 iter 2023-02-09 17:21:45 +00:00
Eric Schmidt 7fd934045a moved location of notebook 2023-02-09 17:21:02 +00:00
Max Reznitskii 4e82877269 Reverting changes to failing notebooks 2023-02-09 16:42:44 +00:00
Andrew FerlitschandGitHub 6ef111144d fix: lost updates (#1513) 2023-02-08 18:35:05 -05:00
Eric Schmidt e9b8aa02e9 linter 2023-02-07 14:27:36 -08:00
Eric Schmidt ac1af33c8c feat: adds stable diffusion notebook with PyTorch serving 2023-02-07 21:50:22 +00:00
Andrew FerlitschandGitHub 5bc18b01e4 feat: MM for automl image (#1483)
* feat: MM for automl image

* feat: MM for automl image

* fix: missing import for testing

* fix: testing

* fix: test timing issues

* debug: timing

* test: fix timing issue

* tune: updates from TW for web index

* fix: code review
2023-02-07 14:21:16 -05:00
Andrew FerlitschandGitHub e98b9d6eb4 fix: bad link (#1507) 2023-02-07 10:52:10 -08:00
Andrew FerlitschandGitHub 5e6b8bf597 fix: bad link (#1508) 2023-02-07 10:51:28 -08:00
Andrew FerlitschandGitHub 5b39e7d995 fix: bad link (#1506) 2023-02-07 10:51:08 -08:00
Max Reznitskii c4f08589a9 Reverting changes to notebooks that fail tests 2023-02-03 19:21:48 +00:00
04c6ff4ec7 Fixed AutoML Tabular linkbacks. Linkbacks now refer to specific tabular data tasks. (#1503)
Co-authored-by: Max Reznitskii <reznitskii@google.com>
2023-02-03 10:35:37 -08:00
Max Reznitskii bcb0b19dc4 Replaced Vertex AI Training linkbacks with Custom training 2023-02-02 23:04:08 +00:00
Ivan CheungGitHubivanmkc@google.com <ivanmkc@google.com>
5586fd7c4d Fixed comment about GCS (#1500)
Co-authored-by: ivanmkc@google.com <ivanmkc@google.com>
2023-02-02 14:30:02 -08:00
gericdongandGitHub 30e747b966 correct/remove invalid github usernames (#1502) 2023-02-02 13:24:44 -08:00
Andrew FerlitschandGitHub 080e2b5bb5 fix: missed updates (#1499) 2023-02-01 15:52:22 -05:00
Michael Hu e908774b5b doc updates 2023-01-31 13:23:25 -05:00
Ivan CheungGitHubivanmkc@google.com <ivanmkc@google.com>
60e4416a7e cleanup: remove 3 deprecated notebooks (#1497)
Co-authored-by: ivanmkc@google.com <ivanmkc@google.com>
2023-01-31 00:07:38 -08:00
gericdongandGitHub b207b270b4 feat: enable TensorBoard profiler for custom training with prebuilt container (#1494)
* feat: enable TensorBoard profiler for custom training with prebuilt container

* Fixed package install error

* addressed review comments
2023-01-30 09:31:51 -08:00
Andrew FerlitschandGitHub 497e93aba1 fix: issue 263246858 (#1496) 2023-01-30 12:30:04 -05:00
Ivan CheungGitHubivanmkc@google.com <ivanmkc@google.com>
9a6c36d016 Fixed cleanup code for matching engine index endpoint (#1493)
Co-authored-by: ivanmkc@google.com <ivanmkc@google.com>
2023-01-30 09:52:32 -05:00
Renovate Bot c889a57c9e chore(deps): update dependency isort to v5.12.0 2023-01-28 18:21:42 +00:00
Michael Hu dbe5d61929 Reduce cost of running prophet notebook 2023-01-27 20:18:33 -05:00
Andrew FerlitschandGitHub c180408f41 feat: model monitoring (#1488)
* fix: review

* fix: testing
2023-01-26 00:26:53 -08:00
gericdongandGitHub 869b19d342 Add new notebook to support the XAI zero metadata config feature (#1484)
* feat: add new notebook to support the XAI zero metadata config feature

* add missing packages

* Attempt to fix issue of -- user install not performed in the env

* Fixed package issues

* Addressed review comments

* Addressed review comments

* Addressed review comments
2023-01-25 10:02:50 -05:00
Michael HuandGitHub 3d967b180d add prophet on vertex pipelines notebook (#1320)
* add prophet on vertex pipelines notebook

* update notebook

* add explicit bq dependency

* add more explanations for what the pipeline is doing

* oops

* oops

* Update overview and add parameter descriptions

* foo

* foo

* add more parameters and types

* remove future tense and fix links

* fix formatting

* fix docs
2023-01-24 22:41:19 -08:00
halio-gandGitHub 49710a9225 Improve the training code to support the non-distributed job and add … (#1489)
* Improve the training code to support the non-distributed job and add the dashboard access.

* format the notebook.

* Use the 8888 instead of getting the env since DASHBOARD_PORT is not populated in the pipeline.

* Resolved the pull request comments.
2023-01-24 15:59:02 -08:00
Andrew FerlitschandGitHub 9d31463585 fix: TW updates (#1492) 2023-01-24 18:58:40 -05:00
ivanmkc@google.com bcd86a3707 Fixed typo for index display name 2023-01-25 08:56:59 +09:00
Mend RenovateandGitHub 9335ea3591 chore(deps): update dependency flake8 to v6 (#1298) 2023-01-24 11:31:29 -08:00
Andrew FerlitschandGitHub 0f7343feee migration: experiments (#1487)
* migration: experiments

* fix: review
2023-01-24 12:27:19 -05:00
Ivan NardiniandGitHub 12cd965ce6 new demand forecasting pipeline notebook (#1439)
* new demand forecasting pipeline notebook

* linter passed

* review notebook

* linter passed

* review notebook

* linter passed

* andy review

* linter passed
2023-01-24 08:44:14 -08:00
ivanmkc@google.com 4e5c75fed6 Renamed json to jsonl 2023-01-24 21:08:08 +09:00
Ivan Cheung b28f941abe Fixed typo 2023-01-24 21:02:46 +09:00
32632711ff Add co-hosting model notebook (#713)
* Add notebook for co-hosting model

* Add notebook for co-hosting model

* Change co-hosting model notebook inline link to officical

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Eric Schmidt <em.schmidt78@gmail.com>
2023-01-23 10:29:13 -08:00
junkourataandGitHub d676d87cce feat: Add E2E notebook featuring Vertex Feature Store, Training and Prediction (#1398)
* Add E2E tutorial for Feature Store

* Add Codeowner and fix the formatting and lining.

* Fixed lint
2023-01-23 10:24:51 -08:00
Douglass ChenandGitHub 153a8044b8 Update Colab notebooks' default fields and URLs (#1485)
* Add Cloud natural language pipeline colab notebook

* Add ready-to-go text classification pipeline colab notebook

* Ran reformatting scripts on text classification pipeline colab notebooks

* Update CODEOWNERS files

* Fix order of cells in cloud_natural_language_pipeline.ipynb

* Remove unused variables via linter for text classification colabs; fix classification variable for preprocessing component

* Minor fix: remove GCPC version requirement

* Minor fix: remove outputs

* fix formatting with nbfmt

* move ready-to-go pipeline to notebooks/community

* fix link

* update CODEOWNERS

* move text classification colabs to notebooks/community/pipelines

* Address initial comments on NL notebook

* Remove commented lines in NL notebook

* minor cell formatting

* clear outputs

* minor changes to NL notebook

* address comments for ready-to-go pipeline

* run linter locally

* add pipeline description to NL pipeline

* run linter locally (PR check could not lint)

* Add cell to examine metrics, update kernel restart cell from official template

* lint

* Update default fields and URLs in NL notebook

* Fix URLs in ready to go notebook

* run linter
2023-01-23 10:00:25 -08:00
Andrew FerlitschandGitHub c0d9250416 migration: labeling (#1479) 2023-01-23 08:58:28 -08:00
fd16e39f91 Added notebook demonstrating hyperparameter tuning using tensorboard (#1451)
* Added notebook demonstrating hyperparameter tuning using tensorboard

* Added notebook demonstrating hyperparameter tuning using tensorboard - linter finished

* Added notebook demonstrating hyperparameter tuning using tensorboard - first round of comments resolved

* Added notebook demonstrating hyperparameter tuning using tensorboard - fixing uncomment error

* fixing comment and lint error

* Jack's comments resolved

* fixing the cell that caused CI/CDtest error

* attempt to fix CI/CD issue with loading tensorboard

* attempt to fix TF import error

* fix CI/CD issues

* fix CI/CD issue

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
2023-01-19 18:13:02 -08:00
Andrew FerlitschandGitHub 1551ca9435 migration: experiments (#1472)
* migration: experiments

* migration: experiments

* debug: experiments
2023-01-19 12:03:28 -08:00
Andrew FerlitschandGitHub 80fcd2904f migration: bqml (#1475)
* fix: require code review

* migration: BQML
2023-01-18 07:26:53 -08:00
Daniel Elias BecerraandGitHub e974c034ba Matching engine tutorial - add networking troubleshooting and updates to notebook (#1465)
* matching engine tutorial add networking troubleshooting

* format check changes

* Change year 2021 to 2023, replace colab, github and workbench links with new template style

* Replace all occurences of ANN and ANN service with matching_engine or Vertex AI Matching Engine to reflect updated product name

* Update Before you Begin section to follow notebook template and add more organization to it

* Update installation of Vertex AI SDK python library from preview to GA version

* Remove outdated set project id section

* Add Authentication section from notebook template

* Update create bucket section to incorporate notebook template guidelines

* Fix format issues

* Fix format issues

* Fix issues when trying the notebook changes, ordered sections and updated some outdated commands

* Add troubleshooting comment for service networking role for worbench instance to create vpc peering

* Add troubleshooting comment for service networking role for worbench instance to create vpc peering

* Revert "Add troubleshooting comment for service networking role for worbench instance to create vpc peering"

This reverts commit ed418a392a.

* Add wait to deploying index

* Add wait to deploying index

* remove redundant import

* Format file
2023-01-17 09:03:18 -08:00
btrinh69 f0112cfc9a fix variables naming 2023-01-14 07:14:56 +00:00
Aleksey VlasenkoandGitHub d2d4493397 fixed T5x sample links (#1473) 2023-01-13 17:58:33 -08:00
btrinh69 33e7d18502 add passthrough case 2023-01-14 00:15:12 +00:00
dependabot[bot]andGitHub 6628866130 Build(deps): Bump torch
Bumps [torch](https://github.com/pytorch/pytorch) from 1.8.1 to 1.13.1.
- [Release notes](https://github.com/pytorch/pytorch/releases)
- [Changelog](https://github.com/pytorch/pytorch/blob/master/RELEASE.md)
- [Commits](https://github.com/pytorch/pytorch/compare/v1.8.1...v1.13.1)

---
updated-dependencies:
- dependency-name: torch
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>
2023-01-13 17:52:59 +00:00
Andrew FerlitschandGitHub 0cd6146a6c fix: restore requirements.txt (#1468) 2023-01-13 09:52:24 -08:00
Andrew FerlitschandGitHub b61395f465 migration: distributed training (#1466)
* migration: distributed training

* migrate: code review
2023-01-13 09:50:43 -08:00
Andrew FerlitschandGitHub 649b209577 upgrade: revised index (#1463)
* upgrade: revised index

* upgrade: revised index

* upgrade: revised index
2023-01-12 16:29:20 -08:00
btrinh69 506a6e66d7 format file 2023-01-13 00:18:59 +00:00
btrinh69 5bd6cfe6a7 remove redundant code 2023-01-13 00:16:15 +00:00
btrinh69 ca27881ca7 Merge branch 'prediction-featurestore-integration' of https://github.com/btrinh69/vertex-ai-samples into prediction-featurestore-integration 2023-01-13 00:13:44 +00:00
btrinh69 5fa0ed6185 remove redundant code 2023-01-13 00:12:38 +00:00
btrinh69 14f58e30c5 remove redundant code 2023-01-13 00:11:14 +00:00
btrinh69andGitHub 6af94b51aa Merge branch 'main' into prediction-featurestore-integration 2023-01-13 00:07:35 +00:00
btrinh69 2f818117db add prediction_featurestore_integration to the CODEOWNER file and format the notebook 2023-01-13 00:06:23 +00:00
btrinh69 04fe89c556 Ingest Feature Store data from an exported CSV instead of querying data
from BigQuery and address comments in the previous commit

This commit does:
- Shorten the Feature Store creation process by using an exported CSV to
  populate FS instead of querying from BigQuery
- Add the Feature fetch config proto to the description
- Grant the service account `Storage Admin` and `Vertex Ai Feature Store
  Data Viewer` role instead of `Vertex AI Service Agent`
- Address nit comments in the previous commit
2023-01-12 23:47:27 +00:00
Andrew FerlitschandGitHub f42a184171 migration: automl (#1455) 2023-01-12 09:29:25 -08:00
Andrew FerlitschandGitHub 03f0647b76 migration: MM notebook (#1445)
* migration: MM notebook

* migration: fix USER_EMAIL
2023-01-12 09:28:43 -08:00
Andrew FerlitschandGitHub 1f39732ae9 migration: distributed training (#1460) 2023-01-11 22:38:26 -08:00
Andrew FerlitschandGitHub 7dd0b31b58 migration: experiments (#1461) 2023-01-11 18:16:34 -08:00
Andrew FerlitschandGitHub ff843173cf Autoindex official 2 (#1459)
* fix: update linkbacks to vertex pages

* fix: update linkbacks to vertex pages

* fix: update linkbacks to vertex pages
2023-01-11 16:53:28 -08:00
Andrew FerlitschandGitHub da19b116e9 fix: update linkbacks to vertex pages (#1458) 2023-01-11 16:30:10 -08:00
Andrew FerlitschandGitHub d8b365dfd4 fix: update the linkback (#1457) 2023-01-11 15:02:14 -08:00
Andrew FerlitschandGitHub 1247c80fed migration: bqml (#1456) 2023-01-11 14:53:13 -08:00
2cf2bf1080 Adding sample T5x sample for optimized TensorFlow runtime (#1453)
* adding T5x sample

* update for benchmark params

* update for benchmark params

* updated model GCS buckets for optimized TF runtime T5x sample

* added GPU accelerators for deployment pool in Vertex shared VM sample

* final updates for T5x sample

* addressed PR feedback

Co-authored-by: Aleksey Vlasenko <alekseyv@google.com>
2023-01-11 13:32:53 -08:00
Andrew FerlitschandGitHub 5e9e8139c1 Update get_started_with_model_monitoring_xgboost.ipynb 2023-01-11 12:10:46 -08:00
Andrew FerlitschandGitHub 0728a0036f Update get_started_with_model_monitoring_setup.ipynb 2023-01-11 12:10:11 -08:00
Andrew FerlitschandGitHub aa52d21643 Update get_started_with_model_monitoring_custom_tf_serving.ipynb 2023-01-11 12:09:18 -08:00
Andrew FerlitschandGitHub 103888d75e Update get_started_with_model_monitoring_custom.ipynb 2023-01-11 12:08:33 -08:00
Andrew FerlitschandGitHub 13d0d5d9b0 Update get_started_bq_datasets.ipynb 2023-01-11 12:06:47 -08:00
Andrew FerlitschandGitHub 79c6669686 Update get_started_with_data_labeling.ipynb 2023-01-11 12:06:20 -08:00
Andrew FerlitschandGitHub dceb0c4c1c Update get_started_bq_datasets.ipynb 2023-01-11 12:04:31 -08:00
Andrew FerlitschandGitHub 0c9cdca713 migration: MM notebook (#1449)
* migration: MM notebook

* migration: MM notebook
2023-01-10 20:58:19 -08:00
Andrew FerlitschandGitHub 6124092681 migration: MM notebook (#1447)
* migration: MM notebook

* migration: MM notebook
2023-01-10 18:39:45 -08:00
Andrew FerlitschandGitHub 629e739327 migration: MM notebook (#1446)
* migration: MM notebook

* migration: MM notebook
2023-01-10 17:51:00 -08:00
Andrew FerlitschandGitHub b68cbd8255 migration: move to pipelines folder (#1452) 2023-01-10 16:44:17 -08:00
Andrew FerlitschandGitHub 7fec30c12f migration: MM notebook (#1448) 2023-01-10 16:31:14 -08:00
Andrew FerlitschandGitHub a754843c39 migration: MM notebook (#1444)
* migration: MM notebook

* migration: MM notebook

* migration: MM notebook
2023-01-10 15:33:26 -08:00
436db4a35b Fixed documentation links (#1450)
Co-authored-by: Max Reznitskii <reznitskii@google.com>
2023-01-10 15:22:58 -08:00
Ivan NardiniandGitHub 8dba2d040b anomaly detection notebook review (#1440)
* fix some minor issues

* linter passed
2023-01-10 11:50:28 -08:00
Kelsi LakeyandGitHub 560dd9da15 [Community] Added image classification pipeline sample for Ready-to-Go Vertex project (#1404)
* Add image classification pipeline components

* Update CODEOWNERS file with image_ml_model_training

* [Community] Added image classification pipeline sample for Ready-to-Go Vertex project

* Remove unnecessary component download
2023-01-10 11:47:53 -08:00
Nicolas WipfliandGitHub 8ec17d6aca Workaround for shapely (#1397)
Without this workaround, the command "from google.cloud import aiplatform as vertex_ai" fails due to the following issue:

https://github.com/googleapis/python-aiplatform/issues/1852
2023-01-10 11:46:32 -08:00
f545282c36 Cohere demo (#1391)
* Adding Cohere Embedding Demo

* Update cohere_embedding_with_matching_engine.ipynb

* Update cohere_embedding_with_matching_engine.ipynb

* Update CODEOWNERS

* Update CODEOWNERS

* Update CODEOWNERS

* Update cohere_embedding_with_matching_engine.ipynb

* Update cohere_embedding_with_matching_engine.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2023-01-10 11:43:16 -08:00
7e4e14e084 Fixed links to documentation (#1438)
Co-authored-by: Max Reznitskii <reznitskii@google.com>
2023-01-09 15:32:56 -08:00
Douglass ChenandGitHub be5933115d Add Colab notebooks to run text classification model pipelines (#1360)
* Add Cloud natural language pipeline colab notebook

* Add ready-to-go text classification pipeline colab notebook

* Ran reformatting scripts on text classification pipeline colab notebooks

* Update CODEOWNERS files

* Fix order of cells in cloud_natural_language_pipeline.ipynb

* Remove unused variables via linter for text classification colabs; fix classification variable for preprocessing component

* Minor fix: remove GCPC version requirement

* Minor fix: remove outputs

* fix formatting with nbfmt

* move ready-to-go pipeline to notebooks/community

* fix link

* update CODEOWNERS

* move text classification colabs to notebooks/community/pipelines

* Address initial comments on NL notebook

* Remove commented lines in NL notebook

* minor cell formatting

* clear outputs

* minor changes to NL notebook

* address comments for ready-to-go pipeline

* run linter locally

* add pipeline description to NL pipeline

* run linter locally (PR check could not lint)

* Add cell to examine metrics, update kernel restart cell from official template

* lint
2023-01-09 13:12:19 -08:00
reznitskiiandGitHub be46140138 Update README.md (#1433) 2023-01-09 08:59:47 -08:00
Andrew FerlitschandGitHub 79f4dbaafe Autoindex official 2 (#1432)
* fix: alpha sort

* fix: alpha sort

* fix: alpha sort
2023-01-08 12:22:32 -08:00
Andrew FerlitschandGitHub 9577f8324c Autoindex official 2 (#1431)
* fix: alpha sort

* fix: alpha sort
2023-01-08 12:17:06 -08:00
Andrew FerlitschandGitHub 01274fe767 fix: alpha sort (#1430) 2023-01-08 12:13:44 -08:00
Andrew FerlitschandGitHub 1690b07e4a Autoindex official (#1429)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* fix: notebook objective

* fix: notebook objective

* fix: alpha sort
2023-01-08 12:04:41 -08:00
Andrew FerlitschandGitHub 6b0de60a5c Autoindex official (#1428)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* fix: notebook objective

* fix: notebook objective
2023-01-07 12:53:35 -08:00
Andrew FerlitschandGitHub 19b541b6cb Autoindex official (#1427)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* fix: notebook objective
2023-01-07 12:47:03 -08:00
Andrew FerlitschandGitHub 22f6841079 Autoindex official (#1426)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-07 12:07:01 -08:00
Andrew FerlitschandGitHub 7c47c95e3a Autoindex official (#1425)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-07 11:52:42 -08:00
Andrew FerlitschandGitHub 7735e6ae69 Autoindex official (#1424)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-07 11:48:07 -08:00
Andrew FerlitschandGitHub 247a540625 Autoindex official (#1423)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-07 11:38:03 -08:00
Andrew FerlitschandGitHub f017606f77 Autoindex official (#1422)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-06 18:38:17 -08:00
Andrew FerlitschandGitHub 1d7024341a Autoindex official (#1421)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-06 18:33:56 -08:00
Andrew FerlitschandGitHub 9181dba316 Autoindex official (#1420)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index

* tuning: README index

* tuning: README index
2023-01-06 18:25:13 -08:00
Andrew FerlitschandGitHub a8320f3943 Autoindex official (#1419)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index

* tuning: README index
2023-01-06 18:19:45 -08:00
Andrew FerlitschandGitHub 6fc34ae4f1 Autoindex official (#1418)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index

* tuning: README index
2023-01-06 18:13:06 -08:00
Andrew FerlitschandGitHub 5566346fdc Autoindex official (#1417)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning

* tuning: linkbak for repo index
2023-01-06 17:55:33 -08:00
Andrew FerlitschandGitHub e584acdb48 Autoindex official (#1416)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: index tuning
2023-01-06 15:49:03 -08:00
Andrew FerlitschandGitHub 4022811d3c Autoindex official (#1415)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing
2023-01-06 13:09:11 -08:00
Andrew FerlitschandGitHub 4d29c490f8 Autoindex official (#1414)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing
2023-01-06 12:59:38 -08:00
Andrew FerlitschandGitHub 2315942901 Autoindex official (#1413)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing
2023-01-06 12:22:20 -08:00
Andrew FerlitschandGitHub 505d5049e0 Autoindex official (#1412)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index

* fix: fine tune indexing

* fix: fine tune indexing

* fix: fine tune indexing
2023-01-06 12:18:03 -08:00
Andrew FerlitschandGitHub 20411db737 Delete get_started_bq_datasets.ipynb
duplication
2023-01-06 12:15:56 -08:00
Andrew FerlitschandGitHub 39dbbde22c Autoindex official (#1410)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements

* fix: tuning index

* fix: tuning index
2023-01-06 11:53:14 -08:00
Andrew FerlitschandGitHub 34251594a4 Autoindex official (#1409)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* feat: CL var replacements
2023-01-06 10:57:19 -08:00
7342673331 Add experiments to Dataproc notebook (#1262)
* Show how to use experiments

* Addressed PR feedback

Co-authored-by: Win Woo <wwoo@google.com>
2023-01-05 12:35:42 -08:00
Andrew FerlitschandGitHub b5d19719e0 Update requirements.txt
The <2.11 syntax does not work, since it is interpreted as I/O redirection on the command line.
2023-01-05 12:23:28 -08:00
59536e9e61 Fix google-api-core version to last known working version (#1402)
Co-authored-by: Ivan Cheung <ivanmkc@google.com>
2023-01-05 10:30:48 -08:00
Andrew FerlitschandGitHub 7d74bc3caa workaround: 900 timeout issue (#1400) 2023-01-03 14:56:59 -08:00
wintwooandGitHub f681879a8a Merge branch 'GoogleCloudPlatform:main' into dataproc 2022-12-28 11:23:34 +11:00
Andrew FerlitschandGitHub b5b65198a6 Mlops migrate 2 (#1394)
* migrate

* migrate

* migrate

* migrate
2022-12-22 16:13:51 -08:00
Andrew FerlitschandGitHub 3a5a14f1d8 migrate (#1392)
* migrate

* migrate
2022-12-22 14:18:53 -08:00
Kelsi LakeyandGitHub 157f8538ed [Community] Added image classification pipeline components from the Ready-to-Go Vertex project (#1379)
* Add image classification pipeline components

* Update CODEOWNERS file with image_ml_model_training
2022-12-22 11:02:57 -08:00
Alexey VolkovandGitHub 532bf04933 Fixed the version of the Scikit-learn component (#1356) 2022-12-22 11:00:35 -08:00
gericdongandGitHub 99547ccb73 fix: updated TensorBoard profiler notebooks (#1387)
* fix: set profiler mininum version

* linter fix
2022-12-21 15:56:02 -08:00
Andrew FerlitschandGitHub 2e0cd74533 Autoindex official (#1389)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 14:21:28 -08:00
Andrew FerlitschandGitHub b9a9d76e8b Autoindex official (#1388)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 14:05:32 -08:00
Andrew FerlitschandGitHub fb61e0631c Autoindex official (#1386)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 13:14:59 -08:00
Andrew FerlitschandGitHub 16c38c8fbf Autoindex official (#1385)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 12:53:24 -08:00
Andrew FerlitschandGitHub 8888e8ad7f Autoindex official (#1384)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 12:24:46 -08:00
Andrew FerlitschandGitHub c787a0e99e Autoindex official (#1383)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 12:09:13 -08:00
Phuong NguyenandGitHub 8ea77a7cb0 Update Tabular Workflows notebooks with Feature Transform Engine's new features (#1378)
* Update Tabular Workflows notebooks with Feature Transform Engine's new features from GCPC 1.0.31 release

* Fix linter errors

* Fix inline comment spacing

* Run tensorflow_docs's nbfmt

* Address comments.
2022-12-21 11:15:38 -08:00
Andrew FerlitschandGitHub 2bb6d6deb2 Autoindex official (#1382)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 11:03:43 -08:00
Andrew FerlitschandGitHub 7b235c935a Autoindex official (#1381)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 10:29:39 -08:00
Andrew FerlitschandGitHub 3c88e9284c Autoindex official (#1380)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-21 09:54:25 -08:00
Andrew FerlitschandGitHub e967b02a22 Autoindex official (#1377)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag

* upgrade: fine-tune layout for webdoc

* upgrade: fine-tuning tags and linkbacks

* upgrade: fine-tuning tags and linkbacks
2022-12-20 20:35:07 -08:00
Andrew FerlitschandGitHub aeb87cbc44 Autoindex official (#1376)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag

* upgrade: autogen index, folder to tag
2022-12-20 11:29:16 -08:00
Andrew FerlitschandGitHub 1f39a8f892 Autoindex official (#1375)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index

* upgrade: autoindex, map dirnames to tags

* upgrade: autogen index, folder to tag
2022-12-20 09:41:33 -08:00
Andrew FerlitschandGitHub d2a6508379 Autoindex official (#1373)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index

* upgrade: prep work of web index
2022-12-19 18:05:27 -08:00
Andrew FerlitschandGitHub 39d1646b3c Autoindex official (#1372)
* upgrade: prep for auto docs index

* upgrade: prep for auto docs index
2022-12-19 17:24:06 -08:00
junkourataandGitHub 4c5ede0130 Update sdk-feature-store.ipynb to add streaming ingestion (#954)
* fest: update the feature store notebook to include streaming ingestion

export VM="junkourata.c.googlers.com"

* fest: more fixing

* Add only streaming ingestion and remove any change in other sections

* Add streaming ingestion section to the notebook

* Remove changes in other sections and leave only streaming ingestion

* Add a new line at the end of the file

* Fix the syntax issue

* Applied all the suggestions by our tech writer.

* Fix the json formatting

* Fix the markdown

* Add additional fixes

* Add additional fix

* Fix formatting
2022-12-19 15:22:27 -08:00
btrinh69 7715f79807 format prediction_featurestore_integration.ipynb. 2022-12-19 23:21:59 +00:00
Soheila ZangenehandGitHub 7c8eeeb1d1 Fix: Hardcode gcpc versionand small fixes in model eval automl video classification notebook (#1270)
* Hardcode gcpc version and rename variable

* Remove hardcoded value in the pipeline

* Fix parameter explanation text

* Run linter

* Fix class labels variable
2022-12-19 15:18:20 -08:00
btrinh69 6caffbe5c3 add an E2E notebook for Prediction and Featurestore integration 2022-12-19 22:52:30 +00:00
Soheila ZangenehandGitHub 99929ca018 Minor text and code edits in model eval custom regression notebook (#1271)
* Hardcode gcpc version

* Fix variable names and text explanations

* Run linter
2022-12-19 13:51:44 -05:00
Soheila ZangenehandGitHub 6aadabd967 Fix: Hardcode gcpc version in model eval custom classification notebook (#1272)
* Update gcpc version and rename variable

* Run linter

* Fix dataset exists error
2022-12-19 13:35:47 -05:00
9b5be742c1 Fixed timeout value (#1370)
Co-authored-by: Ivan Cheung <ivanmkc@google.com>
2022-12-19 11:41:02 -05:00
Andrew FerlitschandGitHub 63d5b5e3bf debug: force use of newest cloud-build (#1369) 2022-12-19 11:07:22 -05:00
Axel PerezandGitHub 1448645ba4 Updating PyTorch Torchrun notebook in community folder (#1366)
* updating custom container with PyTorch v1.13

* moved etcd install to custom container build
2022-12-17 09:46:40 -08:00
Andrew FerlitschandGitHub 3d19ffb131 fix: timeout issue for notebook test (#1365) 2022-12-16 18:27:09 -08:00
Xiang XuandGitHub b6018551a5 add fsdp training (#1317) 2022-12-16 09:53:26 -08:00
Phuong NguyenandGitHub 65fbf0ee0b Use sample dataset from regional bucket (#1355)
* Use sample dataset from regional bucket

* retrigger checks
2022-12-16 09:48:05 -08:00
Andrew FerlitschandGitHub 427bd3d5ea upgrade: replace CURL with GAPIC (#1357) 2022-12-15 11:47:33 -08:00
Andrew FerlitschandGitHub 5f41599745 Autoindex 1 (#1354)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective
2022-12-14 14:11:12 -08:00
Andrew FerlitschandGitHub 67fbd84832 Autoindex 1 (#1353)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective
2022-12-14 12:53:09 -08:00
Andrew FerlitschandGitHub 9b427b6a1f Autoindex 1 (#1352)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective
2022-12-14 12:45:39 -08:00
Andrew FerlitschandGitHub 37d5d5b992 Autoindex 1 (#1351)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective
2022-12-14 11:26:16 -08:00
Andrew FerlitschandGitHub 287911b681 Autoindex 1 (#1350)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective
2022-12-14 11:20:14 -08:00
Andrew FerlitschandGitHub c83387181a Autoindex 1 (#1349)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective

* fix: branding and objective

* fix: branding and objective
2022-12-14 11:13:18 -08:00
Andrew FerlitschandGitHub 236d45b87e Autoindex 1 (#1348)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder

* fix: branding and objective
2022-12-14 10:50:01 -08:00
Soheila ZangenehandGitHub 4eb7b3ce39 Feature Store ingestion streaming notebook (#1321)
* Add featurestore ingestion streaming nb

* Add notebook to CODEOWNERS

* Run linter

* Add pyarrow installation

* Run linter

* Resolve PR comments

* Run linter
2022-12-14 10:47:46 -08:00
Rajesh ThallamandGitHub d74554f641 Torchrun notebook (#1344)
* PyTorch efficient training - refcator code

* Revert "PyTorch efficient training - refcator code"

This reverts commit 90b563a7697b15b4154ac76236b894253dd58f3c.

* Refactor torchrun notebook

* Refactor torchrun notebook

* Refactor torchrun notebook

* Torchrun notebook - Linting fixes

* Torchrun notebook - Linting fixes
2022-12-13 10:23:58 -08:00
Andrew FerlitschandGitHub 3e70c63899 Autoindex 1 (#1343)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance

* fix: autogen README index for workbench folder
2022-12-13 09:44:58 -08:00
Andrew FerlitschandGitHub 4c79ab91e2 Autoindex 1 (#1342)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder

* fix: template conformance
2022-12-13 09:24:15 -08:00
Andrew FerlitschandGitHub dd8a7ad325 Autoindex 1 (#1341)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes

* fix: bad links in workbench folder
2022-12-13 09:12:30 -08:00
Andrew FerlitschandGitHub a3bb273e78 Autoindex 1 (#1340)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes

* fix: update official indexes
2022-12-12 19:04:27 -08:00
Andrew FerlitschandGitHub 1ff0872546 Autoindex 1 (#1339)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official

* fix: update indexes
2022-12-12 18:56:26 -08:00
Andrew FerlitschandGitHub 91144b8476 Autoindex 1 (#1338)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices

* fix: update autogen index in official
2022-12-12 18:40:26 -08:00
Andrew FerlitschandGitHub 9822bd64a1 Autoindex 1 (#1337)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices

* fix: update official indices
2022-12-12 16:47:05 -08:00
Andrew FerlitschandGitHub f14ff50d2b Autoindex 1 (#1336)
* feat: autogen index

* feat: autogen index

* feat: autogen index

* feat: update indices
2022-12-12 16:27:49 -08:00
Andrew FerlitschandGitHub fdc30dab67 Autoindex 1 (#1335)
* feat: autogen index

* feat: autogen index

* feat: autogen index
2022-12-12 16:12:05 -08:00
Andrew FerlitschandGitHub 93229f62c9 fix: next round of restructuring. (#1163)
* fix: working on abstract class

* fix: working on abstract class

* fix: restructuring

* fix: changes per TW needs

* fix: request changes

* fix: before you begin

* feat: task: making cell navigation independent of rules

* fix: review comments

* fix: review comments

* fix: review comments

* fix: review comments

* feat: writeback fixed notebook

* fix: target=_blank detection

* fix: autofixing bad link
2022-12-12 14:55:10 -08:00
Peter PingandGitHub b37f474255 Update stream_update_for_matching_engine.ipynb (#1324)
* Update stream_update_for_matching_engine.ipynb

change "allow_list" to "allow" for index creation as allow_list is not supported but allow is supported for index creation.

* Update stream_update_for_matching_engine.ipynb

Updated to resolve the comments.

* Updated Google Cloud Notebooks to Workbench AI Notebooks
2022-12-12 09:29:38 -08:00
Ivan NardiniandGitHub 344b0dd6d7 update vertex_ai_model_registry_bqml_custom_model_versioning.ipynb (#1331)
* fix dataproc version issue

* linter test passed
2022-12-12 09:12:35 -08:00
Andrew FerlitschandGitHub 48b7cdb21d Ci admin howto 2 (#1333)
* feat: howto admin

* fix: review comments
2022-12-12 08:40:45 -08:00
Andrew FerlitschandGitHub cefdc32d5f feat: howto admin (#1330) 2022-12-09 14:52:36 -08:00
Andrew FerlitschandGitHub 7558411fbc feat: migrate batch model monitoring notebook to official (#1322)
* feat: migrate notebook to official

* fix: set links to official

* fix package issue when testing

* Update batch_prediction_model_monitoring.ipynb

* Update batch_prediction_model_monitoring.ipynb

* Update batch_prediction_model_monitoring.ipynb

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: install/import issues

* fix: dependencies

* fix: missing import
2022-12-09 14:38:33 -08:00
Renovate Bot e01174f169 chore(deps): update dependency black to v22.12.0 2022-12-09 16:42:13 +00:00
Andrew FerlitschandGitHub 1c0487c459 fix: rm line about load mean/stddev (#1327) 2022-12-08 15:04:56 -08:00
Win Woo 62c903f47d Addressed PR feedback 2022-12-08 03:01:56 +00:00
Edgar BermudezandGitHub 6b7bb867ab Fixed links to notebooks (#1302)
* Update README.md

* Fixed links to notebooks

* Fixed links to notebooks
2022-12-07 16:58:42 -08:00
Alexey VolkovandGitHub 8c7363c2b0 Updated the tabular training pipelines to load the components from the vertex-ai-samples repo (#1326) 2022-12-07 16:54:34 -08:00
Brian KangandGitHub 2ea22da2bf Briankang pytorch torchrun (#1323)
* Adding PyTorch Torchrun example

* Revert 'Adding PyTorch Torchrun example'

This reverts commit 239b9fe3b7

* Adding PyTorch torchrun ImageNet training example

* Updated CODEOWNERS for PyTorch torchrun example

* Ran Linter

* Updated based on review feedback
2022-12-07 09:52:49 -08:00
Soheila ZangenehandGitHub 1d96584421 Notebook to demonstrate feature filtering in BatchPredictionJob (#1309)
* Add feature filter notebook

* Clean code

* Run linter

* Add the notebook to CODEOWNERS

* Remove user flag

* Run linter

* Fix bucket URI

* Run linter

* Simplify the notebook
2022-12-07 09:49:29 -08:00
Ivan NardiniandGitHub 06d57da90c inardini -- anomaly detection with BigQuery ML and Vertex AI (#1319)
* adding anomalydetection pipeline

* reviewed notebook

* add code owner

* remove to do

* linter test

* reviewed based on feeback from andy

* linter test passed

* fix links

* linter test passed
2022-12-07 09:42:34 -08:00
Alexey VolkovandGitHub 355105218d Added pipeline components used in the "Train_tabular_models_with_many_frameworks_and_import_to_Vertex_AI_using_Pipelines" samples (#1294)
* Added pipeline components used in the "Train_tabular_models_with_many_frameworks_and_import_to_Vertex_AI_using_Pipelines" samples.

* Removed Pandas type conversion

* Removed Pandas type conversion
2022-12-06 16:42:06 -08:00
Alexey Volkov da77846b88 fix: Fixed the Scikit-learn components 2022-12-06 15:42:27 -08:00
Andrew FerlitschandGitHub 3090a312c0 fix: autofix bad links (#1318)
* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links

* fix: autofix bad links
2022-12-06 14:17:41 -08:00
8c265ee1ef Added matching engine resource managers (#1314)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-12-01 13:41:23 -08:00
fdbfecda04 Updates notebooks/official/model_evaluation/custom_tabular_regression_model_evaluation.ipynb (#1264)
* remove key_columns variable

* ran linter

* remove key_columns in text

* notebooks/official/model_evaluation/custom_tabular_regression_model_evaluation.ipynb

* modified text

* ran linter

* andrew comments resolved

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-12-01 09:30:42 -08:00
7050730b6a sdk_automl_tabular_regression_online_bq (#1246)
* bioler plate changes

* linter test

* made review changes

* linter test

* bioler plate changes

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-12-01 05:04:26 -08:00
Ivan CheungandGitHub 4ec962d277 custom-tabular-bq-managed-dataset.ipynb: Addressed comments regarding evaluation, normalization and dataset creation (#1313)
* Address comments

* Added back BQ dataset creation
2022-11-30 16:09:39 -05:00
Ivan CheungandGitHub 3185ca7d48 Hierarchical forecasting notebook (#664)
This is a hierarchical forecasting notebook demonstrating the use of the new hierarchical forecasting parameters for AutoML Forecasting.

If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [x] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [x] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [x] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [x] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [x] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
2022-11-30 20:02:13 +00:00
Chun-Hsiang Wang 7c123e68d3 samples: Remove experimental text from Pytorch sample. 2022-11-30 07:46:08 +00:00
sudarshan-SpringMLandGitHub 32ac97982c Updates sdk_automl_video_action_recognition_batch.ipynb (#1233)
File came in regression log. Unable to download executed notebook. When ran in local, file executed successfully.
**Changes made**:

Update notebook according to template

- [X] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [X] Follow the style and grammar rules outlined in the above notebook template.
- [X] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [X] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [X] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [X] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>
2022-11-30 00:04:13 +00:00
uday kumarandGitHub 1aa94377f5 automl-text-classification (#1244)
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.

<br>
Changed according to boilerplate requirement.
<br><br><br>

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [X] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [X] Follow the style and grammar rules outlined in the above notebook template.
- [X] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [X] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [X] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [X] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
2022-11-29 06:20:13 +00:00
sarahcduganandGitHub 7271fde2d7 Adding a link to documentation (#1305)
Currently the notebook references docs but doesn't link to them.

**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.

<br>
--- YOUR PR SUMMARY GOES HERE ---
<br><br><br>

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>

2. If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).

<br>

3. If you are opening a PR for `Community Content` under the [community-content](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
2022-11-28 23:24:13 +00:00
Ivan CheungandGitHub 71431d5520 pipelines_intro_kfp.ipynb: Reduced boilerplate (#1307)
Reduced boilerplate in pipelines_intro_kfp.ipynb
2022-11-28 19:44:13 +00:00
Andrew FerlitschandGitHub 0f58771ecd fix: bad link (#1303) 2022-11-27 10:16:58 -05:00
05c5b68db1 pytorch efficient training (#1257)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-26 16:48:11 -08:00
ee2744a7de Updates file google_cloud_pipeline_components_automl_images.ipynb (#1238)
* modified notebook

* ran linter

* ivan comments addressed

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-26 16:38:29 -08:00
a32db129ea Update notebook to use v1 components (#1260)
Co-authored-by: Win Woo <wwoo@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-25 22:21:18 -08:00
c9aff9a5d9 training-multi-class-classification-model-for-ads-targeting-usecase (#1161)
* Made changes in accordance with notebook template

* Ran Linter test

* Changed protobuf version

* Ran linter test

* made sklearn to scikit learn

* ran linter

* andrew comments addressed

* ran linter

* ivan comments addressed

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: sudarshan-SpringML <82567512+sudarshan-SpringML@users.noreply.github.com>
Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
2022-11-25 21:35:40 -08:00
bhupana @ springmlGitHubIvan Cheunggcf-merge-on-green[bot] <60162190+gcf-merge-on-green[bot]@users.noreply.github.com>Andrew Ferlitsch
7324b084ee Made minor changes to Google cloud pipeline components automl tabular notebook (#1253)
* made some minor changes

* Ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: gcf-merge-on-green[bot] <60162190+gcf-merge-on-green[bot]@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-25 21:08:27 -08:00
095b0bd628 sdk_matching_engine_for_indexing.ipynb: Adds filtering example to matching engine notebook. (#1249)
* Added matching engine filtering notebook

* Added filter

* Fixed typos in other notebooks and linted

* Fixed lint issues

* Added PROJECT_NUMBER retrieval

* Removed unneeded RANDOM_ID

* Linted

* Reverted changes

* Fixed review comments

Co-authored-by: gericdong <itseric@google.com>
2022-11-25 18:04:08 -08:00
Ivan CheungandGitHub 7a1b262154 Regression notebook: Remove unneeded cells (#1297)
Removed unneeded cells.
2022-11-23 21:38:13 +00:00
gericdongandGitHub ad1a827824 feat: Reorganize all TensorBoard notebooks together under directory 'tensorboard" (#1296)
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.

<br>
This is the first step of two to move the TensorBoard profiler to tensorboard directory.
<br><br><br>

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>

2. If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).

<br>

3. If you are opening a PR for `Community Content` under the [community-content](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
2022-11-23 16:48:15 +00:00
Ivan CheungandGitHub 1ff7fc70ed custom-tabular-bq-managed-dataset.ipynb: Remove preprocessing (#1278)
- [x] Removed pre-processing (normalization)

This simplifies the code but reduces accuracy.
2022-11-23 16:16:42 +00:00
Ivan CheungandGitHub b45e17efc0 sdk_automl_tabular_regression_batch_bq.ipynb: Fixed unneeded concatenation (#1265)
- [x] Fixed unneeded concatenation
- [x] Fixed incorrect service account info.
2022-11-23 03:02:15 +00:00
gericdongandGitHub 98ad1655a7 fix: updated TensorBoard profiler notebook 2 (#1284)
* fix: updated TensorBoard profiler notebook 2

* Address linter check errors

* Addressed review comments 2

* Added prints for debug

* Added --quiet for another gcloud command
2022-11-22 19:24:36 -05:00
uday kumarGitHubgcf-merge-on-green[bot] <60162190+gcf-merge-on-green[bot]@users.noreply.github.com>
19d56c0fa0 sdk_automl_image_object_detection_batch (#1240)
* changed according to boiler plate requirements

* ran linter test

* changed according to boilerplate requirements

* linter test

* changed file based on boilerplate requirements

* linter test

* biolerplate requirements

* linter test

* changes based on boilerplate

* linter test

* added os library

* linter test

* textual corrections

* linter test

* biolerplate chnages

* linter test

* bioler plate changes

* linter test

Co-authored-by: gcf-merge-on-green[bot] <60162190+gcf-merge-on-green[bot]@users.noreply.github.com>
2022-11-22 14:44:15 -05:00
Soheila ZangenehandGitHub a3ee3687da Fix: Hardcode gcpc version in model eval automl regression notebook (#1267)
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.

Hardcoded gcpc version because it fails in newer versions. And this is a request from model eval swe team to hardcode the version.

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [x] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [x] Follow the style and grammar rules outlined in the above notebook template.
- [x] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [x] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [x] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [x] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [x] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
2022-11-22 01:44:13 +00:00
Soheila ZangenehandGitHub ff1b9ad8ef Fix: Hardcode gcpc version in model eval automl classification notebook (#1268)
* Hardcode gcpc and use better variable name

* Run linter
2022-11-21 15:33:51 -05:00
sudarshan-SpringMLandGitHub 64b4f5103c Updates notebooks/official/pipelines/google_cloud_pipeline_components_model_train_upload_deploy.ipynb (#1250)
**Error from regression test**:RuntimeError: Job failed with:
code: 9
message: "The DAG failed because some tasks failed. The failed tasks are: [model-deploy].; Job (project_id = python-docs-samples-tests, job_id = 2073372166241386496) is failed due to the above error.; Failed to handle the job: {project_number = 1012616486416, job_id = 2073372166241386496}"

Changes made:
Just ran notebook in local. It ran fine. Updated notebook according to template


- [X] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [X] Follow the style and grammar rules outlined in the above notebook template.
- [X] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [X] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [X] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [X] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>
2022-11-18 20:16:14 +00:00
bhupana @ springmlandGitHub a2e8f933dc Sdk custom image classification batch (#1252)
boilerplate for sdk-custom-image-classification-batch notebook

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [x] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [x] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [x] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [x] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
2022-11-18 18:28:14 +00:00
sudarshan-SpringMLandGitHub 5cb368585c Updates notebooks/official/custom/sdk-custom-image-classification-online.ipynb (#1247)
Reduce boilerplate for sdk-custom-image-classification-online.ipynb notebook

- [X] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [X] Follow the style and grammar rules outlined in the above notebook template.
- [X] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [X] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [X] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [X] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>
2022-11-18 17:24:15 +00:00
uday kumarandGitHub db96de8266 sdk-metric-parameter-tracking-for-custom-jobs (#1242)
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.

<br>

1. Boilerplate changes.
2. Added code for deleting experiment otherwise its throwing experiment name already exist.
<br><br><br>

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [X] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [X] Follow the style and grammar rules outlined in the above notebook template.
- [X] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [X] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [X] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [X] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>
2022-11-18 17:04:13 +00:00
uday kumarandGitHub 18440f5c0c sdk-metric-parameter-tracking-for-locally-trained-models (#1248)
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.

<br>
Boilerplate changes.
<br><br><br>

**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [X] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [X] Follow the style and grammar rules outlined in the above notebook template.
- [X] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [X] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [X] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [X] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.

<br>
2022-11-18 16:34:15 +00:00
Mend RenovateandGitHub 95d44d0cf5 chore(deps): update dependency nbqa to v1.5.3 (#1259) 2022-11-18 10:42:11 -05:00
Win Woo 9f26e8385d Show how to use experiments 2022-11-18 10:02:02 +00:00
Mend RenovateGitHubIvan Cheunggcf-merge-on-green[bot] <60162190+gcf-merge-on-green[bot]@users.noreply.github.com>
fc2e91d050 chore(deps): update dependency nbqa to v1.5.2 (#967)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: gcf-merge-on-green[bot] <60162190+gcf-merge-on-green[bot]@users.noreply.github.com>
2022-11-17 15:47:43 -05:00
Mend RenovateandGitHub b8872c1e03 chore(deps): update dependency black to v22.10.0 (#918) 2022-11-17 15:45:52 -05:00
b21ec83ba3 chore(deps): update dependency pyupgrade to v2.38.4 (#1042)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-11-17 15:41:39 -05:00
Jonathan SimonandGitHub d42cc4fbc9 Update notebooks/official/matching_engine/README.md (#1258)
* Update notebooks/official/matching_engine/README.md

* Update region tag formatting

* Update README.md format for single notebook

* Remove horizontal-rules for single notebook
2022-11-17 12:04:17 -08:00
Kacper KulczakandGitHub 28ceb8085e bugfix: custom region for training (#722)
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [x] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [x] Follow the style and grammar rules outlined in the above notebook template.
- [x] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [x] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [x] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [x] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.


If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).

If you are opening a PR for `Community Content` under the [community-content](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
2022-11-17 19:08:14 +00:00
Juan AcevedoandGitHub a460dcbdd8 f/find_ideal_machine_type_endpoints (#1256)
* initial commit

* add CODEOWNERS
2022-11-16 14:58:01 -08:00
Krishna Chaitanya MovvaandGitHub a76ffe0103 moves the owners line from community file to the official file for SDK_FBProphet_forecasting_online.ipynb notebook (#1254) 2022-11-16 16:06:01 -05:00
168c5c2f15 Add custom tabular classification model evaluation notebook (#1219)
* adds the custom tabular classification evaluation notebook

* removes json import

* ran linter test

* fixes the model serving code and adds image

* ran linter test

* adds notebook to the codeowners file

* addresses the review comments: updates text, adds headings

* ran linter test

* boiler-plate reduction, addresses the review comments, adds a constant for table id

* ran linter test

* updates the installation step

* ran linter test

* removes the --user flag while installation

* ran linter test

Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
2022-11-16 10:12:14 -05:00
Krishna Chaitanya MovvaandGitHub d45bbb36df Adding the official version for SDK-FB-prophet-online-forecasting-notebook (#317)
Checklist for moving the notebook to the main repo: 
- [x] Use the [notebook template](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [x] Follow the style and grammar rules outlined in the above notebook template.
- [x] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [x] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [x] This notebook has been added to the [CODEOWNERS](https://togithub.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [x] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
2022-11-16 00:26:14 +00:00
a83ee780f1 Update file automl_tabular_regression_model_evaluation (#1179)
* text correction made

* ran linter

* modified file

* ran linter

* updated file

* ran linter

* addressed comments

* ran linte

* changing component and parameter names as per new gcpc 1.0.26

* ran linter

* updated notebook as per new package changes

* modified notebook

* ran linter

Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-15 10:01:36 -05:00
uday kumarandGitHub 0fffaee6dc Merge branch 'main' into auto_tab_on_vertex_pipeline 2022-11-14 15:42:17 +05:30
udaypunna c34b7ab651 linter test 2022-11-14 07:47:02 +00:00
udaypunna d57d9be9d4 downgraded gcpc version 2022-11-14 07:46:18 +00:00
udaypunna 88f3ecf567 downgraded gcpc version 2022-11-14 07:45:12 +00:00
6011ca5127 Tabnet on Vertex pipelines (#1171)
* Cloud Storage bucket permission issues resolved

* Cloud Storage bucket permission issues resolved

* ran linter test

* DAG issues

* linter test

* textual corrections

* ran linter test

* added service account for pipeline job

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-12 07:30:45 -08:00
haomengchaoandGitHub d53ebed734 fix vertex ai pipelines name issue and rename the colab (#1239)
* fix vertex ai pipelines name issue and rename the colab

* lint
2022-11-11 15:01:43 -05:00
38f29064a0 Updated file notebooks/official/automl/sdk_automl_tabular_regression_batch_bq.ipynb (#1217)
* notebooks/official/automl/sdk_automl_tabular_regression_batch_bq.ipynb

* updated text

* ran linter

* removed --user

* ran linter

* modified notebook, updated installs section

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-11-11 08:15:04 -08:00
Ivan CheungandGitHub 6ccad69a18 Reduce boilerplate for custom tabular bq notebook (#1207)
* Reduced boilerplate

Ran linter and fixed install

Added pyarrow

Fixed pip install

Reverted unneeded changes

Fixed pip install

Linted code and added missing preprocessor call

Fixed preprocessor

Default to us-central1

* Ran linter

* Simplified service account section
2022-11-10 17:47:13 -05:00
Andrew FerlitschandGitHub 0ca86220f8 feat: log model size (#1234) 2022-11-10 13:44:08 -05:00
Andrew FerlitschandGitHub 25e004b60e feat: DIY autlogging for XGBoost (#1229)
* feat: DIY autlogging for XGBoost

* feat: add more heap injection

* feat: lint issues

* fix: review comments
2022-11-10 12:25:27 -05:00
871288ac1a feat: add TFModel example (#1232)
Co-authored-by: gericdong <itseric@google.com>
2022-11-10 12:01:26 -05:00
uday kumarandGitHub ecfbeaa8ce Merge branch 'main' into auto_tab_on_vertex_pipeline 2022-11-10 15:46:16 +05:30
udaypunna 3e5a319455 ran linter test 2022-11-10 10:13:43 +00:00
udaypunna f35ce3432a gcpc version downgraded 2022-11-10 10:12:56 +00:00
753bb0e120 Update file automl_video_classification_model_evaluation (#1201)
* added model evaluation component

* linter test cases

* linter test cases

* model_name param issues resolved

* linter test case

* import issues resloved

* linter test cases

* made review changes

* made review changes

* ran linter test

* made review changes

* made review changes

* made review changes

* linter test

* ran linter test

* made review changes

* ran linter test

* made review changes

* ran linter test

* linter test

* review changes

* ran linter test

* added The links for Colab, Github and Workbench

* added The links for Colab, Github and Workbench

* ran linter test

* added The links for Colab, Github and Workbench

* ran linter test

* added The links for Colab, Github and Workbench

* ran linter test

* notebook title changed

* ran linter test

* text changes and made review changes

* ran linter test

* made review changes

* linter test

* made review changes

* linter test

* content changes

* ran linter test

* textual corrections and links

* ran linter test

* changed function names bases on latest gcpc version

* ran linter test

* changed function names bases on latest gcpc version

* linter test

* ran linter test

* updated arguments in ModelEvaluationClassificationOp based on new version

* ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
2022-11-09 23:16:46 -08:00
3893b76486 Modified notebook notebooks/official/workbench/demand_forecasting/forecasting-retail-demand.ipynb (#1200)
* modified notebook

* ran linter

* removed unused libraries

* ran linter

* comments resolved

* ran linter

* updated library

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-09 17:55:40 -08:00
ee805e7846 Creates a notebook for batch-prediction pipeline with BQ I/O on a custom-tabular model (#992)
* adds the custom-model-bq-io-batch-prediction-pipeline notebook to the official folder

* removes the unused libraries and variables

* ran linter test

* adds a raise exception statement to prevent auto-test check as this notebook is just to serve as a template

* resolves review comments: fixes names, removes trailing comma, fixes link format

* removes the raise excpetion step

* ran linter test

* cleans up code, explains sections and renames the notebook

* removes unused variable batch_predict_task

* removes unnecessary imports

* ran linter test

* updates the dependencies

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-09 16:16:48 -08:00
Ivan CheungandGitHub eb605b7943 Linted file (#1231) 2022-11-09 15:30:41 -05:00
Andrew FerlitschandGitHub 6f0cab7bbb fix: bad links in auto logging notebook (#1225)
* feat: DIY autologging

* feat: DIY autologging

* fix: bad links
2022-11-09 09:41:16 -05:00
udaypunna 2e9ff4a941 linter test 2022-11-09 14:40:27 +00:00
udaypunna 61fbd37fa4 service account and version chnages 2022-11-09 14:39:38 +00:00
udaypunna 474e4e602b ran linter test 2022-11-09 14:14:47 +00:00
udaypunna e409cf710b added service account and downgraded gcpc version 2022-11-09 14:14:06 +00:00
eb9b6552d8 feat: DIY autologging (#1224)
* feat: DIY autologging

* feat: DIY autologging

Co-authored-by: gericdong <itseric@google.com>
2022-11-08 17:04:19 -05:00
Ivan CheungandGitHub 35d71b410e Boilerplate reduction: Notebook template (#1204)
* Reduced notebook boilerplate

* Fixed lint issues

* Added unique suffix note

* Added unique string processor and moved tests to own folder

* Fixed broken link

* Added message about updating links

* Fixed typo

* Added missing import

* Added back useful instructions

* Addressed comments

* Removed matching engine

* Fixed comments
2022-11-08 14:10:50 -05:00
udaypunna e9bac09dce ran linter test 2022-11-08 05:40:59 +00:00
udaypunna b799aad08a gcpc version and textual corrections 2022-11-08 05:40:09 +00:00
b7d98d6f9a Vertex SDK AutoML Text Sentiment Analysis (#1157)
* bucket issues

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-07 20:12:51 -08:00
a421dc1354 Modified file sdk_automl_video_object_tracking_batch.ipynb (#1151)
* file modified

* ran linter

* model evaluation metrics are printed

* ran linter

* notebook modified

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-07 12:50:17 -08:00
a4a72c8b22 Modified file notebooks/official/migration/UJ10 Vertex SDK Custom Scikit-Learn with pre-built training container.ipynb (#1165)
* modified file

* ran linter

* unused library removed

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-07 09:18:25 -08:00
5c403dde3d Minor updates for automl-tabular-classification-model evaluation notebook (#1184)
* upgrades gcpc to latest, adds minor textual corrections

* ran linter test

* minor textual corrections

* ran linter test

* fixes sentence cases, unnecessary capitalizations, article corrections and sentence corrections

* ran linter test

* renames the ground_truth_column argument in classificationeval component to target_field_name as per version 1.0.26 and updates the reference link

* ran linter test

* upgrades gcpc to latest, adds minor textual corrections

* ran linter test

* minor textual corrections

* ran linter test

* fixes sentence cases, unnecessary capitalizations, article corrections and sentence corrections

* ran linter test

* renames the ground_truth_column argument in classificationeval component to target_field_name as per version 1.0.26 and updates the reference link

* ran linter test

* fixes the prediction_score_column unsupported error, adds class_labels field, adds the targetfieldremover component, minor structural/textual updates

* ran linter test & updates the image

* removes unnecessary newline

* ran linter test

Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-07 08:15:33 -08:00
udaypunna 4d6bd1afff ran linter test 2022-11-07 07:46:14 +00:00
udaypunna b4040ff01d textual corrections 2022-11-07 07:45:25 +00:00
a85753e1b7 Adds Pytorch text sentiment classification notebook to official folder: (#1166)
* Custom pytorch text sentiment classification

* Ran linter test

* Added creating predictor directory

* ran linter test

* Creating python package files from the notebook

* Ran linter test

* cleans up the pytorch-text-classification notebook, renames the directory and removes unnecessary files

* ran linter test

* rectifies the python test version

* ran linter test

* removes the python version line

* ran linter test

* restores the README.md file for official folder

* minor textual edits

* ran linter test

* updates notebook structure, removes unnecessary print statements, moves import statements to one cell, textual updates

* ran linter test

* corrects the Colab link

* ran linter test

* addresses review comments: grammatical/textual corrections

* ran linter test

Co-authored-by: krishr2d2 <krishna.movva@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-04 22:09:00 -07:00
2f54cf23cc Made some Minor changes to Uj7 vertex sdk auto ml text entity extraction notebook (#1057)
* Made Minor changes

* Ran Linter test

* Made minor changes

* ran linter test

* Madesome Minor changes

* Ran linter test

* Made some minor changes

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-04 19:51:05 -07:00
ffc7427265 Bqml online prediction v1 (#1160)
* Made changes in accordance with the notebook_template

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-04 14:17:36 -07:00
0e738b506f Made minor changes to Tensorboard custom training with custom container (#1051)
* UID changes added

* Ran lintertest

* removed pip install

* modified custom code

* ran linter test

* Made Minor changes

* Ran linter test

* Ran linter test

Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: sudarshan-SpringML <82567512+sudarshan-SpringML@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-04 12:24:06 -07:00
fdeaaa37fb Update file sdk_automl_text_sentiment_analysis_online (#1208)
* added uuid and textual correction

* ran linter test

* made one cell for pip installations

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-04 08:51:36 -07:00
fed7df10ac Use correct display name for Vertex AI Matching Engine brute force index (#1189)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-03 19:11:41 -07:00
725b2fdd32 Updated file custom_tabular_regression_model_evaluation (#1198)
* made text corrections

* ran linter

* modified notebook

* modified notebook

* ran linter

* modified installation step

* ran linter

* updated component name and parameters

* ran linter

* ran linter

Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-03 13:57:47 -07:00
a70f93fe0a Resolves name collisions in featurestore-pandas notebook + elaborates descriptions (#1199)
* updates featurestore name with uuid to avoid name collisions, elaboration, textual corrections

* ran linter test

* addresses review comments: adds headings + textual corrections

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-03 12:43:25 -07:00
d03697cf73 Vertex AI Experiments - All-in-one notebook (#1216)
* add notebook. update codeowners

* linter fixes

* linter test passed

* fix issues

* linter passed

* implement andy's comments

* linter passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-11-03 11:56:08 -07:00
haomengchaoandGitHub 191f2a11bc add doc about using tensorboard in vertex pipeline (#1190)
* add doc about using tensorboard in vertex pipeline

* format the doc

* fix format

* set default value to params

* fix format

* fix import

* fix format again

* update colab, github and workbench link

* update according to latest offical notebook template

* update according to comments
2022-11-03 11:38:36 -07:00
1b692bc330 feat: notebook request from UX community meeting (#1215)
Co-authored-by: gericdong <itseric@google.com>
2022-11-03 10:28:00 -07:00
Andrew FerlitschandGitHub edfd7727d3 feat: monitor non-TF model (#1211)
* feat: monitor non-TF model

* fix: review comments
2022-11-03 07:06:03 -07:00
Alexey Volkov c29e4fde26 Train tabular models with many frameworks and import to Vertex AI using Pipelines
These pipelines were previously in community content.
We'd like to move them to the official folder.

These pipelines are:

* Working out of the box (code runs with zero modifications)
* End-to-end (from nothing to a Vertex Model)
* Feature multiple ML frameworks (TensorFlow, PyTorch, XGBoost, Scikit-learn)
* Feature multiple training objectives: tabular classification and tabular regression

The main files are Python-based pipeline code (`pipeline.py`).
2022-11-03 01:53:55 -07:00
Andrew FerlitschandGitHub 5d32bd8835 fix: error in text cell (#1214) 2022-11-02 19:26:55 -04:00
Nikita NamjoshiandGitHub 8b188a11b2 fix broken links in hptune example (#1210)
* fix broken links

* fix linter
2022-11-02 10:31:38 -05:00
Andrew FerlitschandGitHub 83546a8e7b feat: TF Serving with TF tabular model (#1209)
* feat: TF Serving with TF tabular model

* fix: typo
2022-11-01 15:22:01 -04:00
c9aa6df17b fix: bad links for HPT notebook (#1205)
* Added notebook demonstrating hyperparameter tuning

* fix lint errors

* fix failing test

* ran linter

* ran linter

* resolved editorial comments

* small editorial edits

* fix failing test

* fix linter

* update colab and workbench links

Co-authored-by: nikitamaia <namjoshi.nikita@gmail.com>
2022-11-01 13:23:28 -05:00
b4955b28a2 Train tabular models with many frameworks and import to Vertex AI using Pipelines (#1174)
These pipelines are:

* Working out of the box (run with zero modifications)
* End-to-end (from nothing to a Vertex Model)
* Feature multiple ML frameworks (TensorFlow, PyTorch, XGBoost, Scikit-learn)
* Feature multiple training objectives: tabular classification and tabular regression

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-11-01 11:00:04 -04:00
Andrew FerlitschandGitHub f33d9eb6d1 feat: add example of instance schema (#1203) 2022-10-31 14:21:56 -07:00
Andrew FerlitschandGitHub 1bdbb7921a fix: reduce visibility of proto code (#1202) 2022-10-31 16:00:27 -04:00
7154a722ba Update Experiments notebook for log_classification_metrics (#1182)
* Update build_model_experimentation_lineage_with_prebuild_code.ipynb

* Update build_model_experimentation_lineage_with_prebuild_code.ipynb

* Update build_model_experimentation_lineage_with_prebuild_code.ipynb

* Update build_model_experimentation_lineage_with_prebuild_code.ipynb

* Update build_model_experimentation_lineage_with_prebuild_code.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-31 12:27:27 -07:00
halio-gandGitHub 99d4a8c31a Adding Open Source Vizier converstion sample[Updated] (#1187)
* Add a colab to show how to integrate the training job with Dask.

* Reformat the notebook xgboost_data_parallel_training_on_cpu_using_dask

* Add the code owner of the sample training/xgboost_data_parallel_training_on_cpu_using_dask.ipynb

* Changed the project id to [your-project-id].

* Fixed the issue for Non colab.

* Adding the sample of converting the Vertex Vizier SDK with Open source Vizier.

* Add the owner for conversions_vertex_vizier_and_open_source_vizier.ipynb

* Addressed the comments in the xgboost_data_parallel_training_on_cpu_using_dask

* Fixed the format of xgboost_data_parallel_training_on_cpu_using_dask

* Addressed the comments in the training/xgboost_data_parallel_training_on_cpu_using_dask.ipynb

* Add explanation that Docker is not available on Colab.

* Add  before docker command.

* add timeout in the worker to wait for the scheduler.

* Addressed the comments in the pr.

* Addressed the comments in the pr.
2022-10-28 15:26:14 -07:00
f9cedf2850 Added notebook demonstrating hyperparameter tuning (#1168)
* Added notebook demonstrating hyperparameter tuning

* fix lint errors

* fix failing test

* ran linter

* ran linter

* resolved editorial comments

* small editorial edits

* fix failing test

* fix linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-28 09:53:22 -07:00
f4f0112a6a Pipelines xgboost (#1196)
* feat: add notebook

* feat: add notebook

* fix: typos in text

Co-authored-by: gericdong <itseric@google.com>
2022-10-27 20:18:20 -04:00
Kevin NaughtonandGitHub e441568c38 Quick typo update in model_monitoring.ipynb (#1197)
The Monitoring Interval is in hours, not seconds.
2022-10-27 17:10:42 -07:00
Andrew FerlitschandGitHub fee8c969e4 feat: add xgboost pipeline notebook (#1194)
* feat: add notebook

* feat: add notebook
2022-10-27 15:20:10 -04:00
Andrew FerlitschandGitHub bdac091e3f feat: add sklearn pipeline notebook (#1193)
* feat: add notebook

* feat: add notebook

* fix: typo in text for dataset-url
2022-10-27 13:32:09 -04:00
kthytangandGitHub ff9338ed3c chore: remove preview note from CPR notebooks (#1192) 2022-10-26 11:31:42 -07:00
Andrew FerlitschandGitHub 1a538fd249 fix: multi-class vs binary classifier (#1191) 2022-10-26 08:28:35 -07:00
4f09c94b5f fix: textual corrections and Upgrade the gcpc version for automl_video_classification_model_evaluation notebook. (#1169)
* added model evaluation component

* linter test cases

* linter test cases

* model_name param issues resolved

* linter test case

* import issues resloved

* linter test cases

* made review changes

* made review changes

* ran linter test

* made review changes

* made review changes

* made review changes

* linter test

* ran linter test

* made review changes

* ran linter test

* made review changes

* ran linter test

* linter test

* review changes

* ran linter test

* added The links for Colab, Github and Workbench

* added The links for Colab, Github and Workbench

* ran linter test

* added The links for Colab, Github and Workbench

* ran linter test

* added The links for Colab, Github and Workbench

* ran linter test

* notebook title changed

* ran linter test

* text changes and made review changes

* ran linter test

* made review changes

* linter test

* made review changes

* linter test

* content changes

* ran linter test

* textual corrections and links

* ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
2022-10-25 17:32:44 -04:00
bcf3e6b0f5 Updated file custom_tabular_regression_model_evaluation (#1180)
* made text corrections

* ran linter

* modified notebook

* modified notebook

* ran linter

* modified installation step

* ran linter

Co-authored-by: Soheila Zangeneh <49654056+soheilazangeneh@users.noreply.github.com>
2022-10-25 12:42:48 -04:00
Bo zhengandGitHub fbcf783064 feat: change E2E AutoML dataset to use bank marketing data
* Change E2E AutoML dataset to use bank marketing data

* Remove vs code config
2022-10-24 22:15:43 -07:00
halio-gandGitHub 2f5fe80f34 Adding the official version for Dask parallel training on cpu (#1153)
* Add a colab to show how to integrate the training job with Dask.

* Reformat the notebook xgboost_data_parallel_training_on_cpu_using_dask

* Add the code owner of the sample training/xgboost_data_parallel_training_on_cpu_using_dask.ipynb

* Changed the project id to [your-project-id].

* Fixed the issue for Non colab.

* Addressed the comments in the xgboost_data_parallel_training_on_cpu_using_dask

* Fixed the format of xgboost_data_parallel_training_on_cpu_using_dask

* Addressed the comments in the training/xgboost_data_parallel_training_on_cpu_using_dask.ipynb

* Add explanation that Docker is not available on Colab.

* Add  before docker command.

* add timeout in the worker to wait for the scheduler.
2022-10-24 10:37:13 -07:00
a850f3a88a fix: missed bad links (#1183)
* fix: missed bad links

* fix: missed bad links

Co-authored-by: gericdong <itseric@google.com>
2022-10-21 11:09:11 -04:00
Andrew FerlitschandGitHub de91feaca1 Update README.md (#1181)
added missing link
2022-10-21 07:15:38 -07:00
Andrew FerlitschandGitHub a7fd0734dc feat: XGBoost online serving (#1175)
* feat: xgboost online serving

* fix: review comments and added pipeline example

* fix: review comments
2022-10-19 08:49:31 -07:00
Soheila ZangenehandGitHub ce1b167f08 Edit folder and file name for model registry (#1178)
* Update folder and file name

* Update file name

* Update CODEOWNERS

* Update notebook links

* Update README

* Run linter
2022-10-18 14:40:52 -07:00
Soheila ZangenehandGitHub 65ff3cab60 Revert "Update folder and file names (#1176)" (#1177)
This reverts commit c7ef72f1d3.
2022-10-18 16:59:39 -04:00
Soheila ZangenehandGitHub c7ef72f1d3 Update folder and file names (#1176)
* Rename folder

* Rename file

* Update the links

* Update CODOWNERS

* Run linter
2022-10-18 16:42:36 -04:00
Andrew FerlitschandGitHub bd58428857 fix: issue 1122 (#1173) 2022-10-18 15:09:35 -04:00
udaypunna c6fdad745f linter test 2022-10-18 12:01:03 +00:00
udaypunna 3c60c2cb97 DAG issues 2022-10-18 12:00:18 +00:00
udaypunna 278a014817 ran linter test 2022-10-17 06:36:00 +00:00
udaypunna 89ec43c706 Cloud Storage bucket permission issues resolved 2022-10-17 06:35:26 +00:00
udaypunna ba6be7ee99 Cloud Storage bucket permission issues resolved 2022-10-17 06:30:12 +00:00
Andrew FerlitschandGitHub a4a6ed848b fix: working on abstract class (#1156)
* fix: working on abstract class

* fix: working on abstract class
2022-10-13 10:56:17 -04:00
Andrew FerlitschandGitHub b753bc58d3 fix: enum and cell index naming (#1152) 2022-10-12 14:54:57 -04:00
6279e12eea Bug fixes and automation improvements for google_cloud_pipeline_components_dataproc_tabular.ipynb (#1139)
* Bug fixes and improved automation

* Clean up notebook

* Add --quiet flag to gcloud call

* Add Python prediction and subnetwork parameter

Co-authored-by: Win Woo <wwoo@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-12 08:19:25 -07:00
Andrew FerlitschandGitHub fc0c34c905 Boilerplate 2 (#1148)
* fix: merge corruption

* fix: still fix post corruption

* tuning: boiler plate script

* tuning: boiler plate

* tuning: boiler plate

* tuning: boiler plate
2022-10-11 14:01:41 -07:00
Andrew FerlitschandGitHub ef388ecf30 Boilerplate 2 (#1147)
* fix: merge corruption

* fix: still fix post corruption

* tuning: boiler plate script

* tuning: boiler plate

* tuning: boiler plate
2022-10-11 13:57:40 -07:00
Andrew FerlitschandGitHub bafb2c6f59 Boilerplate 2 (#1146)
* fix: merge corruption

* fix: still fix post corruption

* tuning: boiler plate script

* tuning: boiler plate
2022-10-11 13:43:27 -07:00
Andrew FerlitschandGitHub f2d431c182 tuning: boiler plate (#1145)
* fix: merge corruption

* fix: still fix post corruption

* tuning: boiler plate script
2022-10-11 13:31:55 -07:00
Andrew FerlitschandGitHub 2e4b6a1b1b fix: structure (#1138) 2022-10-11 13:29:11 -07:00
95cebcbf8f Update google_cloud_pipeline_components_dataproc_tabular.ipynb (#1136)
Removed extraneous `$` from CWD variable causing scala-sbt build to fail

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-11 13:04:28 -07:00
Andrew FerlitschandGitHub 08f1b659c5 Boilerplate 1 (#1144)
* feat: boiler plate reduction

* feat: boiler plate reduction
2022-10-11 11:30:08 -07:00
Andrew FerlitschandGitHub 86ba71931d fix: merge corruption (#1143) 2022-10-11 11:19:05 -07:00
d811306fb9 minor fixes (#1140)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-11 11:09:24 -07:00
Andrew FerlitschandGitHub 4173e6d561 Boilerplate 1 (#1142)
* feat: boiler plate reduction

* feat: boiler plate reduction
2022-10-11 10:27:04 -07:00
Andrew FerlitschandGitHub 499d25055a feat: boiler plate reduction (#1141) 2022-10-11 09:32:30 -07:00
Andrew FerlitschandGitHub 60776de953 fix: bad links and branding (#1137) 2022-10-10 15:57:22 -07:00
Andrew FerlitschandGitHub 182ebcf285 fix: script format (#1134)
* fix: script format

* fix: script format

* fix: script format

* fix: script format
2022-10-10 15:56:31 -07:00
MarcandGitHub 39359a5b21 switch mm ownership to Andy (#1133) 2022-10-10 09:48:12 -07:00
0d72cfe070 Modified file automl_forecasting_bqml_arima_plus_comparison (#1124)
* modified notebook

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-10 08:51:51 -07:00
64fef140a2 Vertex SDK AutoML Image Classification (#1123)
* tf library issues solved

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-07 15:14:53 -07:00
015809b948 Cleans up official/migration/UJ3 notebook and fixes the issue from regression logs (#1063)
* cleans up the notebook,replaces docker with cloud build, textual edits still in progress

* cleans up the notebook

* ran linter test

* changes tf train/serve version to 2.9

* ran linter test

* adds '=' to fix a typo

* ran linter test

* updates the opencv installation package

* ran linter test

* updates the opencv installation dependencies

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-07 09:37:12 -07:00
gericdongandGitHub faccdd081f fix: improved notebook comments and readme (#1131)
* fix: improved notebook comments

* fix: improved notebook comments and formatting
2022-10-07 08:00:02 -07:00
3e8a3cf28e updates: autoreview (#1126)
Co-authored-by: gericdong <itseric@google.com>
2022-10-06 16:11:13 -04:00
Andrew FerlitschandGitHub 821bba2776 fix: loose ends on objective conformance (#1125) 2022-10-06 15:46:31 -04:00
c82bdee299 fix: incorrect linking (#1119)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* fix: incorrect linking for index

* fix: incorrect linking

Co-authored-by: gericdong <itseric@google.com>
2022-10-06 10:11:45 -04:00
Andrew FerlitschandGitHub c27381139b fix: incorrect linking (#1121) 2022-10-05 18:28:32 -07:00
Andrew FerlitschandGitHub 01236836f2 fix: incorrect linking (#1120) 2022-10-05 18:12:30 -07:00
Andrew FerlitschandGitHub b8380650bd fix: incorrect linking (#1118)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* fix: incorrect linking for index
2022-10-05 17:52:45 -07:00
Andrew FerlitschandGitHub 69d266cb90 add: autogen index for official/vizier (#1117)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:25:04 -07:00
Andrew FerlitschandGitHub 530524ac6e feat: add autogen index for official/training (#1116)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:22:17 -07:00
Andrew FerlitschandGitHub ba66961fce feat: add autoindex for official/tensorboard (#1115)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:20:06 -07:00
Andrew FerlitschandGitHub aca7035482 add: add autogen index for official/tabular_workflows (#1114)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:17:15 -07:00
Andrew FerlitschandGitHub 3d270cde69 feat: add autoindex for official/tabnet (#1113)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:14:48 -07:00
Andrew FerlitschandGitHub 9754c265ff feat: add autoindex for official/structured_data (#1112)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:09:35 -07:00
Andrew FerlitschandGitHub f5d730c9f1 feat: add autoindex for official/sdk (#1111)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 17:02:06 -07:00
Andrew FerlitschandGitHub acd42a3a1b feat: add autogen index for official/reduction_server (#1110)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:58:46 -07:00
Andrew FerlitschandGitHub eb7cf4b6bc feat: add autoindex for official/pipelines (#1109)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:54:26 -07:00
Andrew FerlitschandGitHub 34b1011ac9 feat: add autoindex for official/model-registry (#1108)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:46:04 -07:00
Andrew FerlitschandGitHub 239d664990 feat: add autogen index for official/model_monitoring (#1107)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:43:16 -07:00
Andrew FerlitschandGitHub 920c771238 feat: add autogen index for official/model_evaluation (#1106)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:41:01 -07:00
Andrew FerlitschandGitHub e7c68ecb78 fix: autogen index for official/ml_metadata (#1105)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:37:29 -07:00
Andrew FerlitschandGitHub cfeb118d8b feat: add autogen index for official/matching_engine (#1104)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index

* feat: add autogen index
2022-10-05 16:30:00 -07:00
Andrew FerlitschandGitHub 2c9c8db15c feat: add autogen index for official/feature_store (#1103)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index

* feat: add autogen index
2022-10-05 16:24:10 -07:00
Andrew FerlitschandGitHub 6778a2cfbf fix: update autogen index for official/automl (#1102)
* feat: add autogen index

* fix: missed the REAME

* fix: update autogen index
2022-10-05 16:14:24 -07:00
Andrew FerlitschandGitHub 26c5d56e6d feat: update autogen index for official/explainable_ai (#1101)
* feat: add autogen index

* fix: missed the REAME
2022-10-05 16:08:41 -07:00
Andrew FerlitschandGitHub 527fe79f15 feat: add autogen index (#1100) 2022-10-05 16:06:38 -07:00
Andrew FerlitschandGitHub 2a003fa9c3 add: autogen index (#1085) 2022-10-05 15:55:29 -07:00
Andrew FerlitschandGitHub 03b9b6026f feat: add index (#1084) 2022-10-05 15:55:09 -07:00
Andrew FerlitschandGitHub ff8d6a9d56 feat: add autogen index (#1083) 2022-10-05 13:21:55 -07:00
Andrew FerlitschandGitHub 874c881ad6 feat: add autogen index (#1080) 2022-10-05 13:21:24 -07:00
Andrew FerlitschandGitHub f484429a89 fix: auto regen index for curated (#1076)
* fix: auto regen index for curated

* fix: bad links
2022-10-05 13:20:22 -07:00
Andrew FerlitschandGitHub 7fa2502c09 PR: bad links and objective (#1099)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 11:13:12 -07:00
Andrew FerlitschandGitHub 056791fadd fix: bad links and objective (#1098)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 11:10:35 -07:00
Andrew FerlitschandGitHub 154be75dce fix: bad links and objective (#1097)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 11:07:09 -07:00
Andrew FerlitschandGitHub ed7e900a02 fix: bad links and objective (#1096)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 11:01:19 -07:00
Andrew FerlitschandGitHub f109fefbfa fix: bad links (#1095)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 10:54:19 -07:00
Andrew FerlitschandGitHub 6f9c99d1df fix: bad links and objective (#1094)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 10:49:41 -07:00
Andrew FerlitschandGitHub ed39d78005 fix: bad links and objective conformance (#1093)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective

* fix: bad links and objective
2022-10-05 10:25:02 -07:00
Andrew FerlitschandGitHub d6466ab1a6 fix: bad links and objective (#1092)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: bad links and objective
2022-10-05 10:15:36 -07:00
Andrew FerlitschandGitHub 65e310e4e6 fix: bad links and objective (#1091)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance
2022-10-05 10:08:39 -07:00
Andrew FerlitschandGitHub 0e773ba90f fix: bad links and objective (#1090)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance

* fix: objective conformance
2022-10-05 10:07:35 -07:00
Andrew FerlitschandGitHub 0747f9efb8 fix: objective (#1089)
* fix: objective conformance

* fix: objective conformance

* fix: objective conformance
2022-10-05 09:38:50 -07:00
Andrew FerlitschandGitHub 53785fb812 fix: objective section (#1088)
* fix: objective conformance

* fix: objective conformance
2022-10-05 09:33:13 -07:00
Andrew FerlitschandGitHub b85c24dca5 fix: objective conformance (#1087) 2022-10-05 09:21:49 -07:00
Andrew FerlitschandGitHub ea5c12c22a Autoreview 17 (#1082)
* fix: bad link

* fix: objective
2022-10-04 17:32:04 -07:00
Andrew FerlitschandGitHub 392c1b7361 fix: bad link (#1081) 2022-10-04 17:26:30 -07:00
Andrew FerlitschandGitHub c5980e636e Autoreview 15 (#1079)
* fix: tag handling

* fix: objective

* fix: bad links
2022-10-04 17:08:46 -07:00
Andrew FerlitschandGitHub 8859e9426d fix: tag handling (#1078) 2022-10-04 16:57:34 -07:00
Andrew FerlitschandGitHub db7cc9000a fix: bad links (#1077)
* fix: bad links

* fix: bad links and branding
2022-10-04 16:44:03 -07:00
Andrew FerlitschandGitHub d1fe50a1d9 fix: last tag handling (#1075) 2022-10-04 14:18:22 -07:00
Andrew FerlitschandGitHub 9e3597692f Autoreview text fixes (#1074)
* fix: bad links

* fix: bad links

* fix: objective intro

* fix: objective

* fix: objective statement

* fix: objective statement
2022-10-04 14:07:17 -07:00
Andrew FerlitschandGitHub 45c8deebe5 Autoreview text fixes (#1073)
* fix: bad links

* fix: bad links

* fix: objective intro

* fix: objective

* fix: objective statement
2022-10-04 14:03:10 -07:00
Andrew FerlitschandGitHub 6705c4e4ee Autoreview text fixes (#1072)
* fix: bad links

* fix: bad links

* fix: objective intro

* fix: objective
2022-10-04 13:54:50 -07:00
Andrew FerlitschandGitHub b7f06d948a Autoreview text fixes (#1071)
* fix: bad links

* fix: bad links

* fix: objective intro
2022-10-04 13:20:29 -07:00
Andrew FerlitschandGitHub 7f3c1a9a36 fix: bad links (#1070)
* fix: bad links

* fix: bad links
2022-10-04 13:12:54 -07:00
2e991c5b9d New notebook for PyTorch distributed training on reduction server (#1064)
* feat: added new notebook for PyTorch distributed training on reduction server

* Fixed linter errors

* Addressed review comments

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-04 13:07:43 -07:00
Andrew FerlitschandGitHub f8ac68ec10 Autoreview 10 (#1069)
* fix: handling of linkback for web output

* fix: tune markdown output
2022-10-04 13:06:38 -07:00
Andrew FerlitschandGitHub a591c39367 fix: handling of linkback for web output (#1068) 2022-10-04 12:08:46 -07:00
Andrew FerlitschandGitHub d938982aae feat: calculate links for new notebooks (#1065) 2022-10-04 12:08:18 -07:00
1397c9a64a Fixed line break (#1067)
* Added tags, links to corresponding documentation pages

* Fixed line break issue

Co-authored-by: Max Reznitskii <reznitskii@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-04 11:31:32 -07:00
da97ec2244 Added tags, links to corresponding documentation pages (#1066)
Co-authored-by: Max Reznitskii <reznitskii@google.com>
2022-10-04 11:20:08 -07:00
c3f1f8239b UJ15 Vertex SDK AutoML Object Tracking (#1055)
* resloved tf library issues

* ran linter test

* made review changes

* ran linter test

* made review changes

* ran linter

* made review changes

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-04 08:51:17 -07:00
Andrew FerlitschandGitHub 73878dcc01 update: support for multi-tags and desc for web output (#1061) 2022-10-04 09:32:20 -04:00
Andrew FerlitschandGitHub 13bad2e6a3 Autoreview readme (#1060)
* fix: re autogen index

* fix: descriptions

* fix: descriptions
2022-10-03 13:24:59 -07:00
Andrew FerlitschandGitHub 0172f2b11b fix: re autogen index (#1059) 2022-10-03 12:39:50 -07:00
Andrew FerlitschandGitHub 1ba0c17555 fix: tuning README output (#1058) 2022-10-03 15:14:32 -04:00
399c961074 Modified notebook chicago_taxi_fare_prediction according to notebook template (#1043)
* error resolved

* ran linter

* andrew comments resolved

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-03 08:35:59 -07:00
d44836db9d Modified notebook inventory_prediction (#1041)
* resolved error

* resolved error

* ran linter

* andrew comments resolved

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-03 08:34:47 -07:00
4e236fd553 Text classification evaluation (#959)
* Model evaluation for text classification using Automl

* Removed unused library

* Ran Linter Test

* Commented text

* Commented Text

* Ran Linter test

* Made changes suggested in review

* Removed unused import

* Ran Linter Test

* Removed dataflow parameters as mentioned in the review

* Ran Linter Test

* Made review changes and changed notebook links in the beginning of the notebook

* Ran Linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-10-02 13:49:06 -07:00
Andrew FerlitschandGitHub 352b1e2710 fix: error handling improvements (#1053) 2022-09-30 15:40:30 -04:00
13cc94d3b7 feat: Add notebook for Wide & Deep on Vertex Pipelines (#984)
* Add notebook for Wide & Deep on Vertex Pipelines

* Address comments

* Clear output

* Fix deletion logic

* Run linter

* Rename custom_job and hpt_job to pipeline_job

* Use Vertex SDK for deletion instead of gcloud

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-30 09:46:23 -07:00
632362ed80 Modified notebook fraud-detection-model notebook (#1052)
* resolved error

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-30 09:44:45 -07:00
90b5575b0c feat: Add notebook for TabNet on Vertex Pipelines (#726)
* Added notebook for TabNet on Vertex Pipelines

* Added notebook for TabNet on Vertex Pipelines

* Added notebook for TabNet on Vertex Pipelines

* Run linter

* Ran linter

* Ran linter again

* Addressed comments

* Addressed more comments

* Remove parameter definitions, reference documentation, add details under CustomJob/HPT job sections

* Address more comments

* Fix tests

* Bug fix

* Rework TabNet HPT job section

* Addressed more comments

* Update documentation links

* Fix tests

* Fix tests

* Linter and some changes

* Address more comments

* Update CustomJob description to align with documentation

* Use bank-marketing dataset instead of safedriver

* Rename variables

* Rename variables

* Update gcs location to official one

* Changes to make notebook run with updated SDK

* Bug fix

* Rewording

* Fix workbench link

* Update notebook format to align with template

* Fix deletion logic

* Run linter

* Rename custom_job and hpt_job to pipeline_job

* Use Vertex SDK for deletion instead of gcloud

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-29 16:58:53 -07:00
2d96cc0af1 Rapid prototyping bqml automl (#877)
* Made changes in accordance with Notebook template

* Ran Linter Test

* Attached UUID to BQ_DATSET and use bq to delete dataset

* Removed unused imports

* Ran Linter Test

* Fixed BQ_DATASET

* Fixed BQ_DATASET

* Ran linter test

* Made review changes

* Removed unused library

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-29 13:17:14 -07:00
aadc80752b UJ6 Vertex SDK AutoML Text Classification (#1039)
* add The links for Colab, Github and Workbench

* added The links for Colab, Github and Workbench

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-29 13:15:10 -07:00
e8745a750b Modified notebook telecom-subscriber-churn-prediction (#874)
* modified notebook telecom-subscriber-churn-prediction.ipynb

* ran linter

* changes suggested by andrew are done

* ran linter

* changes suggested by andrew done

* ran linter

* resolved error

* ran linter

* fixed a monor bug

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-29 13:13:40 -07:00
Andrew FerlitschandGitHub 67b54685be fix: bad link (#1050)
* fix: bad link

* fix: bad link
2022-09-29 12:07:27 -07:00
Andrew FerlitschandGitHub 738dc1e01c fix: bad links (#1049)
* fix: bad link

* fix: bad link
2022-09-29 12:02:54 -07:00
Andrew FerlitschandGitHub 3b481a43a9 fix: bad links (#1048)
* fix: bad links

* fix: bad links
2022-09-29 12:02:08 -07:00
Andrew FerlitschandGitHub 35d0dee5a0 fix: bad link (#1047)
* fix: bad link

* fix: bad link
2022-09-29 11:47:25 -07:00
Andrew FerlitschandGitHub 90a0bb9b4c fix: bad link (#1046)
* fix: bad link

* fix: bad link
2022-09-29 11:47:01 -07:00
Andrew FerlitschandGitHub e59d5462b4 fix: improve args and add webdoc generation (#1045) 2022-09-29 14:15:52 -04:00
Andrew FerlitschandGitHub f94bf3c7e1 fix: bad link (#1044)
* fix: bad links

* fix: bad links
2022-09-29 09:36:59 -07:00
Andrew FerlitschandGitHub dd215b8cf0 corrections to official notebook (#978)
* fix: corrections

* fix: corrections

* fix: missing bq client

* fix: missing bq client

* fix: installs

* fix: installs

* fix: add missing imports

* fix: add missing imports
2022-09-29 09:10:44 -07:00
Andrew FerlitschandGitHub 784c94a72f fix: bad link, title (#1023)
* fix: bad link, title

* fix: bad link, title
2022-09-29 09:10:08 -07:00
Andrew FerlitschandGitHub dccfed9743 fix: broken link (#1033)
* fix: bad link

* fix: bad link
2022-09-29 09:05:29 -07:00
8346855cfe automl_video_classification_model_evaluation (#1035)
* added model evaluation component

* linter test cases

* linter test cases

* model_name param issues resolved

* linter test case

* import issues resloved

* linter test cases

* made review changes

* made review changes

* ran linter test

* made review changes

* made review changes

* made review changes

* linter test

* ran linter test

* made review changes

* ran linter test

* made review changes

* ran linter test

* linter test

* review changes

* ran linter test

* added The links for Colab, Github and Workbench

* added The links for Colab, Github and Workbench

* ran linter test

* added The links for Colab, Github and Workbench

* ran linter test

* added The links for Colab, Github and Workbench

* ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-29 09:13:24 -04:00
Andrew FerlitschandGitHub 64ad5123d0 fix: bad link (#1008)
* fix: bad link

* fix: bad link
2022-09-28 19:26:37 -07:00
Andrew Ferlitsch 0025e56323 fix: Objective 2022-09-29 02:23:03 +00:00
Andrew Ferlitsch 8fd9f35aca fix: Objective 2022-09-29 02:22:33 +00:00
Andrew FerlitschandGitHub 658abd6d5b fix: title in link (#1029)
* fix: bad links

* fix: bad links
2022-09-28 18:52:04 -07:00
Andrew FerlitschandGitHub 1243f736e2 fix: bad link (#1007)
* fix: bad link

* fix: bad link
2022-09-28 17:01:53 -07:00
Andrew FerlitschandGitHub dd0b07163f fix: bad links (#1031)
* fix: bad links

* fix: bad links
2022-09-28 16:54:38 -07:00
Andrew FerlitschandGitHub c6b268ba89 fix: bad links (#1028)
* fix: bad links

* fix: bad links
2022-09-28 15:53:01 -07:00
Andrew FerlitschandGitHub fd4f7d2641 fix: bad links (#1030)
* fix: bad links

* fix: bad links
2022-09-28 15:52:39 -07:00
Andrew FerlitschandGitHub 5c513e20c9 fix: parsing links (#1032) 2022-09-28 15:45:15 -07:00
Andrew FerlitschandGitHub d78dba7941 fix: bad links (#1025)
* fix: bad links

* fix: bad links
2022-09-28 15:37:55 -07:00
Andrew FerlitschandGitHub 42fa88547b fix: bad links (#1027)
* fix: bad links

* fix: bad links
2022-09-28 15:33:47 -07:00
Andrew FerlitschandGitHub c4cda29095 fix: bad links (#1026)
* fix: bad links

* fix: bad links
2022-09-28 15:33:25 -07:00
Andrew FerlitschandGitHub 47725449b5 fix: bad link (#1005)
* fix: bad link

* fix: bad link
2022-09-28 15:01:44 -07:00
Andrew FerlitschandGitHub 2eba462437 fix: bad link (#1010)
* fix: bad link

* fix: bad link
2022-09-28 14:31:37 -07:00
Andrew FerlitschandGitHub 97a3f4d3dd fix: add abbr (#1024) 2022-09-28 14:28:34 -07:00
Andrew FerlitschandGitHub 531e567358 fix: bad links (#1009)
* fix: bad link

* fix: bad link
2022-09-28 14:12:58 -07:00
Andrew FerlitschandGitHub 1f7c7105bb fix: link, title, format (#1018)
* fix: link, title, format

* fix: link, title, format
2022-09-28 14:12:29 -07:00
Andrew FerlitschandGitHub b109183d52 fix: bad links (#1011)
* fix: bad link

* fix: bad link
2022-09-28 13:53:45 -07:00
Andrew FerlitschandGitHub 72ed00fe0f fix: bad links (#1012)
* fix: bad link

* fix: bad link
2022-09-28 13:53:27 -07:00
Andrew FerlitschandGitHub e8d9137a50 fix: bad links (#1013)
* fix: bad link

* fix: bad link
2022-09-28 13:52:51 -07:00
Andrew FerlitschandGitHub 872e98c544 fix: bad links (#1014)
* fix: bad link

* fix: bad link
2022-09-28 13:52:17 -07:00
Andrew FerlitschandGitHub 0966fc56a4 fix: bad links, missing title (#1015)
* fix: bad link, missing title

* fix: bad link, missing title
2022-09-28 13:51:56 -07:00
Andrew FerlitschandGitHub e8d1e58fc6 fix: bad link, title (#1016)
* fix: bad link, correct title

* fix: bad link, correct title
2022-09-28 13:50:44 -07:00
Andrew FerlitschandGitHub f73ff8a44f fix: bad link, title (#1017)
* fix: bad link, correct title

* fix: bad link, correct title
2022-09-28 13:49:53 -07:00
Andrew FerlitschandGitHub 48c5810bd7 fix: bad link, title (#1019)
* fix: bad link, title

* fix: bad link, title
2022-09-28 13:49:25 -07:00
Andrew FerlitschandGitHub 9821d8986c fix: bad link, title (#1020)
* fix: bad link, title

* fix: bad link, title
2022-09-28 13:48:57 -07:00
Andrew FerlitschandGitHub 207d5db3e9 fix: bad link, title (#1021)
* fix: bad link, title

* fix: bad link, title
2022-09-28 13:48:29 -07:00
Andrew FerlitschandGitHub 9deb05e3e7 fix: bad link (#1022)
* fix: bad links

* fix: bad links
2022-09-28 13:47:59 -07:00
Andrew FerlitschandGitHub 8dafc25aab fix: bad link (#1006)
* fix: bad link

* fix: bad link
2022-09-28 13:47:25 -07:00
ef10e7db53 Vertex AI Model Registry - AutoML model management notebook (#995)
* new notebook

* linter test passed

* linter test passed

* andy review

* linter test passed

* add codeowner

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-28 09:41:50 -07:00
Andrew FerlitschandGitHub cba907ddf8 fix: tuning the script (#1004) 2022-09-28 12:21:47 -04:00
16c3d7fe25 automl_video_classification_model_evaluation (#960)
* added model evaluation component

* linter test cases

* linter test cases

* model_name param issues resolved

* linter test case

* import issues resloved

* linter test cases

* made review changes

* made review changes

* ran linter test

* made review changes

* made review changes

* made review changes

* linter test

* ran linter test

* made review changes

* ran linter test

* made review changes

* ran linter test

* linter test

* review changes

* ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-28 07:33:08 -07:00
60e1f92ef4 Vertex AI Model Registry - BQML and custom model management notebook (#991)
* add new notebook

* linter test passed

* clean text

* linter test passed

* add code owner new model registry notebook

* add more description

* linter test passed

* align with new template

* linter test passed

* andy reviews

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-28 00:05:41 -07:00
Andrew FerlitschandGitHub fb392c6375 Issue 937 (#998)
* fix: issue 937

* fix: issue 937

* fix: wrong method for service account

* fix: wrong method for service account
2022-09-27 21:33:12 -07:00
b4d10bc5aa Modified SDK_Custom_Training_Python_Package_Managed_Text_Dataset_Tensorflow_Serving_Container.ipynb (#996)
* modified notebook, resolved error and modified notebook according to template

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-27 19:51:55 -07:00
4049250bad chore: Fix Workbench links. (#983)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-27 15:24:51 -07:00
923db816e1 Added changes such as timestamp, removed colab references, added markup text mentioning usage of flag -q in a command for the file SDK_Custom_Container_Prediction (#503)
* Added changes in notebook

* Ran linter test

* Replaced Timestamp with UUID; Added 'delete-bucket' in cleanup; Added condition for repo creation and few other minor changes

* Ran Linter Test

* Made some minor changes to install packages

* Made minor changes to fix linter failed tests

* ran linter test

* Made some minor changes

* ran linter test

* addresses the review comments: fixes container build steps, license year, updates according to the template

* ran linter test

* removes beta from gcloud to avoid timeouts

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: SamyuktaDR <samyukta.dontireddy@springml.com>
Co-authored-by: SamyuktaDR <45586340+SamyuktaDR@users.noreply.github.com>
Co-authored-by: Krishna Chaitanya Movva <krishr2d2@gmail.com>
Co-authored-by: krishr2d2 <krishna.movva@springml.com>
2022-09-27 15:13:29 -07:00
Andrew FerlitschandGitHub 872f1561cd fix: argument handling improvements (#999) 2022-09-27 16:51:41 -04:00
8d7832de6e fix: issue 241479124 (#997)
* fix: issue 241479124

* fix: issue 241479124

Co-authored-by: gericdong <itseric@google.com>
2022-09-27 15:08:10 -04:00
Michael HuandGitHub f840017cda fix: bump gcpc version for bqml arima notebook (#985)
* fix: bump gcpc version for bqml arima notebook

* pr fixes
2022-09-27 11:02:38 -07:00
de3f35b8a6 Modified notebook sdk_automl_tabular_forecasting_batch.ipynb (#896)
* modified notebook

* ran linter

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-26 20:17:58 -07:00
b746bc80d4 Resolves shell-output issue in google_cloud_pipeline_components_model_upload_predict_evaluate.ipynb notebook (#878)
* resolves the shell-output issue + updates the structure based on the template

* ran linter test

* fixes issues from review: textual updates, delete_bucket=False

* ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-26 16:27:29 -07:00
2001604d37 Modified pricing-optimization.ipynb (#867)
* modified notebook according to notebook_template.

* ran linter

* Added create dataset step

* ran linter

* replaced hardcoded dataset name with a variable

* ran linter

* changes suggested by nadrew done

* ran linter

* followed prolong lin comments, data cleaning now done in bigquery

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-09-26 15:37:48 -07:00
faa148f66e Bqml vertex model registry (#993)
* Add bqml-vertexai-model-registry notebook

* Run linter

* Add notebook to CODEOWNERS file

* Update the links

* Ran linter again

* Rename bigquey-ml folder to model-registry

* Add bigquery-ml folder

* Moved the notebook

* Deleted folder

* Resolve comments

* Use UUID

* Remove using existing endpoint

* Remove try statement

* Get model sample based on model's name

* Use job.result to check query job status

* Run linter

* Fix dataset not found error by adding region in bq client creation

* Revert changes

* Fix bq bugs

* Run linter

* Resolve comments

* Display dataframe

* Updated the codeowner file

* Updated the links and editted text

* Run linter

* Remove repeated resources

* Run linter

* Resolve comments

* Run linter

* Install pyarrow

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-26 18:22:57 -04:00
f184411666 Create a function to get notebook python version for execution (#828)
* Create a function to get notebook python version for execution

* Inject python version to yaml file

* Fix python version references

* Add python string to python version variable

* add python version extraction script (untested)

* Create a function to get notebook python version for execution

* Inject python version to yaml file

* Fix python version references

* Add python string to python version variable

* Remove one notebook condition

* Remove extra check and use python 3 as default version

* Use python3.9 as default version

* Update python version notebook parser

* Add python version to the notebook template

* Fix bug

* Update python version parser function

* Add python version to a notebook for testing

* Run linter

* Use regex in python version parser function

* Add new notebook for testing

* Use better variable name

* fix typo

* Use f string instead +

* Use python from env instead of using _PYTHON_VERSION

* Use simpler regex

* Add python version test notebook

* Fixed a mistake

* Updated notebook template with python version

* Fixed python version format

* Print log contents to stdout

* Remove failing notebook

* Run linter

* Remove extra steps in the printed log

* Edit comments

* Run linter

* Run linter

* Revert test changes

Co-authored-by: AG Sol <aarongabriel@google.com>
2022-09-26 14:32:53 -07:00
bdad774100 Vertex SDK AutoML Text Sentiment Analysis (#824)
* new changes for sentiment analysis notebook

* new changes for sentiment analysis notebook

* changed back to year 2021 text

* changed back to year 2021 text

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-25 08:37:58 -07:00
9abe9a643b Added Custom tabular regression model evaluation file (#942)
* added file

* removed unnecessary imports

* ran linter

* removed extra batch prediction component

* ran linter

* moved file to official

* changed links to point to official

* ran linter

* Jason comments addressed

* ran linter

* comments addressed

* ran linter

* comments addresed

* ran linter

* added predictionschema instance schema files

* ran linter

* Followed Karen Lin's comments

* ran linter

* replaced old prebuilt containers with latest ones

* ran linter

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-24 11:12:06 -07:00
ab230ca06f add fixes to sdk-feature-store.ipynb (formatting, link edits) (#913)
* fix sdk-feature-store.ipynb Workbench link

* adding changes

* fixing links

* lint issues:

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-24 09:37:06 -07:00
dcbd3702d2 Made uuid changes and cleaned Uj6 vertex sdk auto ml text classification notebook (#904)
* Made some minor changes to notebook

* Ran linter test

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-24 09:03:11 -07:00
0505d0c04c Vizier sdk (#981)
* update: replace GAPIC with SDK

* update: replace GAPIC with SDK

Co-authored-by: gericdong <itseric@google.com>
2022-09-23 16:27:36 -04:00
a47e0aacbb Model monitor batch (#980)
* fix: batch monitoring notebook

* fix: batch monitoring notebook

Co-authored-by: gericdong <itseric@google.com>
2022-09-23 15:10:54 -04:00
15912adeaf Update the vizier sample to replace the gapic library with new Vertex Vizier SDK. (#979)
* Update the vizier codelab to replace the gapic library with new Vertex Vizier SDK.

* Added the [project_id] and [region] in the parameter field.

* Fixed the lint errors for vizier sample.

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-23 11:12:28 -07:00
Ivan NardiniandGitHub 35fdba7e1c Vertex AI Experiments - Title fix (#982)
* title fix

* linter test passed
2022-09-23 07:17:58 -07:00
f403fa9051 Made UUID changes for Sdk automl tabular regression batch bq (#976)
* Made UUID changes

* Ran lintertest

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-22 14:45:45 -07:00
0d346b136e Vertex AI Experiments - Comparing local trained models notebook - update (#971)
* clean and update comparing_local_trained_models based on feedback

* linter test passed

* fix libraries

* linter test passed

* andy review fixes

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-22 12:21:22 -07:00
Andrew FerlitschandGitHub 60d71d29cc update: add explain example (#974) 2022-09-22 09:35:13 -07:00
28c872f4b6 chore(deps): update python docker tag to v3.10 (#977)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-21 17:09:31 -07:00
Andrew FerlitschandGitHub c637d693b7 tune: pricing, branding, combining text cells (#966)
* tune: pricing, branding, combining text cells

* fix: lint
2022-09-21 13:20:01 -07:00
Andrew FerlitschandGitHub 5c3a216eb7 feat: Add notebook for automl text model online predict (#973) 2022-09-21 14:34:10 -04:00
Ivan CheungandGitHub 0b7831b0f4 Added Dockerfile for linter (#975)
Updated Dockerfile
2022-09-21 09:26:42 -07:00
Andrew FerlitschandGitHub 6a6f077ae4 update: add explain (#972) 2022-09-20 18:40:49 -04:00
Andrew FerlitschandGitHub 27f0a4bb63 feat: notebook for automl tabular online serving (#961)
* feat: notebook for automl tabular online serving

* feat: notebook for AutoML tabular model online prediction

* updates: add explain
2022-09-20 12:54:46 -07:00
1476453603 Moves Sentiment-Analysis notebook from community to official folder (#868)
* moves the sentiment_analysis notebook from community to official folder after making the updates

* removes unused modules

* ran linter test

* updates the dataset's GCS links and notebook links in the heading

* ran linter test

* fixes the typo(=)

* ran linter test

* removes wait() calls and IS_TESTING condition

* ran linter test

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-20 07:35:15 -07:00
dbafcb47ea Modified notebook UJ4 Vertex SDK AutoML Tabular Binary Classification (#891)
* modified notebook

* ran linter

* tensorflow was used only for file reading.So replaced tensorflow with pandas

* ran linter

* made text changes

* ran linter

* latest andrew domments addressed

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-19 14:46:22 -07:00
f20700f25a Model monitoring (#964)
* Changed protobuf version

* ran linter test

* Cleared execution outputs

* Ran Linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-19 11:31:01 -07:00
Andrew FerlitschandGitHub d1ca1cd7f8 fix: reported issues (#968) 2022-09-19 14:11:56 -04:00
Andrew FerlitschandGitHub 9b03fb7f8e fix: install issues (#969) 2022-09-19 09:43:07 -07:00
aac271eacc Sdk metric parameter tracking for custom jobs (#844)
* Replaced timestamp with UUID

* Ran Linter test

* Removed local kernel from metadata

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-09-16 11:43:45 -07:00
68b53e0d32 UJ11 Vertex SDK Hyperparameter Tuning (#957)
* library issues resolved

* library issues resolved

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-16 11:02:37 -07:00
Andrew FerlitschandGitHub bf354adfd3 fix: filename consistency (#952)
* fix: filename consistency

* fix: package name
2022-09-16 09:56:02 -07:00
Andrew FerlitschandGitHub 55ad5701e4 fix: pip dependency fixes (#965) 2022-09-16 12:51:05 -04:00
Andrew FerlitschandGitHub 918564dcc7 fix: missing delete dataset (#963) 2022-09-16 12:44:17 -04:00
19b3b5da0f Add Vertex AI hyperparameter tuning notebook for R using custom containers (#958)
* add unfinished notebook on hpt using R

* clear output

* add working version of notebook

* finish R HPT notebook

* update CODEOWNERS

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-15 08:37:16 -07:00
2bdab9a9b8 Fix export_additional_model_without_custom_ops argument in AutoML Tabular Workflows notebook (#914)
Co-authored-by: Helin Wang <helin@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-15 08:09:25 -07:00
Andrew FerlitschandGitHub 88e5d5d236 feat: notebook for automl image online prediction (#953) 2022-09-14 15:20:56 -04:00
Andrew FerlitschandGitHub 79730d191f fix: add details on dataset input formats (#951) 2022-09-13 18:43:08 -04:00
Andrew FerlitschandGitHub 019040e4cb fix: links (#950) 2022-09-13 15:15:43 -04:00
Andrew FerlitschandGitHub 4fd3514d6d feat: add index to batch features/notebooks (#949) 2022-09-13 14:29:46 -04:00
Andrew FerlitschandGitHub bb17381b03 fix: detecting copyright cell (#948) 2022-09-13 11:14:19 -07:00
Andrew FerlitschandGitHub 3f06f48282 fix: filename rename (#943)
* fix: filename rename

* fix: lint issues
2022-09-13 10:01:22 -07:00
33abd1e427 Move model evaluation notebooks from community to official (#940)
* Add automl regression model eval first draft

* Remove extra file

* Pring evaluation results

* adds the automl-tabular-classification notebook in model_evaluation folder

* removes unnecessary imports

* adjusts the imports inside the pipeline

* adjusts the imports

* elaborates imports inside pipeline

* modified regression notebook

* renamed pipeline displayname to resolve error

* Add automl regression model eval first draft

* Remove extra file

* Pring evaluation results

* modified some text

* added suggested updates from review: remove dataflow params, add/change textual descriptions, add UUID

* removes the output from the notebooks

* removes the extra matplotlib import

* ran linter test

* addressed soheila's comments

* ran linter

* addresses the review comments

* ran linter test

* removes the artifacts comment

* ran linter test

* reviewed comments

* ran linter

* addresses review comments: textual updates, removes unnecessary parameters

* ran linter test

* addressed comments

* ran linter

* removed unwanted variables

* ran linter

* addresses the tech-writer's comments + updates the pipeline image with data-sampler task

* ran linter test

* Update text

* Move model eval folder to official

* Update CODEOWNERS

* Run linter

* Removed problem_type parameter

* Run linter

* addresses Andrew's review comments: textual updates and removes additional gcpc installation

* ran linter test

* comments addressed

* ran linter

* removed trailing comma on last parameter of trainingjob.run

* ran linter

Co-authored-by: krishr2d2 <krishna.movva@springml.com>
Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-13 09:28:16 -07:00
Peter PingandGitHub 1d9bfe9934 Stream Update v2 (#946)
* Stream Update v2

* correct codeowner name
2022-09-12 18:24:53 -04:00
fb9defa985 Merge to sparkml branch (#881) (#882)
* Merge to sparkml branch (#881)

* feat: initial commit

* feat: WIP

* feat: still WIP, need to work on EDA

* fix: change name, still WIP

* fix: initial draft

* install geopandas in the notebook

* fix: add codeowners

* fix: install pyarrow

* fix: add condition for testing env

* fix: indentation

* fix: add dependencies for gpd

* fix: install seaborn

* fix: isort and codeowner

* fix: description

* fix: add debriefing the result

* fix: decrease sample size for testing

* fix: code review wip

* fix: code review

* fix: change dataset to 2017

* fix: code review

* fix: not using sql

* fix: lint

* fix: delete outputs

* fix: code review

* fix: typo

* fix: make sample pandas df if not testing

* Update spark_ml.ipynb (#884)

(Tech writer edit) Editing for syntax and clarification.

* small text updates

* lint fixes

* constraining plotting to non-test environments

* lint fixes

* put plotting back into tests

* address review feedback

* added comment to rerun cell if URLError thrown

Co-authored-by: Hyunuk Lim <hyunuklim@google.com>
Co-authored-by: aman-ebay <amancuso@google.com>
2022-09-12 17:28:09 -04:00
Soheila ZangenehandGitHub 824fb689e4 Bqml vertex model registry (#945)
* Add bqml-vertexai-model-registry notebook
2022-09-12 16:44:46 -04:00
Andrew FerlitschandGitHub c48dd8662b Issue 235883443 (#944)
* fix: remove obsoleted case

* fix: remove obsoleted case
2022-09-12 15:49:52 -04:00
gericdongandGitHub f251721d23 Enable Cloud Resource Manager API (#939)
* Enable Cloud Resource Manager API

* Reformatted file
2022-09-09 14:05:36 -07:00
Andrew FerlitschandGitHub e949eb128f fix: autoreview of mlops notebooks (#936)
* fix: tune for autoreview

* fix: tune for autoreview
2022-09-09 12:02:50 -04:00
df48e74f59 feat: Batch prediction for custom text model (#934)
* feat: notebook for custom text model batch prediction

* feat: notebook for custom text model batch prediction

Co-authored-by: gericdong <itseric@google.com>
2022-09-09 09:26:13 -04:00
MarcandGitHub ce9e6ecf62 add back pip install of xai sdk (#935) 2022-09-09 01:02:56 +01:00
9ab5f4274a Add automl regression and classification with model evaluation (#911)
* Add automl regression model eval first draft

* Remove extra file

* Pring evaluation results

* adds the automl-tabular-classification notebook in model_evaluation folder

* removes unnecessary imports

* adjusts the imports inside the pipeline

* adjusts the imports

* elaborates imports inside pipeline

* modified regression notebook

* renamed pipeline displayname to resolve error

* Add automl regression model eval first draft

* Remove extra file

* Pring evaluation results

* modified some text

* added suggested updates from review: remove dataflow params, add/change textual descriptions, add UUID

* removes the output from the notebooks

* removes the extra matplotlib import

* ran linter test

* addressed soheila's comments

* ran linter

* addresses the review comments

* ran linter test

* removes the artifacts comment

* ran linter test

* reviewed comments

* ran linter

* addresses review comments: textual updates, removes unnecessary parameters

* ran linter test

* addressed comments

* ran linter

* removed unwanted variables

* ran linter

* addresses the tech-writer's comments + updates the pipeline image with data-sampler task

* ran linter test

Co-authored-by: krishr2d2 <krishna.movva@springml.com>
Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-08 14:42:04 -07:00
Andrew FerlitschandGitHub 29e584a422 feat: add batch automl video notebook (#933)
* feat: batch for automl video

* feat: batch for automl video

* feat: batch for automl video
2022-09-08 11:34:29 -07:00
MarcandGitHub beabb87cff fix import problem described in b/245553683 (#932)
* fix aiplatform import problem

* lint fix

* build fix, missing tensforflow

* lint fixes
2022-09-08 16:47:20 +01:00
e3f6717ff6 community -> official for bqml-online-prediction.ipynb (#788)
* move bqml-vertex notebook from community to official

* add to CODEOWNERS official

* fix errors for execution-test

* fix project_id line

* fix linting

* fixes re: comments from sarahcdugan

* fix links at top of notebook from community/ to official/

* added UUID to model name

* fix linting

* fix error in TIMESTAMP --> UUID

* fixing linting double space

* fixes re: ivanmkc comments

* fixed notebook after linting issues

* linting via cloud shell

* simplified run_bq_query function

* linting

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-09-07 18:20:02 -04:00
fd30c4014a Minor fixes for CPR Pytorch sample (#744)
* Minor fixes for CPR Pytorch sample: Add missing test data, add auth info to readme, scrub private project and bucket names from config, tolerate missing config.json in unit tests.

* Minor fixes for CPR Pytorch sample: Add missing test data, add auth info to readme, scrub private project and bucket names from config, tolerate missing config.json in unit tests.

* Fix merge conflicts

* fix typo

* Point CPR links to main branch of SDK repo.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-07 13:02:55 -07:00
Andrew FerlitschandGitHub 4be8b0a59a fix: finetuning of batch notebooks (#930)
* fix: fine-tuning

* fix: fine-tuning
2022-09-07 10:44:44 -07:00
Andrew FerlitschandGitHub aa09d46265 feat: batch prediction for AutoML text models (#929)
* feat: Automl text model batch predict

* feat: Automl text model batch predict

* feat: Automl text model batch predict
2022-09-07 13:14:16 -04:00
Andrew FerlitschandGitHub 5667967131 feat: add BQ input example (#926)
* feat: add notebook for custom tabular batch predict

* feat: add notebook for custom tabular batch predict

* feat: add example for BQ input

* feat: add example for BQ input

* feat: add example for BQ input

* feat: add example for BQ input
2022-09-07 08:38:36 -07:00
4e4f532658 feat: batch prediction for automl tabular models (#928)
* feat: notebook for AutoML tabular batch prediction

* feat: notebook for AutoML tabular batch prediction

Co-authored-by: gericdong <itseric@google.com>
2022-09-06 15:53:54 -04:00
Andrew FerlitschandGitHub 14b2ce4f2e feat: notebook for batch predict for automl image models (#927)
* feat: batch predict for automl image model

* feat: batch predict for automl image model
2022-09-06 11:45:04 -04:00
Chun-Hsiang WangandGitHub c14b98c92d samples: Minor fix for the wording. (#924) 2022-09-05 10:42:25 -07:00
8275ea6c49 fix: correct the download_url (#923)
* fix: correct the download_url

* fix: fixed formatting issue

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-02 17:04:42 -04:00
40fbffcc95 Sdk automl image object detection batch (#869)
* changed to andrew comments

* changes according to andrew comments

* changes according to andrew comments

* review changes

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-02 13:34:25 -07:00
Andrew FerlitschandGitHub 08bb513488 feat: Batch prediction for custom tabular model (#920)
* feat: add notebook for custom tabular batch predict

* feat: add notebook for custom tabular batch predict
2022-09-01 20:33:34 -04:00
Chun-Hsiang WangandGitHub b298f83cd3 Vertex Prediction PyTorch Experimental: Add a sample for pre-built PyTorch deployments. (#898)
* samples: Add a new sample for pre-built Pytorch deployments. It's
borrowed from the examples in community-content/pytorch_text_classification_using_vertex_sdk_and_gcloud.

* samples: Removed all training related stuff in the notebooks.

* samples: Fixed comments.

* samples: Updated readme.

* samples: Updated emails for Pytorch launch.
2022-09-01 11:48:59 -07:00
Andrew FerlitschandGitHub 659cbb54c4 feat: add model monitoring with custom container (#919)
* feat: add notebook using custom deployment container

* feat: add notebook using custom deployment container
2022-09-01 10:22:05 -07:00
6ddcaa540a fix: tf serving workaround (#917)
* fix: pin TF serving image

* fix: pin TF serving image

Co-authored-by: gericdong <itseric@google.com>
2022-09-01 12:58:27 -04:00
1656c57b18 feat: extend image batch notebook (#916)
* feat: add notebook for custom image model batch prediction

* feat: add notebook for custom image model batch prediction

* fix: review comments

* fix: review comments

* feat: extend image batch notebook

* feat: extend image batch notebook

Co-authored-by: gericdong <itseric@google.com>
2022-09-01 09:56:36 -07:00
6cac60f74a Sdk feature store ver1 (#790)
* Added condition to create Featurestore if it doesn't exist

* Ran Linter Test

* Made changes mentioned in review

* Ran Linter Test

* Attached uuid to featurestore_id to avoid error while creating featurestore with existing name

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-01 08:57:16 -07:00
Andrew FerlitschandGitHub 55e37f795c feat: notebook for batch prediction with custom image model (#915)
* feat: add notebook for custom image model batch prediction

* feat: add notebook for custom image model batch prediction

* fix: review comments

* fix: review comments
2022-08-31 10:38:31 -07:00
c030d7ef74 use dataset instead of datasets (#892)
less chance for an error and confusion in name clashing with the `datasets` pypi package also used in the notebook.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-31 07:44:46 -07:00
Andrew FerlitschandGitHub 96be449c69 feat: add notebook for MM autoML (#912)
* feat: model monitoring for AutoML

* feat: model monitoring for AutoML

* fix: correction on AutoML

* fix: correction on AutoML
2022-08-30 12:45:45 -07:00
e40ddab4d5 Upgrade to DataprocPySparkBatch v1 component and add Vertex AI placeholder features (#910)
* Fix typo in notebook heading.

* Fix linting issues.

* Use gcpc v1 components and use Vertex AI for model upload and serving.

* Notebook cleanup

* Minor heading cleanup

* Fix linting issues

* Fix linting issues

* Fix linting issues

* Fix linting issues

Co-authored-by: Win Woo <wwoo@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-30 10:46:21 -07:00
Michael HuandGitHub d02bc2d56b pin arima notebook dependencies (#905)
Pins the versions of packages installed in the notebook in anticipation for a breaking change to the GCPC package.
2022-08-29 19:35:54 -04:00
76b641b23d fix: private endpoint example (#909)
* fix: remove gcloud usage

* fix: remove gcloud usage

* fix: review comments

* fix: review comments

Co-authored-by: nayaknishant <nishantnayak@google.com>
2022-08-29 12:16:18 -07:00
Andrew FerlitschandGitHub bbf4345e76 fix: remove Pantheon links (#908)
* fix: issue 194103604

* fix: issue 194103604
2022-08-28 11:24:32 -04:00
058358a795 Vertex SDK AutoML Image Object Detection (#808)
* new notebook Vertex SDK AutoML Image Object Detection

* new notebook Vertex SDK AutoML Image Object Detection

* new notebook of Vertex SDK AutoML Image Object Detection

* new notebook of Vertex SDK AutoML Image Object Detection

* linter test

* linter test

* andrew commented changes

* andrew commented changes

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 15:56:46 -07:00
Andrew FerlitschandGitHub 1c2f75f680 update: GetVertexModelOp (#907)
* update: use GetVertexModelOp

* update: use GetVertexModelOp
2022-08-26 12:12:09 -07:00
Andrew FerlitschandGitHub 999866fad1 feat: model monitoring custom (#906)
* feat: notebook for custom models

* feat: notebook for custom models

* fix: refining

* fix: refining

* fix: review updates

* fix: review updates
2022-08-26 08:58:54 -07:00
89f4571a2c Create explore_data_in_bigquery_with_workbench.ipynb (#885)
* Create explore_data_in_bigquery_with_workbench.ipynb

Adding in notebook for exploratory data analysis as part of "Data to AI" effort. See this Colab for what this notebook looks like after it is run: https://colab.research.google.com/drive/1JeNeMtj2A_5P5vo9wxSkrwHQM5JQSoAu. Submitting it with outputs shown since a lot of this about interactive visualization, which can inspire folks to use/read the notebook beyond just the code.

* Update CODEOWNERS

Adding owner for forthcoming exploratory data analysis notebook

* Update CODEOWNERS

* Updating exploratory data analysis notebook with latest updates from linter/review

* Updated notebook formatting to try to pass format test

* Trying again to pass notebook formatting test

* Trying again to pass notebook formatting test

* Trying again to pass notebook formatting test

* Linted version of notebook & better project picker

* Uploading linted version from ivanmkc@

* Update CODEOWNERS with EDA notebook

* Updated notebook w/ Tech Writer edits, re-ran all

* 1-2 minor text updates, try to pass linter again

* Trying w/ updated linted file from ivanmkc@

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 08:46:17 -07:00
eaff81fd97 New Build model experimentation lineage with prebuild code (#785)
* new changes of build model notebook

* new changes of build model notebook

* linter test issues

* linter test issues

* review changes

* review changes

* review changes

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 08:42:15 -07:00
976ed94cf2 metrics_viz_run_compare_kfp (#847)
* added new cell for is_colab condition

* added new cell for is_colab condition

* changes andrew comments

* changes andrew comments

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 08:26:58 -07:00
haomengchaoandGitHub 8ab8ef9ca9 update featurestore api version (#861)
* update api version

* fix tests

* remove unused import

* Run lint to format the change
2022-08-25 10:05:45 -07:00
eaff80a920 Fraud detection notebook2 (#821)
* Made minor changes

* Ran linter test

* Made changes mentioned in the review

* Ran Linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-25 09:49:24 -07:00
Andrew FerlitschandGitHub 8646285c26 fix: fine-tuning (#902)
* feat: new mm notebook

* feat: new mm notebook

* fix: fine-tuning

* fix: fine-tuning

* fix: review comments

* fix: review comments

* fix: review comments

* fix: review comments
2022-08-25 08:34:34 -07:00
7cad8680e1 Sdk automl tabular binary classification batch explain (#829)
* Changed prediction_output format from csv to jsonl to support generate_explanations

* ran linter test

* Made the changes as mentioned in the review

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-25 08:05:21 -07:00
4f66324883 Google cloud pipeline components automl tabular (#843)
* Removed try except blocks from cleanup section

* Ran Linter test

* Made changes mentioned in review and removed globals

* Removed an unused variable

* Ran Linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-24 21:55:50 -07:00
468fd144d2 New auto ml tabular classification bean (#787)
* new notebook of classification beans

* new notebook of classification beans

* changes on andrew comments

* changes on andrew comments

* json file issues

* json file issue

* fixes issues from reviews: adds parameter descriptions, fixes clean up, textual updates and replaces gapic functionality

* ran linter test

* adds the missing machine-type parameter

* ran linter test

* retreives the metrics using dict method

* removes unused variables

* ran linter test

* replaces old code for resource-name with new one

* ran linter test

* updates fetching the resourceName from the training artifacts

* ran linter test

* adds wait method for endpoint deployment

* ran linter test

* removes the wait method

* ran linter test

* adds wait gcp resources component

* ran linter test

* updates colab link, removes wait component, sets force to true in delete endpoint step

* ran linter test

* adds endpoint.wait() method

* ran linter test

* moves model deletion down the endpoint deletion and removes endpoint.wait() method

* ran linter test

Co-authored-by: Krishna Chaitanya Movva <krishr2d2@gmail.com>
Co-authored-by: Krishna Chaitanya Movva <krishna.movva@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-24 13:30:48 -07:00
Rosie ZouandGitHub 2503c3411c chore: fix typo in notebook (#900)
This fix was previously made by Yang Pan in https://github.com/googleapis/python-aiplatform/pull/1437 but closed due to the notebook being moved out of the main Vertex SDK repo.
2022-08-24 11:03:22 -07:00
Andrew FerlitschandGitHub 94b27550e8 feat: model monitor notebook (#899)
* feat: new mm notebook

* feat: new mm notebook
2022-08-24 08:56:18 -07:00
Soheila ZangenehandGitHub 3542e0b0a3 Add bqml vertexai model registry notebook (#842)
* Add bqml-vertexai-model-registry notebook

* Run linter

* Add notebook to CODEOWNERS file

* Update the links

* Ran linter again

* Rename bigquey-ml folder to model-registry

* Add bigquery-ml folder

* Moved the notebook

* Deleted folder

* Resolve comments

* Use UUID

* Remove using existing endpoint

* Remove try statement

* Get model sample based on model's name

* Use job.result to check query job status

* Run linter

* Fix dataset not found error by adding region in bq client creation

* Revert changes

* Fix bq bugs

* Run linter

* Resolve comments

* Display dataframe

* Updated the codeowner file
2022-08-24 10:58:46 -04:00
Andrew FerlitschandGitHub 5cf3b64618 fix: add BQ batch format info (#895)
* fix: add more info on BQ batch format

* fix: add more info on BQ batch format
2022-08-23 09:56:04 -07:00
885bfd56e5 Vertex AI Pipelines - Dataproc Serverless components - Notebook review (#866)
* review dataproc serverless notebook

* linter passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-23 09:44:34 -07:00
3a5eec64af Vertex AI Experiments - Compare pipeline runs - Notebook review (#854)
* experiments cuj1 review

* linter test passed

* typo

* linter test passed

* add correct library. add IAM roles

* linter test passed

* minor fix

* linter test passed

* add api

* linter test passed

* remove library

* linter test passed

* fix

* linter passed

* check

* linter passed

* add text

* linter passed

* minor changes

* andy reviews

* linter passed

* fix link. fix warnings

* linter passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-23 07:57:41 -07:00
8cdc7f1f79 Modified notebook multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb (#886)
* modified notebook according to template

* ran linter

Co-authored-by: gericdong <itseric@google.com>
2022-08-22 10:57:24 -04:00
Ivan CheungandGitHub 84fd10f408 fix: Fixed kernel spec by forcing it to use python3 (#889) 2022-08-19 18:43:07 -07:00
Andrew FerlitschandGitHub 7804c860c5 fix: replace tabs with spaces in JSON template (#888)
* fix: replace tabs with spaces in JSON template

* fix: replace tabs with spaces in JSON template
2022-08-19 11:11:08 -07:00
Andrew FerlitschandGitHub ed0c1c74a6 fix: typo in serving_container_uri parameter (#887) 2022-08-19 08:49:12 -07:00
Andrew FerlitschandGitHub 5127a59e92 Model monitoring (#883)
* fix: notebook template tuning

* fix: notebook template tuning

* fix: possible confusion on when to wait for the email notification

* fix: possible confusion on when to wait for the email notification
2022-08-19 08:38:29 -07:00
d8df732d6b Replace GAPIC with SDK - Model Monitoring Notebook (#879)
* Replace GAPIC with SDK

* Run linter

* Remove unused variables

* Run linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-18 11:41:11 -07:00
9c10899db8 AutoML Video Classificaton (#871)
* changes according to andrew review comments

* changes according to andrew review comments

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-18 07:25:14 -07:00
Ivan NardiniandGitHub 80770188ec Vertex AI Experiments - Model training - Notebook review (#853)
* experiments cuj1 review

* linter test passed

* add IAM role

* linter test passed

* add rm local dir

* linter test passed

* add api

* linter test passed

* remove libraries

* linter test passed

* solve build error

* fix issue

* clean

* linter passed

* fix dependency

* linter passed

* add dependency

* linter passed

* add dependency

* linter passed

* delete bucket flag fix

* linter passed
2022-08-17 10:43:34 -04:00
fa91e45018 Adds the updated managed_notebooks/predictive_maintenance notebook to the official folder (#521)
* adds the updated predictive-maintenance (managed)notebook from community to official folder

* ran linter test

* resubmitting during phase2

* ran linter test

* addresses the review comments: updates based on the new template, sets delete_bucket to False

* ran linter test

* replaces timestamp with uuid

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-16 09:39:07 -07:00
fa27309134 Fixes the issues from the regression tests (#822)
* fixes tensorflow version, replaces timestamp with uuid, adds service-account and minor textual changes

* removes second defnition of random library

* ran linter test

* uncomments the user flag and updates the installation command

* ran linter test

* removes the extra backslash

* ran linter test

* updates the installation step to fix long running compatibility checks

* ran linter test

* updates the METADATA path during installation steps

* ran linter test

* adds google-api-core version in the installation

* ran linter test

* removes METADATA step during installation

* ran linter test

* updates google api-core & auth versions

* ran linter test

* fixes tensorflow version, replaces timestamp with uuid, adds service-account and minor textual changes

* removes second defnition of random library

* ran linter test

* uncomments the user flag and updates the installation command

* ran linter test

* removes the extra backslash

* ran linter test

* updates the installation step to fix long running compatibility checks

* ran linter test

* updates the METADATA path during installation steps

* ran linter test

* adds google-api-core version in the installation

* ran linter test

* removes METADATA step during installation

* ran linter test

* updates google api-core & auth versions

* ran linter test

* fixes the issues from review: cell descriptions, parameter definitions, tense changes, 3rd person --> 2nd person, list model after pipeline run

* ran linter test

* removes the METADATA hack and updates the installations

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-16 09:11:30 -07:00
udaypunnaandGitHub 7b85f76384 custom_model_training_and_batch_prediction (#873)
* changed based on andrew review comments

* changed based on andrew review comments

* import library issues

* import library issues

* import issues

* import issues
2022-08-16 08:40:33 -07:00
40a0477b08 modified notebook automl-text-classification.ipynb (#757)
* modified notebook

* modified notebook

* added new notebook

* added new notebook

* new auto_ml_text_classifiation

* new auto_ml_text_classifiation

* new automl text classification

* linter test

* linter test

* changes on andrew comments

* changes on andrew comments

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-15 17:53:52 -07:00
839c7dddb8 Vertex AI Experiments - Compare Models - Notebook review (#852)
* experiments cuj1 review

* linter test passed

* typo

* linter test passed

* add andy reviews

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-15 09:49:50 -07:00
Andrew FerlitschandGitHub 578cfb7da7 fi: Issue 850 (#863)
* fix: add missing end_run() for experiment

* fix: add missing end_run() for experiment
2022-08-15 08:57:07 -07:00
Ivan CheungandGitHub b129c0bf43 Update CODEOWNERS (#864)
Use proper Github username.
2022-08-12 17:21:39 -04:00
07b4c37135 Automl links fix (#742)
* fixing links to open notebook - main and images

* linter test changes

* fixes the papermill execution error(hard-coded bucket link was the cause)

* ran linter test

* adds minor textual changes

* ran linter test

* fixes issues from review: future tense, copyright year, section placement, latest sdk methods, new updates from the template

* ran linter test

Co-authored-by: Manuel Amunategui <manuel.amunategui@springml.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-12 12:34:53 -07:00
f48fb1c650 Modified file churn_prediction_for_game_developers (#809)
* made changes

* made changes

* ran linter test

* made changes

* ran linter

* made changes

* ran linter

* changes suggested by andrew done

* ran linter

* replaced timestamp with uuid

* ran linter

* changed bucket creation command according to template

* ran linter

* changed text in overview

* changed region cell from markdown to code

* made changes

* replaced dataset from constant to a variable

* replaced constant dataset_id with a variable

* ran linter

* changed suggested by andrew done

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-12 08:40:38 -07:00
3bbd59311c Made UUID Changes to SDK_BigQuery_Custom_Container_Training.ipynb (#849)
* MAde UUID changes

* Ran Linter test

* made some minor changes

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-12 08:08:32 -07:00
Krishna Chaitanya MovvaandGitHub 15bb4cea73 Fixes the issues(missing variable) from regression tests, adds minor updates from the template. (#823)
* adds the missing delete_bucket variable, adds steps to configure SERVICE_ACCOUNT

* removes unnecessary random import

* ran linter test

* removes the src folder dependency to run on Colab, adds the pipeline.wait step, updates the cleanup steps

* ran linter test

* fixed issues from review: section posistions, tense changes, section descriptions, template updates

* ran linter test
2022-08-12 08:07:11 -07:00
Andrew FerlitschandGitHub 1511cc9fd1 fix: branding updates from autoreview (#862)
* autoreview: branding fixes

* fix: improve installation detection

* cleanup: rm tmp file

* fix: lint issues

* fix: 2nd try at lint fixes
2022-08-11 18:32:47 -07:00
2885a7a70f Migrated matching engine notebook to official and added VPC network support to CI (#836)
* Added matching engine notebook official

* Ran linter

* Added matching engine to .cloud-build/test_notebook_vm.txt

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 18:30:22 -07:00
ea36f5c43e Vertex SDK Custom Image Classification with pre-built training container (#833)
* new notebook of custom image classification

* new notebook of custome image classification

* andrew commented changes

* andrew commented changes

* andrew commented changes

* andrew commented changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 14:58:49 -07:00
a905a6305f fixed cleanup cell, cosmetic and doc improvements, and removed load test (to avoid flakiness), (#859)
* fix cleanup cell and print out more info on xai prediction test

* lint fix

* remove load test

* lint fixes

* lint fix

* fix andrews comments

* lint fix

* missing newline

* lint fixes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 14:04:28 -07:00
Ivan CheungandGitHub aeaeddcc75 Update PULL_REQUEST_TEMPLATE.md (#860)
Updated PR template to emphasize need for a summary and checklist. Otherwise, people tend to skip this standard practice.
2022-08-11 16:18:54 -04:00
161965cfb0 Fixes the exception in batch-explain notebook in the official folder (#810)
* fixes exception(reg-test), replaces timestamp with uuid, minor changes

* ran linter test

* resolved review comments: license year, Vertex AI SDK, dataset after objective and future tense

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 10:25:51 -07:00
b9d4457474 Modified notebook forecasting-retail-demand (#827)
* deleted file in community and added file in official folder

* renamed file

* ran linter test

* renamed file

* ran linter

* made changes

* ran linter test

* made changes

* ran linter test

* made changes

* ran linter test

* made changes

* ran linter

* made change

* ran linter test

* changes suggested by andrew done

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 09:31:27 -07:00
a5b6bcfab1 those two files are moved to official folder.Deleting them in community content (#855)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 09:14:02 -07:00
5d55f5b0d2 Modified notebook pricing-optimization.ipynb (#834)
* modified notebook according to notebook_template.

* ran linter

* Added create dataset step

* ran linter

* replaced hardcoded dataset name with a variable

* ran linter

* changes suggested by nadrew done

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 09:00:13 -07:00
36ace6f4a6 deleted inventory_prediction_folder,folder moved to official (#856)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 08:24:39 -07:00
32d9b416c1 UUID changes done comparing_pipeline_runs.ipynb (#759)
* done UUID changes

* ran lintertest

* made changes in cleanup section

* ran lintertest

* done UUID changes

* ran lintertest

* made changes in cleanup section

* ran lintertest

* made changes in cleanup section

* Ran linter test

* made UUID changes

* RAN linter test

* Made Some minor Chanages notebook

* Ran Linter Test

* small changes made

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 08:07:17 -07:00
1c6309f401 Modified notebook SDK_AutoML_Video_Classification.ipynb (#839)
* modified notebook according to template, tensorflow library is used only for file opening so instead of tf we used bucket.blob.download_as_string()

* ran linter

* all changes requested by andrew are done

* cleared all outputs

* making changes to run linter test

* making changes to run linter test

* ran linter

* removed region text in create bucket step

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-10 19:05:41 -07:00
728dec8526 Updates the custom-tabular-bq-managed-dataset notebook according to the new template (#780)
* updates the configuring steps, replaces timestamp with uuid, expands the imports

* ran linter test

* separates the vertex-ai and bigquery initialization steps

* adds comment to cell_24

* adds blank line to cell_24:7:1

* adds blank line to cell_24:7:1

* ran linter test

* fixes aiplatform+bigquery installation compatibility issue

* ran linter test

* fixes installation dependencies

* ran linter test

* fixes the issues from the review: future tense, section positions, updates from the latest template

* ran linter test

* fixes the issues from the review: Code formatting, delete redundant cells, resource name changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-10 08:41:50 -07:00
sudarshan-SpringMLandGitHub 7692f902dd Added minor changes to training-multi-class-classification-model-for-ads-targeting-usecase notebook (#735)
* added new file

* ran linter test

* made small changes

* ran linter

* added file

* ran linter

* changes requested by andrew done

* ran linter
2022-08-10 08:03:42 -07:00
9281403198 fix cleanup cell to undeploy models before deleting endpoint and remove BQ table and dataset (#846)
* fix artifact cleanup

* lint fixes

* remove extraneous echo

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 20:09:25 -07:00
2be602fbef Update comparing_local_trained_models.ipynb (#704)
Install from Pypi

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 15:39:54 -07:00
b140077eb1 Change REGION_NAME to REGION to match flag set earlier in notebook (#734)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 14:54:22 -07:00
d3139f7df8 Added colab , installed some packages, added some code based on standard template and made changes in cleanup section for the file inventory_prediction.ipynb (#533)
* Added notebook

* Ran linter test

* added pyarrow to install

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: sudarshan-SpringML <82567512+sudarshan-SpringML@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 14:49:40 -07:00
72baced988 model monitoring notebook fixes (#841)
* fix model monitoring notebook

* lint fixes

* fixed Soheila's review comments

* fix Andrew's comments

* lint fixes

* clean up install packages per review request

* lint fixes

* fix more comments from Andrew

* lint fixes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 14:16:54 -07:00
Soheila ZangenehandGitHub 5232654705 Update folder name to training (#845) 2022-08-09 12:29:34 -07:00
Andrew FerlitschandGitHub 125fe32eb2 feat: notebook for DASK training (#837)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region

* fix: set MODEL_DIR for HPT

* fix: set MODEL_DIR for HPT

* feat: add batch example

* feat: add batch example

* feat: add batch example

* feat: add batch example

* feat: add notebook for DASK training

* feat: add notebook for DASK training
2022-08-08 16:17:28 -07:00
Andrew FerlitschandGitHub 614f4154dc fix: owner names 2022-08-08 15:50:33 -07:00
Andrew FerlitschandGitHub 970415398b fix: owner username 2022-08-08 15:46:57 -07:00
Hyunuk LimandGitHub a052a3d361 A new notebook for Spark Sample (#720)
* Created spark notebook with test code

* Implemented experimental code for poly_view

* implemented the table

* WIP-notebook

* moved experimental to tutorial

* delete experimental code and rename the notebook

* clear all outputs

* fix: delete outputs again

* fix: changed template to the newer one

* fix: modify link on workbench

* add creating a cluster

* Completed Before you begin part

* Change execution sequence

* completed write back process

* change order that switching kernel goes top

* modify pie chart to bar chart

* Completed write up part

* WIP: adding description and comments.

* WIP: delete outputs

* fix: nbqa done

* Completed the first draft

* Delete %%time from cells

* Apply changes as per the code review from Brad except SparkSql

* delete outputs

* Change SparkSQL to Spark API

* change label to xlabel

* fix: description in Dataset

* fix: change BUCKET_NAME to DATASET_NAME, link for the region, and add descriptions and examples for frequency table

* fix: move normalize_name to top of the cell

* fix: refactor udf functions and descriptions

* fix: add link for udf

* fix: description in Dataset

* fix: grammer

* fix: add declared in the sentence

* fix: small changes on grammar

* fix: delete string

* fix: change UserDefinedFunction to udf

* fix: as per TW's code review

* fix: reorder REGION and TIMESTAMP under Creating a GCS bucket

* fix: lint

* chore: add bmiro@ as a codeowner of this doc

* fix: change the variable to fix a bug

* fix: as per TW's second review

* fix: add installation part to pass the ci test

* fix: url for links to main

* fix: delete disabling API since it doesn't affect to the pricing

* fix: add conditions for CI test

* fix: changed jar for testing

* fix: add gcs connector

* fix: change writing method to direct

* fix: delete gcs connector

* fix: specify java folder

* fix: change java_home location

* fix: change unzip instruction

* fix: delete mono_ranking_avg_bytes from testing env

* fix: delete frequency_table from testing env

* fix: delete GCS bucket part

* fix: as per Brad's review

* fix: lint

* fix: add version

* fix: change comment

* fix: add package due to switching the kernel

* fix: delete dataproc cluster command

* fix: change link

* fix: change link

* fix: revert cluster deletion command

* fix: change parenthesis to encoded character

* fix: change the name of the notebook

* fix: change timestamp to UUID

* fix: change the link and add description

* fix: change metadata
2022-08-08 16:23:16 -04:00
Krishna Chaitanya MovvaandGitHub f8203b9f46 UUID replaces Timestamp in the notebook template (#745)
* replaces timestamp with uuid #create *task #tag1 replace the TIMESTAMP with uuid in other official notebooks

* ran linter test

* updates the uuid code

* fixes the comment style highlighted through linter-test

* ran linter test

* adds length argument to uuid function defaulted to 8

* ran linter test
2022-08-08 11:20:33 -04:00
Andrew FerlitschandGitHub fac8c4c9b1 fix: improve batch description (#830)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region

* fix: set MODEL_DIR for HPT

* fix: set MODEL_DIR for HPT

* feat: add batch example

* feat: add batch example

* feat: add batch example

* feat: add batch example
2022-08-05 13:50:14 -07:00
Andrew FerlitschandGitHub d6c13c201e Ml ops v9v4 (#817)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region

* fix: set MODEL_DIR for HPT

* fix: set MODEL_DIR for HPT

* feat: add batch example

* feat: add batch example
2022-08-05 09:40:11 -07:00
Soheila ZangenehandGitHub 8db9ce0415 Move download link up (#813) 2022-08-04 15:05:18 -04:00
Ivan CheungandGitHub 8c7fb38136 Added missing dependency (#814) 2022-08-04 14:53:17 -04:00
Andrew FerlitschandGitHub acec861ad5 tune: notebook template (#812)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region
2022-08-04 10:51:08 -07:00
Andrew FerlitschandGitHub b5cc2b425e feat: auto review script tuning (#811)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script
2022-08-04 09:30:13 -07:00
Soheila ZangenehandGitHub 710e6ea0d8 Run commands in quiet mode (#789)
* Run commands in quiet mode in both yaml files
* Test CI against single and multiple notebooks
2022-08-04 11:00:49 -04:00
4dce246b57 Add single notebook test file and remove broken notebook from the list (#801)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-08-04 10:39:09 -04:00
Andrew FerlitschandGitHub 696efb00ee fix: auto review (#807)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 21:19:10 -07:00
Andrew FerlitschandGitHub fea73bb9c0 obsolete 2022-08-03 20:28:16 -07:00
Andrew FerlitschandGitHub f50ea24dd1 fix: auto review (#806)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 20:27:45 -07:00
Andrew FerlitschandGitHub 473e673d0a fix: auto review (#805)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 17:22:25 -07:00
Andrew FerlitschandGitHub 127297ee4e tune: grammar 2022-08-03 15:38:44 -07:00
Chun-Hsiang WangandGitHub fb528b60c6 samples: Minor fix for CPR existing image use cases. (#778) 2022-08-03 15:23:35 -07:00
Andrew FerlitschandGitHub 1c1a2b2097 fix: auto review (#804)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review
2022-08-03 14:56:26 -07:00
Andrew FerlitschandGitHub 8cb2a26817 fix: auto review (#803)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review
2022-08-03 14:38:14 -07:00
Andrew FerlitschandGitHub 3bf098b361 feat: auto review (#802)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 14:19:49 -07:00
433cffbf76 Tabnet (#732)
* Start a new branch for TabNet tutorial.

* format lint

* Clean version Created using Colaboratory

* Remove unused import

* Remove unused import

* Created using Colaboratory

* add import

* Add visualization for TabNet

* add gcs

* run format

* reformat

* reformat

* Rmove the - file

* run linter

* run linter

* Update the objective and data section

* Update the link.

* Update data description.

* Update data description.

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:42:06 -07:00
0ec2f4fbe8 bugfix: pass Dataflow related parameters correct for AutoML Tabular pipeline notebook (#725)
Also corrected the required Roles for the service account.

Co-authored-by: Helin Wang <helin@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:39:32 -07:00
a9af97f1b9 Added notebook demonstrating Tensorboard Custom Training with custom container. (#611)
* Added notebook demonstrating Tensorboard Custom Training with custom container.

* Added notebook demonstrating Tensorboard Custom Training with custom container.

* update codeowners file

* call Vertex API instead of gapic API

* resolve comments for custom container

* resolve comments and format

* resolve comments

* using --quiet for delete doctor repository

* address more comments

Co-authored-by: gericdong <itseric@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:37:14 -07:00
d6431fab4c Added notebook demonstrating Tensorboard Custom Training with prebuilt container. (#603)
* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* small fix

* address comments

* format

* update project id to be [your-project-id], and populate tensorboard resource name automatically

* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* small fix

* address comments

* format

* fix typo for service account

* use vertex api instead of gapic api

* address comments

* minor fix

* minor fix for link

* minor fix

* resolve more comments

* a minor fix for comment

* format the notebook

* resolve comments

* address more comments

Co-authored-by: gericdong <itseric@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:35:41 -07:00
dcfde86928 Added colab , installation packages and few other changes to chicago_taxi_fare_prediction.ipynb file (#515)
* Added notebook

* Made changes in installing packages code cell

* Ran linter test

* fixes the installation issues and updates some textual content

* fixes the # formatting for comments

* ran linter test

* adds pyarrow to the packages

* ran linter test

* replaces timestamp with uuid

* ran linter test

* updates the uuid code

* fixes the comment style highlighted through linter-test

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: krishr2d2 <krishna.movva@springml.com>
2022-08-03 13:33:08 -07:00
5d747ffa0d Refresh of PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container (#509)
* notebook refresh from vertex ai sdk project

* linter test

* notebook refresh from vertex ai sdk project with trainer folder

* linter test

* add pyarrow

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:32:44 -07:00
53f25201cc Made minor changes to SDK_Custom_Training_Python_Package_Managed_Text_Dataset_Tensorflow_Serving_Container notebook (#507)
* modified notebook

* small changes done

* modified notebook and moved notebook to official folder

* ran linter test

* resolved comments

* ran linter test

* sentence case heading added for some more text

* ran linter test

* made changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:32:01 -07:00
9b17db3025 Refresh of PyTorch Image Classification Multi-Node Distributed Data Parallel Training on CPU using Vertex Training with Custom Container Notebook (#489)
* multi_node_ddp_gloo_vertex_training_with_custom_container refresh and related trainer folder

* linter test

* various fixes and colab update

* linter test

* modified notebook

* modified notebook

* ran linter test

* Update multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb

Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:24:45 -07:00
423f7ac584 Adding PrivateEndpoint CUJ notebook to notebooks/community (#721)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console

* removing TODOs from Tabnet notebook

* adding notebook and editing CODEOWNERS file

* fixing links

* adding to community because of test issue

* removing CODEOWNERS

* reverting CODEOWNERS

* linting?

* adding fixes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-08-03 12:54:46 -07:00
aec82c7e5b inardini -- bqml new operators release update to v1 (#717)
* update to v1

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 12:51:46 -07:00
b227509fbb chore(deps): update dependency black to v22.6.0 (#696)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 12:43:54 -07:00
Andrew FerlitschandGitHub e715e68273 fix: auto review (#800)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 12:39:06 -07:00
406de6fe9a Adds the updated sdk-feature-store-pandas notebook to official from community folder (#488)
* adds the updated sdk-feature-store-pandas notebook to official and removes it from the community

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: nayaknishant <nishantnayak@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-08-03 12:30:10 -07:00
Andrew FerlitschandGitHub eacc49d911 fix: auto review (#798)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review
2022-08-03 12:26:12 -07:00
Andrew FerlitschandGitHub b95959e7a1 cleanup 2022-08-03 10:58:57 -07:00
Andrew FerlitschandGitHub cc2cf876de fix: auto review (#797)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 10:58:27 -07:00
Andrew FerlitschandGitHub 1047237335 Ml ops v9v4 (#796)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 10:11:23 -07:00
Andrew FerlitschandGitHub 791d589d41 Ml ops v9v4 (#795)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 09:53:21 -07:00
Andrew FerlitschandGitHub f7bdf75d90 fix: auto-review (#794)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 09:37:14 -07:00
Andrew FerlitschandGitHub 785ca9f864 fix: auto review (#793)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 09:22:59 -07:00
Andrew FerlitschandGitHub aaa7d5c259 fix: auto review (#792)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review
2022-08-03 09:01:37 -07:00
Andrew FerlitschandGitHub e21cb948d6 feat: auto review (#784)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-02 18:46:08 -07:00
Andrew FerlitschandGitHub 5551c5f895 fix: auto review (#783)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review
2022-08-02 18:29:21 -07:00
Andrew FerlitschandGitHub e8853475bc feat: tune template (#782)
* feat: tune template

* feat: tune template
2022-08-02 17:33:32 -07:00
Andrew FerlitschandGitHub 33cb8139da Update get_started_vertex_training_lightgbm.ipynb 2022-08-02 16:33:03 -07:00
Andrew FerlitschandGitHub 0288fa3703 fix: link 2022-08-02 16:32:25 -07:00
Andrew FerlitschandGitHub d48edc2cb4 fix: links 2022-08-02 16:27:45 -07:00
Andrew FerlitschandGitHub 7b26f01671 fix: link 2022-08-02 16:25:45 -07:00
Andrew FerlitschandGitHub 59cd2cda3c fix: link 2022-08-02 16:23:46 -07:00
Andrew FerlitschandGitHub 3ac469f57c fix: link 2022-08-02 16:12:59 -07:00
Andrew FerlitschandGitHub 008833422c fix: link 2022-08-02 14:47:08 -07:00
Andrew FerlitschandGitHub 59c85c3085 fix: link 2022-08-02 14:44:57 -07:00
Andrew FerlitschandGitHub f2b5d0924e fix: link title 2022-08-02 14:35:38 -07:00
Andrew FerlitschandGitHub 772cd44cef fix: link 2022-08-02 14:28:58 -07:00
Andrew FerlitschandGitHub 379a4c6a1c fix: link 2022-08-02 14:27:16 -07:00
Andrew FerlitschandGitHub 5cea72848e fix: link 2022-08-02 14:25:47 -07:00
Andrew FerlitschandGitHub 9c12dd811b fix: links 2022-08-02 14:22:38 -07:00
Andrew FerlitschandGitHub 844cf5b047 fix: links 2022-08-02 14:19:52 -07:00
Andrew FerlitschandGitHub 1492051560 fix: link 2022-08-02 14:06:43 -07:00
Andrew FerlitschandGitHub 40bdd5fce3 fix: link 2022-08-02 14:03:36 -07:00
Andrew FerlitschandGitHub d1cc60e8d7 fix: link 2022-08-02 13:50:36 -07:00
Andrew FerlitschandGitHub 7ca4cf9912 fix: links 2022-08-02 13:34:59 -07:00
Andrew FerlitschandGitHub 294e40cb61 fix: link 2022-08-02 13:27:09 -07:00
Andrew FerlitschandGitHub f69e43d3d6 fix: link 2022-08-02 13:24:41 -07:00
Andrew FerlitschandGitHub 582c479dbe fix: link 2022-08-02 13:23:07 -07:00
Andrew FerlitschandGitHub f83660cf62 fix: link 2022-08-02 13:15:55 -07:00
Andrew FerlitschandGitHub e948fae793 fix: link 2022-08-02 13:13:57 -07:00
Andrew FerlitschandGitHub cd51333ff1 fix: link 2022-08-02 13:13:00 -07:00
Andrew FerlitschandGitHub cf5d266bd7 fix: link 2022-08-02 13:09:57 -07:00
Andrew FerlitschandGitHub 8ef840affb fix: link 2022-08-02 12:59:31 -07:00
Andrew FerlitschandGitHub 4dcc3d0183 fix: link 2022-08-02 12:31:11 -07:00
Andrew FerlitschandGitHub 0bcb6a8d8e fix: title 2022-08-02 12:24:32 -07:00
Andrew FerlitschandGitHub d26b385ec7 fix: title 2022-08-02 12:23:44 -07:00
Andrew FerlitschandGitHub d5a2766aa4 Update get_started_with_matching_engine.ipynb 2022-08-02 12:22:14 -07:00
Andrew FerlitschandGitHub 7abfbb5473 fix: title 2022-08-02 12:21:41 -07:00
Andrew FerlitschandGitHub 096423da33 fix: notice 2022-08-02 12:11:17 -07:00
Andrew FerlitschandGitHub 89a133549c fix: pinning (#779)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* fix: pinning

* fix: pinning
2022-08-01 19:56:29 -07:00
648f1c34e0 Add notebook to show how to deploy BQML models for online prediction via Vertex AI Model Registry (#736)
* adding new notebook on BQML online pred via Model Registry

* minor changes

* fixes to linting

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-01 08:42:51 -07:00
Andrew FerlitschandGitHub 3f21907c31 feat: autodiscover (#775)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover
2022-07-29 22:23:59 -07:00
Andrew FerlitschandGitHub fce66b3e57 fix: title (#774)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* fix: title

* fix: title
2022-07-29 22:19:45 -07:00
Andrew FerlitschandGitHub 3b140f9caa fix: title (#773)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 21:57:11 -07:00
Andrew FerlitschandGitHub 89325d7e52 feat: autodiscover (#772)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover
2022-07-29 19:58:21 -07:00
Andrew FerlitschandGitHub e4d44f02d6 feat: autodiscover (#771)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 19:54:08 -07:00
Andrew FerlitschandGitHub 78993c4729 fix: title (#770)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 16:28:15 -07:00
Andrew FerlitschandGitHub c29e7d86bd feat: autodiscover (#769)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover
2022-07-29 16:18:24 -07:00
Andrew FerlitschandGitHub a8793fb00a fix: title (#768)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 16:08:49 -07:00
Andrew FerlitschandGitHub bb60a7d0db Ml ops v9v3 (#767)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover
2022-07-29 15:08:27 -07:00
Andrew FerlitschandGitHub eef758c719 feat: autodiscover index (#766)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title
2022-07-29 15:06:34 -07:00
Andrew FerlitschandGitHub 486ef17ab8 fix: title (#765)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title
2022-07-29 14:57:39 -07:00
Andrew FerlitschandGitHub 90dfef3db6 fix: title (#764)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title
2022-07-29 14:35:34 -07:00
Andrew FerlitschandGitHub d59c87b387 fix: title (#763)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title
2022-07-29 13:27:46 -07:00
Andrew FerlitschandGitHub 9d69b77ac6 feat: autodiscover index (#762)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover
2022-07-29 13:04:48 -07:00
Andrew FerlitschandGitHub b0da5d69f8 update: tune title (#761)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title
2022-07-29 12:44:46 -07:00
Andrew FerlitschandGitHub 830e10e583 upgrade: updates for new release (#760)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release
2022-07-29 12:17:43 -07:00
kthytangandGitHub db904b424e chore: Update CPR notebooks. (#756)
* chore: Update CPR notebooks to pip install latest released Vertex SDK pypi package.

* Update CPR notebooks wording for experimental -> preview.

* Update Objectives wording

* Update github links to main branch.

* Update Sklearn interface.

* Fix formatting and typos.

* Update Predictor interface
2022-07-28 17:13:50 -07:00
Andrew FerlitschandGitHub c371f05bfa fix: split guidelines from template (#754)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template
2022-07-28 08:13:04 -07:00
Andrew FerlitschandGitHub 5f7de16e2d fix: split off authoring guidelines (#753)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template
2022-07-28 08:08:55 -07:00
Andrew FerlitschandGitHub 3908580ad6 feat: add notebook for non-TF HPT (#751)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF
2022-07-27 14:57:24 -07:00
Andrew FerlitschandGitHub 77d2cac20a Update README.md 2022-07-27 13:39:38 -07:00
Andrew FerlitschandGitHub a92d5ce473 Update README.md 2022-07-27 13:38:51 -07:00
Andrew FerlitschandGitHub 416ec74af3 add entry 2022-07-27 13:37:51 -07:00
Andrew FerlitschandGitHub 8443bbfe44 feat: notebook for importing automl tabular model (#750)
* feat: import automl tabular model

* feat: import automl tabular model
2022-07-27 13:35:04 -07:00
kthytangandGitHub 23a599068a Update CPR notebooks. (#741)
* Update CPR notebooks.

- Update interfaces
- Fix missing timestamp
- Rename some variables

* Update cpr preprocess notebook.

- Change preprocessor import path.

* Update SDK_Custom_Predict_SDK_Integration.ipynb

* Update SDK_Custom_Predict_and_Handler_SDK_Integration.ipynb

* Update SDK_Pytorch_Custom_Predict.ipynb

* Update SDK_Triton_PyTorch_Local_Prediction.ipynb

* Fix lint and revert path change for pickle dumping preprocessor.
2022-07-27 10:58:28 -07:00
gericdongandGitHub c63bb4c464 New notebook to demonstrate how to enable TensorBoard Profiler (#719)
* New notebook to demonstrate how to enable TensorBoard Profiler

* Reformatted with Lint

* Changed service account handling and added a step to monitor job state

* Addressed review comments

* Addressed technical writerreview comments

* Addressed Ivan review comments

* Switched from GAPIC to Vertex SDK

* Removed an unused package

* Addressed review comments
2022-07-26 14:39:37 -04:00
Ivan CheungandGitHub 2226e915c0 Update CODEOWNERS 2022-07-25 16:24:10 -04:00
Ivan CheungandGitHub cd9f8b1d89 Update CODEOWNERS 2022-07-25 15:01:46 -04:00
Ivan CheungandGitHub aae9ad0422 Update CODEOWNERS 2022-07-25 15:00:33 -04:00
Ivan CheungandGitHub 89d50579a6 Add @GoogleCloudPlatform/caiis-tw to CODEOWNERS
Add @GoogleCloudPlatform/caiis-tw to default.
2022-07-25 15:00:01 -04:00
Ivan CheungandGitHub 2d6afa8313 Added better download instructions (#738)
* Improve download instruc
tions

* Added web download to notebook results list
2022-07-22 18:21:05 -04:00
Ivan CheungandGitHub 00cfb20c36 Notebook CI: Fixed variable replacement to handle numbers (#739)
* Removed replacement of variable comparisons

* Fixed issue with numbers in replacement content
2022-07-22 11:50:39 -04:00
Ivan CheungandGitHub 14c87ae702 Removed replacement of variable comparisons (#737) 2022-07-21 19:21:02 -04:00
e2a6610c2d Add an example use case for custom prediction routines. (#709)
* Add an example use case for custom prediction routines.

* Addressing some PR comments: reworded the readme in a few places, added a 'probe' command to build.py that sends a sample predict request, and pinned versions in requirements. Also fixed a bug where the artifacts_uri passed in during deployment on Vertex AI was not recognized as a directory.

* Autoformat code with black and fix a couple of typing errors.

* Addressing PR comments: Add deployment machine type to the config and add docstring to probe_prediction method.

* Update example to work with new LocalModel interface.

* Update example to work with new LocalModel interface.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-07-21 12:42:31 -07:00
Ivan CheungandGitHub 145cdd0928 Added a service account injection (#695)
* Added a service account injection

* Revert this

* Added service account injection

* Fixed cloud build file

* Added gcloud version debug info

* Fixed sa injection

* Removed test file

* Revert CODEOWNERS
2022-07-21 15:04:10 -04:00
Michael HuandGitHub 04e1697bca fix workbench link in new tables notebooks (#714) 2022-07-21 09:29:06 -04:00
Ivan CheungandGitHub be785d0389 Allow outputs (#733) 2022-07-20 17:31:12 -04:00
MarcandGitHub 976e346a3d rm open in cloud notebook until tested there, also fix open links to use community for now (#731) 2022-07-20 21:48:07 +01:00
e37caca496 chore(deps): update dependency nbqa to v1.4.0 (#727)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-07-19 13:06:00 -05:00
MarcandGitHub 7a48fe8850 add community notebook (#729) 2022-07-19 07:52:03 +01:00
Ivan NardiniandGitHub 915a1edba8 inardini - vertex explainable ai example based api example using sdk gapic (#716)
* new notebook

* linter test passed.

* add codeowners

* review

* reviews

* linter test passed.

* last review. linter test passed
2022-07-16 19:12:46 -04:00
MarcandGitHub 424f947b04 avoid linter reformatting that breaks this notebook in colab (#715)
* fix formatting for colab

* disable black formatting selectively
2022-07-12 16:23:29 -07:00
Andrew FerlitschandGitHub c95f73c1a8 fix: bad link (#712)
* feat: notebook on model registry

* feat: notebook on model registry

* feat: workflow notebook

* feat: workflow notebook

* feat: workflow notebook

* fix: objective

* fix: objective

* fix: link

* fix: link
2022-07-07 12:51:14 -07:00
Andrew FerlitschandGitHub 9da033c887 Update README.md 2022-07-06 14:40:51 -07:00
Andrew FerlitschandGitHub f61f9bfdc2 feat: notebook for automl tabular workflow (#710)
* feat: notebook on model registry

* feat: notebook on model registry

* feat: workflow notebook

* feat: workflow notebook

* feat: workflow notebook
2022-07-06 14:26:45 -07:00
b2a17dfc83 inardini - New 20+ Pipeline Operators for BQML notebook (#706)
* google_cloud_pipeline_components_bqml_pipeline_demand_forecasting notebook

* linter test to check with andy

* google_cloud_pipeline_components_bqml_pipeline_demand_forecasting notebook

* linter test to check with andy

* merge

* linter test minor fails. check with andy

* add code owner

* minor changes

* remove components

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-07-06 08:38:28 -07:00
sasha-gitgandGitHub 7072219d8b Update build_model_experimentation_lineage_with_prebuild_code.ipynb (#703)
Switch to install from Pypi
2022-07-01 14:40:52 -07:00
Andrew FerlitschandGitHub 57db2f4014 Update README.md 2022-07-01 11:45:37 -07:00
Andrew FerlitschandGitHub 4604b0a0a9 Update README.md 2022-07-01 11:44:38 -07:00
Andrew FerlitschandGitHub c8c26a12ba fix: finish objective cell (#708)
* feat: notebook on model registry

* feat: notebook on model registry
2022-07-01 11:40:28 -07:00
Andrew FerlitschandGitHub 3a8fa3e312 feat: notebook for model registry (#707)
* update: refine experiment notebook

* update: refine experiment notebook

* update: new feature release

* update: new feature release

* update: new feature release

* update: new feature release

* feat: notebook on model registry

* feat: notebook on model registry
2022-07-01 11:25:20 -07:00
bbfba5aaaf add initial automl tables on vertex pipelines notebook (#694)
* add initial automl tables on vertex pipelines notebook

* apply template

* update bucket variable name

* reviewer requested changes

* update notebook with the updated API

* fix typo

* add stage_1_tuning_result_artifact_uri to skip architecture search pipeline

* update parameter for skip architecture search pipeline

* default evaluation to True; update data splits

* update dataset to gs://cloud-samples-data/vertex-ai/tabular-workflows/datasets/safe-driver/train.csv

Co-authored-by: Helin Wang <helin@google.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-07-01 09:54:39 -07:00
Andrew FerlitschandGitHub e30b2182b0 Update get_started_with_vertex_endpoints.ipynb 2022-06-30 20:35:07 -07:00
4c4dade55a samples: Add Prediction CPR preprocess sample. (#662)
* samples: Add Prediction CPR preprocess sample.

* chore: Refined wording and used notebook template for CPR preprocessing
sample.

* samples: Fixed comments for CPR Preprocess sample.

* samples: Fixed wording.

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-30 20:14:35 -07:00
5690d50430 samples: Add Prediction CPR Triton sample. (#661)
* samples: Add Prediction CPR Triton sample.

* chore: Refined wording and used notebook template for CPR Triton sample.

* samples: Fixed comments for CPR Triton samples.

* samples: Fixed wording.

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-30 20:13:00 -07:00
Chun-Hsiang WangandGitHub 10c33f934f samples: Add Prediction CPR SDK sample. (#660)
* samples: Add Prediction CPR SDK sample.

* chore: Refined wording and used notebook template for CPR SDK sample.

* samples: Fixed comments for CPR SDK sample.

* samples: Fixed wording.
2022-06-30 20:07:29 -07:00
Andrew FerlitschandGitHub 0c43cbd563 update: remove install from git branch 2022-06-30 16:24:20 -07:00
Andrew FerlitschandGitHub b640a8f545 update: new feature release (#702)
* update: refine experiment notebook

* update: refine experiment notebook

* update: new feature release

* update: new feature release

* update: new feature release

* update: new feature release
2022-06-30 11:57:50 -07:00
Ivan CheungandGitHub a575528b11 Tweaks to matching engine notebook (#701)
* Tweaks to notebook

* Ran linter

* More tweaks
2022-06-30 11:59:05 -04:00
Andrew FerlitschandGitHub 42a2c4d082 fix: doc link 2022-06-30 08:36:57 -07:00
Andrew FerlitschandGitHub 0bcf44e9fa Update get_started_bqml_training.ipynb 2022-06-30 08:33:06 -07:00
Andrew FerlitschandGitHub 9ac2774ece Update README.md 2022-06-29 21:25:19 -07:00
Andrew FerlitschandGitHub 975c9fe6bc update: refine experiments notebook (#699)
* update: refine experiment notebook

* update: refine experiment notebook
2022-06-29 21:14:11 -07:00
Andrew FerlitschandGitHub 417410f382 Fix: remove hardwired project number (#698)
* fix: remove hardwired project number

* fix: remove hardwired project number
2022-06-29 14:42:51 -07:00
Andrew FerlitschandGitHub 8fdfbe4e31 fix: link 2022-06-29 14:20:04 -07:00
Andrew FerlitschandGitHub 80f977546c fix: title 2022-06-29 09:54:29 -07:00
Ivan NardiniandGitHub c5fe281e32 inardini - experiments cuj2 notebook release (#637)
* experiments cuj2 notebook release

* add andy reviews

* linter test passed

* align notebooks

* linter test passed

* minor changes

* karl bug review fix

* linter test passed

* add -q to install

* linter test passed

* debug

* linter test passed

* PR build fix

* linter test passed. delete debug notebook

* import import tempfile

* linter test passed

* remove pandas install

* linter test passed

* add sklearn

* linter test passed

* test pandas dep

* linter test passed

* minor changes

* linter test passed

* ivan fix
2022-06-29 12:38:16 -04:00
49a2ddaf08 fix: removing TODOs from TabNet notebook (#652)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console

* removing TODOs from Tabnet notebook

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-28 07:26:01 -07:00
e9cba94bb4 inardini - experiments cuj3 notebook release (#638)
* experiments cuj3 notebook release

* add andy reviews

* linter test passed

* align notebooks

* linter test passed

* align notebooks

* linter test passed

* update CODEOWNERS

* sasha bug review fix

* linter test passed

* minor changes

* add -q to install

* linter test passed

* ivan dep fix

* linter test passed

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-06-27 19:15:13 -04:00
fc83cfcea5 samples: Add Prediction CPR PyTorch sample. (#659)
* samples: Add Prediction CPR PyTorch sample.

* chore: Refined wording and used notebook template for PyTorch sample.

* added missing bucket cleanup

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-27 12:23:31 -07:00
e3aa9e8f35 samples: Add Prediction CPR handler sample. (#658)
* samples: Add Prediction CPR handler sample.

* chore: Refined wording and used notebook template.

* added missing bucket cleanup sequence

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-27 12:09:20 -07:00
Ivan CheungandGitHub 37c52abc11 Added a virtualenv to the notebook execution tests which should help with dependency issues (#693)
* Added a virtualenv

* Added a virtualenv for the single yaml

* Debug

* Fixed diff logic for all notebooks case

* Added missing -c
2022-06-26 13:31:52 -04:00
Ivan CheungandGitHub c8320c8764 Revert "Add notebook for co-hosting model (#666)" (#692)
This reverts commit aa5464151d.
2022-06-24 18:26:28 -04:00
b5d51e61b6 inardini - experiments cuj1 notebook release (#636)
* experiments cuj1 notebook release

* add andy reviews

* linter test passed

* align notebooks

* linter test passed

* minor changes

* linter test passed

* minor changes

* linter test passed

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-06-24 15:35:32 -04:00
Ziye XingandGitHub aa5464151d Add notebook for co-hosting model (#666)
* Add notebook for co-hosting model

* Add co-hosting model notebook codeowner
2022-06-24 10:36:26 -07:00
Andrew FerlitschandGitHub 386cecf4c2 upgrade: current notebook standard (#677)
* upgrade: notebook standard

* upgrade: notebook standard

* Update custom_model_training_and_batch_prediction.ipynb
2022-06-24 09:59:49 -07:00
dffdb15c17 Add default kernel_name for notebook execution (#497)
Currently, there is no kernel_name. Hence, the execution test cannot run for notebooks that don't have kernels defined in their .ipynb file.

Side-note: We should use lint to remove the kernel_name from .ipynb as well, as it could include info specific to the author's environment.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-23 19:18:49 -04:00
Andrew FerlitschandGitHub 2f3691eb71 fix: workbench link 2022-06-23 13:55:29 -07:00
Andrew FerlitschandGitHub f456d86555 fix: open in workbench link 2022-06-23 13:52:39 -07:00
Andrew FerlitschandGitHub f534b4e7a5 upgrade: fine tune notebook standard 2022-06-23 13:28:00 -07:00
Andrew FerlitschandGitHub de247cd78b upgrade: current notebook standards (#681)
* upgrade: notebook standard

* upgrade: notebook standard

* fix: formatting
2022-06-23 12:03:55 -07:00
Andrew FerlitschandGitHub 22ad74eb8d Update README.md 2022-06-23 10:06:28 -07:00
Andrew FerlitschandGitHub baf69999fc update: fine-tuning notebook (#689)
* update: touchups

* update: touchups
2022-06-23 10:02:02 -07:00
Mohammad Al-AnsariandGitHub d5057da9bb Added new notebook that creates Vertex AI AutoML text entity extraction dataset from PDFs using Vision API (#683)
* Added new Stage 1 notebook to create unlabelled
Vertex AI AutoML text entity extraction dataset
from collection of PDF files on Google Cloud Storage

* Linted notebook

* Removed TODOs

* Updates per PR comments

* Revered to multiple imports per line
2022-06-23 08:38:14 -07:00
24904a5999 feat: adding code owners and updating graph_paysim (#645)
* adding code owners and updating graph_paysim

* formatted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-06-22 21:31:55 -05:00
Ivan CheungandGitHub 881a2b45c5 Improved git diff logic (#687) 2022-06-22 21:49:09 -04:00
Andrew FerlitschandGitHub 41fc83ad03 upgrade: current notebook standards (#655)
* update: current standards

* update: current standards

* Update sdk_custom_image_classification_batch_explain.ipynb

* fix: bucket nit
2022-06-22 16:59:39 -07:00
Andrew FerlitschandGitHub 9928276dc3 upgrade: current notebook standard (#653)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update sdk_automl_tabular_binary_classification_batch_explain.ipynb

* fix: bucket nit
2022-06-22 16:58:42 -07:00
Andrew FerlitschandGitHub 6607f93f5e upgrade: updated curated notebook to current standards (#648)
* upgrade: current standards

* upgrade: current standards

* fix: missed nits

* fix: missed nits

* Update automl-text-classification.ipynb

* Update automl-text-classification.ipynb

* rm extra comma
2022-06-22 16:56:38 -07:00
Andrew FerlitschandGitHub dcc0cfe06e upgrade: current notebook standards (#686)
* upgrade: notebook standard

* upgrade: notebook standard
2022-06-22 16:50:13 -07:00
Andrew FerlitschandGitHub 00d5c5c4bf Update README.md 2022-06-22 15:34:01 -07:00
Andrew FerlitschandGitHub f8152dde19 Update README.md 2022-06-22 15:24:14 -07:00
Andrew FerlitschandGitHub 0586e04c21 upgrade: current notebook standards (#656)
* update: current standards

* update: current standards

* fix: bucket nit
2022-06-22 15:06:01 -07:00
Andrew FerlitschandGitHub 3de18a7fab upgrade: current notebook standards (#674)
* upgrade: current notebook standard

* upgrade: current notebook standard

* fix: bucket

* fix: bucket
2022-06-22 15:03:54 -07:00
Andrew FerlitschandGitHub dc0bf24cc5 Update README.md 2022-06-22 14:58:28 -07:00
Andrew FerlitschandGitHub 8ce4c3070c Update README.md 2022-06-22 14:53:54 -07:00
Andrew FerlitschandGitHub 13c3acb976 Update README.md 2022-06-22 14:50:45 -07:00
Andrew FerlitschandGitHub c1150ff584 Update README.md 2022-06-22 14:39:06 -07:00
Andrew FerlitschandGitHub 4f11d70f7e Update README.md 2022-06-22 14:34:02 -07:00
Andrew FerlitschandGitHub 2bf9a2b317 Update README.md 2022-06-22 14:24:53 -07:00
Andrew FerlitschandGitHub b1e0ad0c4f Update README.md 2022-06-22 14:15:22 -07:00
Andrew FerlitschandGitHub 5624f92f02 Update README.md 2022-06-22 14:12:18 -07:00
Andrew FerlitschandGitHub 1335032954 Update README.md 2022-06-22 14:05:24 -07:00
Andrew FerlitschandGitHub 0b13c66e07 Update README.md 2022-06-22 14:01:55 -07:00
Andrew FerlitschandGitHub ef25b54926 update: add index (#684) 2022-06-22 13:58:06 -07:00
Andrew FerlitschandGitHub 064dbfeefa fix: bucket nit 2022-06-22 12:34:50 -07:00
Andrew FerlitschandGitHub 044c69e7a5 upgrade: current notebook standards (#654)
* update: current standards

* update: current standards
2022-06-22 12:33:26 -07:00
Andrew FerlitschandGitHub 32a46e7471 upgrade: current standards (#649)
* upgrade: current standards

* upgrade: current standards

* fix: missed nits

* fix: missed nits
2022-06-22 12:30:16 -07:00
Andrew FerlitschandGitHub b52d59822d upgrade: current notebook standards (#657)
* update: current standards

* update: current standards

* update: current standards

* update: current standards

* Update sdk_custom_tabular_regression_batch_explain.ipynb

* fix: indent issue

* fix: indent issue

* fix: bucket

* fix: bucket

* fix: image

* fix: image

* fix: cleanup

* fix: cleanup

* fix: cleanup
2022-06-22 11:47:17 -07:00
Andrew FerlitschandGitHub 529995ecde upgrade: current notebook standard (#671)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update google_cloud_pipeline_components_automl_tabular.ipynb

* fix: bucket

* fix: bucket
2022-06-22 11:35:38 -07:00
Andrew FerlitschandGitHub 0726328c92 upgrade: current notebook standard (#667)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update model_monitoring.ipynb

* Update model_monitoring.ipynb
2022-06-22 11:21:32 -07:00
Andrew FerlitschandGitHub 090e83c286 fix: more broken links 2022-06-22 11:19:17 -07:00
Andrew FerlitschandGitHub c3802626b9 fix: links issue 672 2022-06-22 11:18:08 -07:00
Andrew FerlitschandGitHub 9570c2477f upgrade: current notebook standards (#682)
* upgrade: current notebook standards

* upgrade: current notebook standards
2022-06-22 11:09:27 -07:00
Andrew FerlitschandGitHub 2b1a898b2a upgrade: current notebook standards (#680)
* upgrade: current notebook standards

* upgrade: current notebook standards
2022-06-22 11:09:04 -07:00
Andrew FerlitschandGitHub f2a42aa66e upgrade: current notebook standard (#679)
* upgrade: notebook standard

* upgrade: notebook standard

* fix: bucket

* fix: bucket
2022-06-22 11:08:37 -07:00
Andrew FerlitschandGitHub 30a03f1fd1 upgrade: current notebook standards (#678)
* upgrade: notebook standard

* upgrade: notebook standard

* Update google_cloud_pipeline_components_model_train_upload_deploy.ipynb

* fix: bucket nits

* fix: bucket
2022-06-22 11:08:08 -07:00
Andrew FerlitschandGitHub ca25448f59 upgrade: current notebook standard (#673)
* upgrade: current notebook standard

* upgrade: current notebook standard

* fix: bucket nit

* fix: bucket nit
2022-06-22 11:07:37 -07:00
Andrew FerlitschandGitHub 8f922710b0 upgrade: current notebook standard (#670)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update google_cloud_pipeline_components_automl_images.ipynb

* fix: bucket

* fix: bucket
2022-06-22 11:06:31 -07:00
Andrew FerlitschandGitHub 9509c6ab9d upgrade: current notebook standard (#669)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update lightweight_functions_component_io_kfp.ipynb

* fix: nits

* fix: nits

* fix: nits

* fix: nits
2022-06-22 11:05:47 -07:00
Andrew FerlitschandGitHub ccba176979 upgrade: current notebook standard (#665)
* upgrade: notebook standard

* upgrade: notebook standard

* Update sdk-feature-store.ipynb

* Update sdk-feature-store.ipynb

* Update sdk-feature-store.ipynb

* fix: aip reference

* fix: nits

* fix: nits
2022-06-22 11:05:07 -07:00
Andrew FerlitschandGitHub 1b8f383897 upgrade: current notebook standard (#663)
* update: current standards

* update: current standards

* fix: bucket

* fix: bucket
2022-06-22 09:36:49 -07:00
Andrew FerlitschandGitHub e5cd9e86d2 upgrade: notebook to latest standard (#651)
* fix: missed nits

* fix: missed nits
2022-06-22 08:56:10 -07:00
Andrew FerlitschandGitHub a7e86a4f26 upgrade: current notebook standard (#668)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
2022-06-21 20:23:18 -07:00
Ivan CheungandGitHub 8f0c73b32c Fixed cleanup scripts (#676) 2022-06-21 20:13:37 -07:00
Andrew FerlitschandGitHub c7d7b48a91 upgrade: notebook to current standards (#650)
* upgrade: current standards

* upgrade: current standards
2022-06-21 18:25:25 -07:00
Karl WeinmeisterandGitHub 583eb90f07 fix: CONTRIBUTING.md did not have nbfmt as final step 2022-06-20 13:56:49 -05:00
c3a9249c0c Workaround tensorboard/GCS issue for Cloud Shell (#386)
* Workaround tensorboard/GCS issue for Cloud Shell

Without `--load_fast=false` there will be `401 Unauthorized` for GCS log loads. 
See https://github.com/tensorflow/tensorboard/issues/4784#issuecomment-868945650

* PR #386: Fix missing import

`import json` was missing.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-19 10:07:09 -05:00
Karl WeinmeisterandGitHub 81b70e779c ci: Remove protobuf from requirements.txt 2022-06-19 09:38:45 -05:00
Karl WeinmeisterandGitHub 085713a818 ci: Add protobuf to requirements.txt 2022-06-18 17:20:45 -05:00
Karl WeinmeisterandGitHub 5af7c851dc Fix: update typo in GAPIC Feature Store notebook 2022-06-18 17:10:49 -05:00
691312d467 Add import feature analysis config sample code into gapic-feature-sto… (#548)
* Add import feature analysis config sample code into gapic-feature-store.ipynb

* Fixing linter for gapic-feature-store.ipynb

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 17:09:37 -05:00
650c256c13 Fixes link to colab (#627)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:26:36 -05:00
9b00c4380b chore(deps): update actions/setup-python action to v4 (#622)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:21:49 -05:00
Karl WeinmeisterandGitHub 4851457e93 ci: Add Python version to support setup-python v4 2022-06-18 16:19:09 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
1c54878fab build(deps): bump tensorflow (#595)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:08:07 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
c139b84454 build(deps): bump tensorflow (#593)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-06-18 16:02:53 -05:00
15c38b4ca6 chore(deps): update dependency pyupgrade to v2.34.0 (#457)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 15:59:54 -05:00
Ivan CheungandGitHub 271c949a71 Update README.md (#642) 2022-06-17 14:59:05 -07:00
Andrew FerlitschandGitHub 09b5401434 update: fine-tuning notebook (#641)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms

* review: updates from review

* review: updates from review

* updates: fine tuning
2022-06-17 13:41:10 -07:00
dad76547f0 inardini - mobile gaming feature store blog review (#635)
* review content and image

* linter test passed

* andy review fixes

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-17 10:39:18 -07:00
Andrew FerlitschandGitHub c14a110c81 Update get_started_with_custom_training_pipeline_components.ipynb 2022-06-16 14:24:08 -07:00
Andrew FerlitschandGitHub d1e16546cc Update get_started_with_bqml_pipeline_components.ipynb 2022-06-16 14:23:29 -07:00
Andrew FerlitschandGitHub f91bc3d0c9 Update get_started_with_bq_tfdv_pipeline_components.ipynb 2022-06-16 14:22:56 -07:00
Andrew FerlitschandGitHub 5168808b6c fix: colab link 2022-06-16 14:22:23 -07:00
Andrew FerlitschandGitHub 501cca7b5e fix: colab link 2022-06-16 14:21:31 -07:00
Andrew FerlitschandGitHub f19d40d858 Update mlops_experimentation.ipynb 2022-06-16 13:49:17 -07:00
Andrew FerlitschandGitHub 5a721ce01d Update get_started_with_visionapi_and_automl.ipynb 2022-06-16 13:48:31 -07:00
Andrew FerlitschandGitHub 66421fb4d8 fix: colab link 2022-06-16 13:47:47 -07:00
Andrew FerlitschandGitHub 3658ee8c88 Update get_started_with_tabnet.ipynb 2022-06-16 13:46:10 -07:00
Andrew FerlitschandGitHub afaab4bb02 Update get_started_with_cmek_training.ipynb 2022-06-16 13:45:08 -07:00
Andrew FerlitschandGitHub c1e004bdff fix: colab link 2022-06-16 13:44:22 -07:00
Andrew FerlitschandGitHub 874e5a3ef5 Update get_started_vertex_training_xgboost.ipynb 2022-06-16 13:43:11 -07:00
Andrew FerlitschandGitHub 51529f370c fix: broken table 2022-06-16 13:41:01 -07:00
Andrew FerlitschandGitHub 5ddf98866c Update get_started_vertex_training_sklearn.ipynb 2022-06-16 13:40:22 -07:00
Andrew FerlitschandGitHub fbb6830876 fix: colab link 2022-06-16 13:30:01 -07:00
Andrew FerlitschandGitHub ee1bb281da fix: colab link 2022-06-16 13:28:16 -07:00
Andrew FerlitschandGitHub da2f7e88fe fix: update location of public dataset bucket 2022-06-16 12:43:15 -07:00
Andrew FerlitschandGitHub 3fb28e353f fix: remove internal link 2022-06-16 12:40:02 -07:00
Andrew FerlitschandGitHub c8e7f44f0a fix: updates from review (#640)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms

* review: updates from review

* review: updates from review
2022-06-16 12:36:28 -07:00
3d9049aeeb remove old hard-coded instances for prediction (#633)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-16 11:50:01 -07:00
Andrew FerlitschandGitHub 7b8726af24 fix: perms for using MR in BQML (#634)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms
2022-06-15 14:55:17 -07:00
Andrew FerlitschandGitHub 0443b05360 feat: add create tabular dataset from dataframe example (#632)
* feat: add example of import from dataframe

* feat: add example of import from dataframe
2022-06-14 11:44:30 -07:00
Ivan CheungandGitHub e422dbdef2 Added official version of tabular regression batch bq (#331)
* Added official version of tabular regression batch bq

* Ran linter

* Fixed cleanup

* Additional cleanup

* Added working version

* Refactored and made work

* Ran linter and cleaned up

* Renamed aip to aiplatform

* Replaced online with batch

* Renamed notebook

* Ran linter and cleaned up

* Fixed bug

* Fixed SQL by adding backticks

* Install google-cloud-bigquery[all]

* Refactored datasets

* Ran linter

* Removed GCS cells

* Fixed import file

* Fixed SQL issues and added cleanup of training dataset

* Fixed hardcorded table

* Fixed brand names

* Fixed header

* Fixed results table

* Addressed tech writing review comments

* Ran linter
2022-06-14 14:14:06 -04:00
Andrew FerlitschandGitHub ec5fc0b1c8 Update get_started_vertex_training_r.ipynb 2022-06-14 10:05:36 -07:00
Andrew FerlitschandGitHub c52e3f20ba Update get_started_vertex_training_pytorch.ipynb 2022-06-14 10:04:45 -07:00
Andrew FerlitschandGitHub e367dceceb Update get_started_vertex_training_lightgbm.ipynb 2022-06-14 10:04:11 -07:00
Andrew FerlitschandGitHub 19b8666808 Update get_started_vertex_training.ipynb 2022-06-14 10:03:24 -07:00
Andrew FerlitschandGitHub a2df0e9fca Update get_started_vertex_tensorboard.ipynb 2022-06-14 10:01:52 -07:00
Andrew FerlitschandGitHub 73b094550e Update get_started_vertex_feature_store.ipynb 2022-06-14 09:59:24 -07:00
Andrew FerlitschandGitHub d05ae109e1 Update get_started_vertex_experiments.ipynb 2022-06-14 09:57:55 -07:00
Andrew FerlitschandGitHub fdb25791d5 Update get_started_vertex_distributed_training.ipynb 2022-06-14 09:57:19 -07:00
Andrew FerlitschandGitHub 5a88492498 Update get_started_bqml_training.ipynb 2022-06-14 09:56:34 -07:00
Andrew FerlitschandGitHub f19a12b829 Update get_started_automl_training.ipynb 2022-06-14 09:55:53 -07:00
Andrew FerlitschandGitHub 3ed0ea73f4 Update get_started_bq_datasets.ipynb 2022-06-14 09:08:47 -07:00
Andrew FerlitschandGitHub b98fd24a72 Update get_started_bq_datasets.ipynb 2022-06-13 21:29:41 -07:00
Andrew FerlitschandGitHub eb4e9a0f91 Update get_started_vertex_datasets.ipynb 2022-06-13 21:27:16 -07:00
Andrew FerlitschandGitHub ec7c136b0a Update get_started_vertex_datasets.ipynb 2022-06-13 21:26:24 -07:00
Andrew FerlitschandGitHub ee7e43cc1a Update mlops_data_management.ipynb 2022-06-13 20:24:57 -07:00
Andrew FerlitschandGitHub ea9f5f3c5c Update get_started_with_data_labeling.ipynb 2022-06-13 20:24:22 -07:00
Andrew FerlitschandGitHub bd44798412 Update get_started_vertex_datasets.ipynb 2022-06-13 20:23:37 -07:00
Andrew FerlitschandGitHub 2af0cc0f80 fix: test for local execution 2022-06-13 20:22:57 -07:00
Andrew FerlitschandGitHub 5c0fa14d2d Update get_started_bq_datasets.ipynb 2022-06-13 20:21:44 -07:00
Andrew FerlitschandGitHub 7cc50d3203 Update README.md 2022-06-13 13:58:20 -07:00
Andrew FerlitschandGitHub 9c7da13177 Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:39:33 -07:00
Andrew FerlitschandGitHub 45e0645f0b Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:38:55 -07:00
Andrew FerlitschandGitHub cb884cc74a Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:38:22 -07:00
Ivan CheungandGitHub d3a6475580 Fixed mistake in batch prediction request section (#617)
* Fixed mistake in batch prediction request section

* Fixed linter requirements
2022-06-10 17:13:45 -04:00
4e7061b2db added MLPerf benchmark reference and updated Criteo sample to use GRPC for stock containers (#630)
* added MLPerf benchmark reference and updated Criteo sample to use GRPC for stock containers

* addressed feedback for BERT sample and did similar changes to Criteo sample

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-10 12:06:25 -07:00
Ivan CheungandGitHub 0250879f65 Added notebook substitution for common case of 1 notebook (#625) 2022-06-10 14:44:43 -04:00
Andrew FerlitschandGitHub 5cee23ae68 Update get_started_with_autoscaling.ipynb 2022-06-09 15:02:28 -07:00
Andrew FerlitschandGitHub d518558b3d Update README.md 2022-06-09 15:01:55 -07:00
Andrew FerlitschandGitHub 5c085c843f feat: notebook on autoscaling (#629)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook

* feat: airflow+vertex

* feat: airflow+vertex

* feat: notebook on autoscaling

* feat: notebook on autoscaling
2022-06-09 14:57:41 -07:00
Michael HuandGitHub 936b434ac4 fix: typo in links in bqml arima notebook (#616)
Notebook used as template had incorrect link format. Apply the same fixes as #514 to the arima notebook.
2022-06-09 17:52:12 -04:00
Michael HuandGitHub 43059c9fd9 fix: pin protobuf version to 3.19.0 (#621) 2022-06-09 12:49:45 -07:00
Andrew FerlitschandGitHub 19f72d426d fix: typos 2022-06-08 11:59:37 -07:00
Andrew FerlitschandGitHub 14ecaf3023 Update README.md 2022-06-08 11:58:18 -07:00
Andrew FerlitschandGitHub 80c93a9b6d feat: airflow with vertex pipelines (#624)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook

* feat: airflow+vertex

* feat: airflow+vertex
2022-06-08 11:55:11 -07:00
Andrew FerlitschandGitHub 06a1b4dc57 Update README.md 2022-06-07 09:48:16 -07:00
Andrew FerlitschandGitHub 4e779eedf1 Update README.md 2022-06-07 09:45:10 -07:00
Andrew FerlitschandGitHub afb341f5fd feat: new R notebook (#618)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook
2022-06-07 09:39:44 -07:00
e34b0fa115 chore(deps): pin dependency protobuf to v (#606)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:13:56 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
6fa0345f25 build(deps): bump tensorflow (#596)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-06-06 18:09:52 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Andrew Ferlitsch
dd43ae6639 build(deps): bump tensorflow (#594)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:08:37 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Ivan CheungAndrew Ferlitsch
840385e0a7 build(deps): bump tensorflow (#592)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:07:48 -07:00
Michael HuandGitHub 9daaf51a1f add bqml arima and vertex forecasting comparison notebook (#581)
Adds a notebook that demonstrates how to compare a Vertex Forecasting model against a BQML ARIMA+ model trained using a first-party GCPC pipeline.
2022-06-06 20:48:30 -04:00
Andrew FerlitschandGitHub 9b2511e54e Update README.md 2022-06-06 13:38:55 -07:00
Andrew FerlitschandGitHub b6674e6540 feat: notebook for co-hosting models (#615)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting
2022-06-06 13:35:47 -07:00
Ivan CheungandGitHub a109cb6d44 fix: Added explanations output to forecasting notebook (#613)
* Added explanations output to forecasting notebook

* Simplified and added XAI

* Fix conflicts

* Ran linter

* Fixed batch prediction request explanation
2022-06-06 10:00:07 -07:00
Ivan CheungandGitHub f730d6b9de Added ability to test a single notebook (#608)
* Added ability to test a single notebook

* Added output_url to table

* Removed ML Ops notebooks
2022-06-06 10:30:31 -04:00
0947f2792d Made some minor changes to Sdk big query custom container training (#522)
* minor changes done

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:58:45 -07:00
dbf19acde4 Adds the updated telecom-subscriber-churn-prediction notebook to official and removes from community (#506)
* updates and adds the telecom-subscriber-churn-prediction notebook to official and removes from the community

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:53:21 -07:00
1aaa833153 Adds manual-scaling config and explanation to the Automl-forecasting-batch notebook in official folder (#514)
* adds manual-scaling config and explanation to the notebook

* ran linter test after installing linter requirement updates

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:50:23 -07:00
c73d995680 Made minor changes to sdk_automl_image_object_detection_batch.ipynb file (#513)
* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:45:55 -07:00
3fe5028724 Malansari automl vision api notebook update (#612)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

* Fixed sample dataset link to point to public version

* Fixed linting issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-04 09:14:23 -07:00
Andrew FerlitschandGitHub 44dd24f910 Update README.md 2022-06-02 15:57:04 -07:00
Andrew FerlitschandGitHub c20a9c4e63 update: AutoML + MLMD (#605)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD
2022-06-02 15:50:05 -07:00
Ivan CheungandGitHub edffdf34b7 Pin protobuf version to avoid broken dependencies. 2022-06-02 17:25:28 -04:00
340c24c5b4 Added custom container explainability notebook (#564)
* Commit for lint

* Commit after name change

* Commit of notebook and CODEOWNERS

Added custom container with xai notebook, and explainable_ai folder in the community folder

* Removed extra copy of file

* Remove extra file

* Updated per review from DPE

* Lint test updates

* linter ran

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-02 12:28:15 -07:00
Andrew FerlitschandGitHub 11f20f3f08 fix: replace BLAH (#600)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH
2022-06-01 11:19:02 -07:00
Andrew FerlitschandGitHub 199b330aa5 Update get_started_automl_mlmd.ipynb 2022-05-31 18:37:05 -07:00
Andrew FerlitschandGitHub 5143db1024 feat: Add DIY MLMD with AutoML (#598)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML
2022-05-31 18:35:23 -07:00
Andrew FerlitschandGitHub 2f0bd3de15 fix: correct reference to service 2022-05-31 13:50:51 -07:00
Andrew FerlitschandGitHub 4d6c541967 feat: XAI + custom server (#597) 2022-05-31 13:31:20 -07:00
Andrew FerlitschandGitHub 5228a5c978 Update README.md 2022-05-31 12:47:16 -07:00
Andrew FerlitschandGitHub c6118bd17d feat: start stage 7 (#591)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine

* feat: LightGBM

* feat: LightGBM

* feat: start stage7

* feat: start stage8
2022-05-31 09:48:49 -07:00
Andrew FerlitschandGitHub d2c9e84af4 Add files via upload 2022-05-26 09:30:17 -07:00
Andrew FerlitschandGitHub fe0a0ff055 Update README.md 2022-05-26 09:30:04 -07:00
Andrew FerlitschandGitHub 40e287245d Delete stage5v2.png 2022-05-26 09:29:50 -07:00
Andrew FerlitschandGitHub c79646a537 Add files via upload 2022-05-26 09:26:24 -07:00
Andrew FerlitschandGitHub e293e1c2fb Update README.md 2022-05-26 09:26:09 -07:00
Andrew FerlitschandGitHub f2ab65bd03 Delete stage4v2.png 2022-05-26 09:25:51 -07:00
Andrew FerlitschandGitHub aa686516d3 Add files via upload 2022-05-25 14:42:01 -07:00
Andrew FerlitschandGitHub 11c80a0251 Update README.md 2022-05-25 14:41:45 -07:00
Andrew FerlitschandGitHub c5e9e5812b Delete stage3v2.png 2022-05-25 14:41:29 -07:00
Andrew FerlitschandGitHub 98b126fa0b Update README.md 2022-05-25 14:34:29 -07:00
Andrew FerlitschandGitHub 55553f9e69 Update README.md 2022-05-25 14:33:56 -07:00
Andrew FerlitschandGitHub 563013c745 Add files via upload 2022-05-25 14:33:10 -07:00
Andrew FerlitschandGitHub fefb9778a7 Update README.md 2022-05-25 14:32:53 -07:00
Andrew FerlitschandGitHub be1831082c Update README.md 2022-05-25 14:11:47 -07:00
Andrew FerlitschandGitHub 9e15ee2e8a Add files via upload 2022-05-25 14:11:21 -07:00
Andrew FerlitschandGitHub ceff7d7271 Delete stage2v2.png 2022-05-25 14:10:51 -07:00
Andrew FerlitschandGitHub df9b5cd6f0 Add files via upload 2022-05-24 16:17:27 -07:00
Andrew FerlitschandGitHub bc57801525 Update README.md 2022-05-24 16:17:06 -07:00
Andrew FerlitschandGitHub 1b403373d3 Delete stage1.png 2022-05-24 16:16:49 -07:00
Andrew FerlitschandGitHub 987fb74ca6 Add files via upload 2022-05-24 15:13:15 -07:00
Andrew FerlitschandGitHub 65a209bc7b Update README.md 2022-05-24 15:12:55 -07:00
Andrew FerlitschandGitHub 16e6d9e90f Delete stage6c.png 2022-05-24 15:12:32 -07:00
Andrew FerlitschandGitHub 7ce6bee763 Delete stage6b.png 2022-05-24 15:12:18 -07:00
Andrew FerlitschandGitHub 6d7ca3eb55 Delete stage6a.png 2022-05-24 15:12:05 -07:00
Andrew FerlitschandGitHub 8e9f205e9a Add files via upload 2022-05-24 14:58:15 -07:00
Andrew FerlitschandGitHub 5fdb6c4368 Update README.md 2022-05-24 14:57:50 -07:00
Andrew FerlitschandGitHub 71ebfd402c Delete stage5.png 2022-05-24 14:57:33 -07:00
Andrew FerlitschandGitHub 6e4ca83531 Update README.md 2022-05-24 14:43:12 -07:00
Andrew FerlitschandGitHub 05793d6a3c Add files via upload 2022-05-24 14:42:39 -07:00
Andrew FerlitschandGitHub 3dc374b7db Delete stage4.png 2022-05-24 14:42:13 -07:00
Andrew FerlitschandGitHub 3ac8a4f617 Add files via upload 2022-05-24 14:22:20 -07:00
Andrew FerlitschandGitHub 21b4b5b063 Delete stage3v3.png 2022-05-24 14:22:11 -07:00
Andrew FerlitschandGitHub 9ffd921ca4 Update README.md 2022-05-24 14:21:38 -07:00
Andrew FerlitschandGitHub 14e6ebbb95 Add files via upload 2022-05-24 14:21:08 -07:00
Andrew FerlitschandGitHub 277b685a39 Delete stage3.png 2022-05-24 14:20:58 -07:00
Andrew FerlitschandGitHub 67e7715ed9 Update README.md 2022-05-24 13:59:19 -07:00
Andrew FerlitschandGitHub bb87900209 Add files via upload 2022-05-24 13:58:51 -07:00
Andrew FerlitschandGitHub 96ebe7286b Delete stage2.png 2022-05-24 13:58:24 -07:00
Andrew FerlitschandGitHub 0b3a5dde09 Add files via upload 2022-05-24 13:57:41 -07:00
Andrew FerlitschandGitHub 17a30360b4 Delete stage2.png 2022-05-24 13:57:24 -07:00
Andrew FerlitschandGitHub b386f51916 Update README.md 2022-05-24 13:40:25 -07:00
Andrew FerlitschandGitHub dd4f40c7f4 Add files via upload 2022-05-24 13:39:51 -07:00
Andrew FerlitschandGitHub d402fc085a Delete stage1.jpg 2022-05-24 13:39:38 -07:00
Andrew FerlitschandGitHub a12b9cd60f Add files via upload 2022-05-24 13:38:11 -07:00
Andrew FerlitschandGitHub bf1032d550 Delete stage1.jpg 2022-05-24 13:38:01 -07:00
Andrew FerlitschandGitHub dea05e1e36 Add files via upload 2022-05-24 13:36:59 -07:00
Andrew FerlitschandGitHub a9f0117c82 Update README.md 2022-05-23 17:09:39 -07:00
Andrew FerlitschandGitHub 83f1fe9ecd Add files via upload 2022-05-23 17:08:06 -07:00
Andrew FerlitschandGitHub 7344274037 Add files via upload 2022-05-23 17:06:53 -07:00
Andrew FerlitschandGitHub e36bfa9a3b Add files via upload 2022-05-23 17:03:27 -07:00
Andrew FerlitschandGitHub 950aa245b8 Update README.md 2022-05-23 16:55:52 -07:00
Andrew FerlitschandGitHub ac47b2e370 Update README.md 2022-05-20 13:01:42 -07:00
Andrew FerlitschandGitHub 6662fc809b Update README.md 2022-05-20 13:00:49 -07:00
Andrew FerlitschandGitHub 12b3171d5e feat: LightGBM (#583)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine

* feat: LightGBM

* feat: LightGBM
2022-05-20 12:58:37 -07:00
Andrew FerlitschandGitHub 579d4751bd Update README.md 2022-05-20 12:41:10 -07:00
Andrew FerlitschandGitHub d4c607323d feat: swivel + ME (#582)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine
2022-05-20 12:39:42 -07:00
nayaknishantandGitHub 3ad30738a7 docs: fixing CODEOWNERS and instructions hyperlinks (#580)
When opening a PR, the CODEOWNERS and instructions hyperlinks throw a 404 error because they point to a URL that has been changed. Fixing these hyperlinks.
2022-05-19 13:20:23 -07:00
Andrew FerlitschandGitHub 119273ae7e Ml.googleapis fix (#579)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:42:55 -07:00
Andrew FerlitschandGitHub 95bc39a685 fix: enable APIs stage5 (#578)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:30:11 -07:00
Andrew FerlitschandGitHub b054104851 fix: enable APIs stage4 (#577)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:23:49 -07:00
Andrew FerlitschandGitHub e0e0cf849a fix: enable APIs stage3 (#576)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:15:29 -07:00
Andrew FerlitschandGitHub c95b3d7088 fix : enable APIs stage2 (#575)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 11:51:49 -07:00
Andrew FerlitschandGitHub 19c2bdb008 fix: enable APIs stage1 (#574)
* fix: enable apis

* fix: enable apis
2022-05-19 11:36:12 -07:00
Andrew FerlitschandGitHub 3c815f3888 update: new template edition (#572)
* fix: new template review updates

* fix: new template review updates

* mport -> import

* fix: dummy code sample required an import

dummy code samples (not otherwise part of template) -- should be self contained since they will be deleted by the template user.

* fix: added install for self-contained code passes ingestion test

* fix: example code (not otherwise part of template) not self-contained.

* fix: continue update so code example is self-contained

* update: numpy already installed in test env
2022-05-19 11:24:19 -07:00
cfcd9b29fd Malansari automl vision api notebook (#573)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-19 11:14:17 -07:00
Ivan CheungandGitHub 4fca7d98b2 Increases notebook concurrency and linted CI files (#512)
* Fixed private pool issues

* Ran linter

* Added worker timeouts

* Tweaked timeout

* Removed gcloud requirement

* Removed unneeded file
2022-05-18 18:58:54 -04:00
Andrew FerlitschandGitHub dea950bcb6 fix: DPE styling (#570)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:32:30 -07:00
Andrew FerlitschandGitHub 4c43755fb6 Mlops 8v3 (#569)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:11:31 -07:00
Andrew FerlitschandGitHub 374942a9e9 fix: DPE-style tuning (#568) 2022-05-18 14:01:13 -07:00
Andrew FerlitschandGitHub 8add418428 Mlops 8v2 (#567)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:46:24 -07:00
Andrew FerlitschandGitHub 9d73cc4574 fix: DPE style tuning (#566)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:29:45 -07:00
Andrew FerlitschandGitHub 5edb4bb1bf fix: DPE-styling (#565)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 12:29:01 -07:00
Andrew FerlitschandGitHub 0e811868d3 fix: links 2022-05-18 11:33:56 -07:00
Andrew FerlitschandGitHub 9efcfa25e8 fix: links 2022-05-18 11:27:11 -07:00
48036cf581 vision api notebook - updated link to open in Vertex AI Workbench (#562)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-18 11:20:39 -07:00
Andrew FerlitschandGitHub 79fd9b4049 Update README.md 2022-05-17 11:05:54 -07:00
Andrew FerlitschandGitHub 46b2181a4e fix: typos in two towers (#563)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers
2022-05-17 11:04:01 -07:00
Andrew FerlitschandGitHub d04f25a8bd Update README.md 2022-05-16 15:13:45 -07:00
Andrew FerlitschandGitHub 9f341c350c fix: two towers (#561)
* fix: two towers

* fix: two towers
2022-05-16 15:11:44 -07:00
Ivan CheungandGitHub f22f97f680 fix: Updated matching engine dependency and fixed cases (#557)
* fix: Updated dependency and fixed cases

* Ran linter

* Renamed to Vertex AI Workbench notebook

* Additional text fixes
2022-05-16 13:06:04 -04:00
Andrew FerlitschandGitHub fe75745d44 feat: WIP: twotowers+matching engine (#560)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine

* feat: wip: twotowers

* feat: wip: twotowers
2022-05-13 14:03:43 -07:00
Andrew FerlitschandGitHub bbc9f1337e Update README.md 2022-05-13 08:56:39 -07:00
Andrew FerlitschandGitHub eb1fa9213a feat: add notebook for matching engine (#559)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine
2022-05-12 15:55:21 -07:00
Mohammad Al-AnsariandGitHub a7033a6527 Updates to visionapi notebook (#556)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting
2022-05-11 11:23:50 -07:00
Andrew FerlitschandGitHub 7e6c2d69c8 update: ModelEval as SDK (#555)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK
2022-05-10 15:33:52 -07:00
Andrew FerlitschandGitHub 1a21b81804 fix: stage5 DPE style (#554)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 14:11:31 -07:00
Andrew FerlitschandGitHub 2bbd520613 fix: stage4 DPE styling (#553)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 13:58:44 -07:00
Andrew FerlitschandGitHub 8285e4ebd1 Mlops 8 (#552)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:56:43 -07:00
Andrew FerlitschandGitHub 859849894e fix: stage3 workbench (#551)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:38:52 -07:00
Andrew FerlitschandGitHub e74dd48ae0 fix: 2nd round workbench (#550)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:12:27 -07:00
Andrew FerlitschandGitHub a14eb71210 fix: check for workbench (#549)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench
2022-05-10 11:37:44 -07:00
Mohammad Al-AnsariandGitHub 0b6a9718ff Added author / reviewer informationAdded sample files (#544)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference
2022-05-09 13:59:59 -07:00
Andrew FerlitschandGitHub 6ac0d8a029 Update README.md 2022-05-09 13:48:00 -07:00
Andrew FerlitschandGitHub 2ee013bcab Delete get_started_nvidia_triton_serving.ipynb 2022-05-09 13:47:18 -07:00
Andrew FerlitschandGitHub 1ebb3f5714 Mlops 8 (#547)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server
2022-05-09 13:46:35 -07:00
Andrew FerlitschandGitHub 11c5134961 Update README.md 2022-05-09 13:40:51 -07:00
Andrew FerlitschandGitHub e328b7268f feat: triton server (#546)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server
2022-05-09 13:38:37 -07:00
Andrew FerlitschandGitHub d297e99e5a Update get_started_with_machine_management.ipynb 2022-05-09 12:20:03 -07:00
Andrew FerlitschandGitHub 48c7a4c82e fix: spelling 2022-05-09 12:15:07 -07:00
Andrew FerlitschandGitHub eb3b52f863 Update README.md 2022-05-09 12:10:40 -07:00
Andrew FerlitschandGitHub 4e58cca127 Update get_started_with_machine_management.ipynb 2022-05-09 12:09:07 -07:00
Andrew FerlitschandGitHub 182a98768f feat: machine resource settings (#545)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings
2022-05-09 12:06:56 -07:00
Andrew FerlitschandGitHub f483447235 Update README.md 2022-05-06 19:07:16 -07:00
Andrew FerlitschandGitHub c59050608b feat: vision api and automl (#543)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data
2022-05-06 19:04:43 -07:00
Andrew FerlitschandGitHub 3b9844f92c update: add co-author (#542)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth

* update: add co-author

* update: add co-author
2022-05-06 15:27:05 -07:00
Andrew FerlitschandGitHub ee301a22f6 clean: remove BLAH 2022-05-06 12:38:30 -07:00
Andrew FerlitschandGitHub b7d16f66aa fix: workbench auth (#541)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth
2022-05-06 10:18:06 -07:00
Andrew FerlitschandGitHub 57aad5b802 fix: compat issue with Vertex AI and TFX Transform (#540)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility
2022-05-05 19:04:13 -07:00
Andrew FerlitschandGitHub 9e311433ba fix: mistakes in tfx notebook (#539)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes
2022-05-05 14:58:04 -07:00
Andrew FerlitschandGitHub 04b310927a Update README.md 2022-05-05 13:36:36 -07:00
Andrew FerlitschandGitHub 2fed3ad014 feat: add TFX pipeline (#538)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX
2022-05-05 13:34:22 -07:00
Andrew FerlitschandGitHub 0ec94e0af6 fix: IS_COLAB (#535)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA
2022-05-04 13:55:11 -07:00
9470be0900 adds the updated service-account code to mlops/stage3/get_started_with_dataproc_serverless_pipeline_components notebook (#529)
* adds the updated service-account setting code to notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:55 -07:00
479a0c6271 adds the updated service-account code to mlops/stage3/get_started_with_automl_pipeline_components notebook (#528)
* adds the updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:13 -07:00
053f9c397f adds the updated service-account code to mlops/stage3/get_started_with_kubeflow_pipelines notebook (#527)
* adds updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:03:39 -07:00
Andrew FerlitschandGitHub 2c82469756 fix: service account 2022-05-03 08:33:17 -07:00
Andrew FerlitschandGitHub fdfc7009d0 fix: correct IS_COLAB (#531)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB
2022-05-02 14:25:08 -07:00
Andrew FerlitschandGitHub 59fcfe137d fix: typo in stage 2022-05-02 14:00:16 -07:00
Andrew FerlitschandGitHub 9b434b32bc feat: more eval examples (#530)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work
2022-05-02 13:19:07 -07:00
fc27cd8628 Added service account fetch code for colab in get_started_with_rapid_prototyping_bqml_automl file (#520)
* made changes

* ran linter test

* added minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:45 -07:00
a62f03c396 Added service account fetch code for colab in get_started_with_custom_training_pipeline_components file (#519)
* made changes

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:08 -07:00
a270439814 Added service account fetch code for colab in get_started_with_bqml_pipeline_components file (#518)
* changes made

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:20:18 -07:00
sudarshan-SpringMLandGitHub a97af4a078 Added service account fetch code for colab in get_started_with_bq_tfdv_pipeline_components file (#517)
* added service account code for colab

* ran linter test

* made changes

* ran linter test
2022-05-02 09:19:29 -07:00
Andrew FerlitschandGitHub d7127cc22f fix: IS_COLAB (#526)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:25:49 -07:00
Andrew FerlitschandGitHub 802ab4edd8 fix: DPE-styling (#525)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:10:19 -07:00
Andrew FerlitschandGitHub ae7f28fb31 fix: DPE-styling updates (#524)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 14:06:59 -07:00
f63e3e6e4c Added colab link and made changes in the code in such a way that docker commands can run on colab environment for the file get_started_vertex_training_pytorch (#508)
* Added colab in the notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-29 11:55:51 -07:00
Andrew FerlitschandGitHub b9bb497ebc fix: IS_COLAB (#523)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 11:54:21 -07:00
Andrew FerlitschandGitHub 4368b9e7f8 feat: GAPIC->SDK for private endpoint (#516)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints
2022-04-28 09:59:49 -07:00
2e9cb5d2cf minor change for 'Get started with dataflow pipeline components' (#500)
* Add minor changes to get_started_with_dataflow_pipeline_components

* minor changes and tested

* remove variable dataflow_wait_op, since not used in other places.

* remove variable dataflow_wait_op, since not used in other places

* removed unused import

* Run linter test

* Add gcloud project set when using colab

* Run linter

* correct anem toColab logo Run in Colab

* run linter

* correct the list of items to remove

* Run linter

* Run liinter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 16:45:20 -07:00
9ec8a93e05 Minor changes has been done to pipelines_intro_kfp (#494)
* minor changes done

* ran linter test

* chnanged the as per review coments

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:42:34 -07:00
3ed8778656 Made few changes to sdk-feature-store (#486)
* Added vertexai notebook

* Ran the linter test

* Made the required changes based on the comments

* Ran linter test again

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:39:03 -07:00
Andrew FerlitschandGitHub bf5e3cf870 fix: delete tmp BQ model (#510)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model
2022-04-27 09:30:35 -07:00
c23215893d minor changes on stage1 ml ops - Get started vertex datasets (#474)
* Add minor changes to get_started_vertex_datasets notebook

* run linter

* Run Linter test

* Add google authentication cell for colab execution

* run linter

* correct the project id definition

* Run linter

* Add project id cell

* run liner

* Added imports that are required

* run linter test

* Add gcloud project set

* Run linter

* add linter run

* Running linter test

* run linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-25 10:11:27 -07:00
Andrew FerlitschandGitHub 1c96f7ca71 fix: notebook run in colab (#505)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker
2022-04-22 18:50:29 -07:00
Andrew FerlitschandGitHub 0d5661835b feat: add docker support in Colab (#504)
* feat: add colab code for docker

* feat: add colab code for docker
2022-04-22 13:54:29 -07:00
fe1a3c0bc9 Adds Colab part and minor changes to ml_ops/stage2/get_started_bqml_training notebook (#491)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

* adds colab part and minor changes

* ran linter test

* retains the newly added code lost in conflicts

* ran linter test

* converts vertex to vertex ai

* ran linter test

* moves deletion of temporary BQ table outside delete_storage condition

* ran linter test

* adds bigquery-storage dependency to the notebook tested on Colab

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 11:09:49 -07:00
82bffb87f1 Made some minor changes to sdk-metric-parameter-tracking-for-locally-trained-models (#480)
* Added to correct path

* Ran linter test

* Made some changes

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 00:05:57 -07:00
sudarshan-SpringMLandGitHub 741c6732f1 Made minor changes to sdk-metric-parameter-tracking-for-custom-jobs file (#479)
* modified file

* modified file

* ran linter test

* deleted file in community folder

* ran linter test

* changed folder name in links

* ran linter test

* resolved comments

* ran linter test

* modified file

* ran linter test
2022-04-22 00:05:07 -07:00
9d8caf7888 Added markup text mentioning the role provided to service account used by notebook instance & provided key-version value while destroying it in notebook get_started_with_cmek_training (#495)
* Changes made to notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 23:37:19 -07:00
e63d354413 Made minor changes to rapid_prototyping_bqml_automl file and moved file from community to official (#496)
* added file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:44:18 -07:00
831c515477 Adding official version for Fraud detection notebook (#321)
* deleted file in community folder

* modified notebook

* ran linter test

* renamed managed_notebooks folder to workbench

* ran linter

* resolved comments

* ran linter test

* pulled new version of branch

* ran linter again

* resolved comments

* ran linter test

* removed %%time and added --user flag to all pip installs

* ran linter test

* added debug statements

* ran linter test

* added verbose

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:07:58 -07:00
Andrew FerlitschandGitHub 06ba5d6804 fix: SaraRob installation updates (#501)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-21 11:37:44 -07:00
0137cd106e adds Colab part and minor changes to ml_ops/stage2/get_started_vertex_experiments notebook in community folder (#493)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:20:29 -07:00
8b3b63d714 Adds Colab part and minor changes to ml_ops/stage2/get_started_automl_training notebook (#492)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-21 09:19:34 -07:00
bf79916f29 Adds Colab part to ml_ops/stage1/get_started_bq_datasets notebook (#490)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

* adds Colab part and minor changes

* ran linter test

* updates the enable apis step in setup project section

* ran linter test

* changes vertex to vertex ai

* ran linter test

* moves temporary BQ table deletion outside the delete_storage condition

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:17:49 -07:00
6bf462f79d Notebook fix to handle GCS outputs and resolve (AutoML Tabular Forecasting notebook error: no row field 'name' #453) (#477)
* notebook fix to handle gcs output

* linter test

* minor bug fix and markup added

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:13:52 -07:00
Andrew FerlitschandGitHub 106cdee495 feat: update model eval metrics for comparison (#498)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-20 19:21:23 -07:00
dfb7301733 Inardini - feature store demo blog review (#484)
* review for blog

* linter code passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:17:17 -07:00
da707b2cbc Made minor changes to custom-tabular-bq-managed-dataset file (#473)
* modified notebook

* modified file

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:07:07 -07:00
873ba9dde9 Made minor changes to get_started_with_rapid_prototyping_bqml_automl file (#459)
* modified file

* made linter changes

* made changes

* linter test issues resolved

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:06:27 -07:00
Andrew FerlitschandGitHub 15c452f39d fix: Issue 451, add db-dtypes to requirements (#458)
* fix: issue 451

* fix: issue 451
2022-04-18 12:14:56 -07:00
Andrew FerlitschandGitHub be7111815b fix: getting SERVICE ACCOUNT 2022-04-18 10:59:44 -07:00
17db1a952b Tabnet - Add serving (#482)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

* Add deployment in Vertex AI

* Add delete the resource

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 12:51:55 -07:00
Andrew FerlitschandGitHub 455143d0f0 Update README.md 2022-04-15 12:26:06 -07:00
Andrew FerlitschandGitHub f0892852cb Update README.md 2022-04-15 12:24:39 -07:00
Andrew FerlitschandGitHub ca48556d0c feat: add tabnet notebook (#483)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example

* feat: add tabnet notebook

* feat: add tabnet notebook
2022-04-15 12:21:51 -07:00
Aleksey VlasenkoandGitHub f961aa3174 Minor updates basing on team feedback (#481) 2022-04-15 10:56:46 -07:00
64c8eca7df Refresh of Distributed Hyperparameter Tuning for Colab (#461)
* notebook refresh from vertex ai sdk project

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 08:49:36 -07:00
b3332c1742 minro changes to get_started_with_hpt_pipeline_components (#465)
* minor changes made to notebook

* ran lintertest

* added coment

* ran lintertest

* made changes sujjested in git review

* ran linter test

* changes done as per review

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-14 17:02:23 -07:00
Aleksey VlasenkoandGitHub b35f697a75 Adding samples for Vertex AI Prediction optimized TensorFlow runtime (#475)
* adding Vertex AI optimized TensorFlow runtime samples

* updated URLs, added code to import benchmark.py

* fixed 'Open in Vertex AI Workbench' links

* final cleanup

* added @vlasesnkoalexey as an owner of notebooks/community/vertex_endpoints/optimized_tensorflow_runtime

* rerun linter
2022-04-14 10:14:27 -07:00
3bc32a1d48 Adds Colab part to the ml_ops/stage3/get_started_with_automl_pipelines notebook (#472)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

* adds Colab part to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:52:06 -07:00
d66f851554 Adds Colab part to the ml_ops/stage3/get_started_with_kubeflow_pipelines notebook (#471)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

* adds colab changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:34 -07:00
d733f107e1 Made minor changes to get_started_with_custom_training_pipeline_components file (#470)
* added colab related content

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:01 -07:00
805e2e1c83 Made minor changes to get_started_with_bqml_pipeline_components file (#469)
* made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:50:18 -07:00
03dc17d9d7 updates ml_ops/stage3/get_started_with_dataproc_serverless_pipelines notebook (adds delete-batch code + adds colab part + updates textual content) in community folder (#464)
* updates: adds delete-batch code  + adds colab part + updates textual content

* sets delete_bucket to False as default

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:49:26 -07:00
a4909f823e Adds changes for Colab support to the ml_ops/stage2/get-started-with-vertex-featstore notebook (#462)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

* adds the colab changes and minor textual changes

* ran linter test

* adds the colab changes to the notebook and minor textual changes

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:48:58 -07:00
e91b259595 Made minor changes to file get_started_vertex_training_xgboost.ipynb (#436)
* modified file

* run linter test

* run in colab

* added coment

* run lintertest

* changed as per review coments

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:08:04 -07:00
14284046e4 Made minor changes to get_started_vertex_tensorboard (#437)
* Adding a notebook

* Ran linter test

* Added Colab

* Ran the linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:07:24 -07:00
59a9a5e6ba Notebook Refresh E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Distributed Training (#434)
* notebook refresh from vertex ai sdk project

* update with linter test changes

* linter fix

* linter issue

* notebook colab workbench links

* linter test

* linter fix

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:06:01 -07:00
Andrew FerlitschandGitHub f3b0a9e0c0 Update README.md 2022-04-11 18:56:52 -07:00
Andrew FerlitschandGitHub 92b572a364 feat: add raw predict example (#468)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example
2022-04-11 18:53:45 -07:00
014be9b530 Made minor changes to get_started_with_data_labeling_2 (#463)
* added colab link and made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:07:13 -07:00
fa675e0082 inardini real time churn feature store demo fixes (#455)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

* name fixes. linter code done. passed.

* fix project id and region

* test done

* format

* linter test done.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:01:27 -07:00
Andrew FerlitschandGitHub 113cbb9709 Update README.md 2022-04-11 14:54:27 -07:00
Andrew FerlitschandGitHub b72bdc8112 Update README.md 2022-04-11 12:31:03 -07:00
Andrew FerlitschandGitHub 0842fa8354 Update README.md 2022-04-11 12:30:38 -07:00
Andrew FerlitschandGitHub 4e4f3f4095 Ml ops 7v6 (#467)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed
2022-04-11 12:16:47 -07:00
Andrew FerlitschandGitHub d014febeb9 Update README.md 2022-04-11 11:37:42 -07:00
Andrew FerlitschandGitHub a3264df643 feat: add BQML + MR example (#466)
* feat: add BQML+MR example

* feat: add BQML+MR example
2022-04-11 11:36:50 -07:00
f0208e3e37 Made minor changes to get_started_with_custom_training_pipeline_components (#456)
* modified file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:37 -07:00
f84e1b9cbc Updates ml_ops/stage3/get-started-kubeflow-pipeline-notebook in the community folder (#449)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:05 -07:00
16b2086031 Made minor changes to get_started_with_bqml_pipeline_components (#444)
* modified notebook

* linter modifications made

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:30:20 -07:00
0e24ba565d Updates ml_ops/stage3/get-started-automl-pipeline-notebook in the community folder (#440)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:37 -07:00
49718b02a5 Made minor changes to get_started_with_bq_tfdv_pipeline_components (#439)
* modified notebook

* linter test issues resolved

* ran linter test

* added colab option

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:03 -07:00
63031ed364 Updates ml_ops/stage2/get_started_vertex_featurestore notebook in community folder. (#426)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:26:57 -07:00
9fd325e25b Made minor changes to file get_started_with_data_labeling (#425)
* modified notebook

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:22:12 -07:00
93af43419c Updates Mlops/stage2/get-started-automl-training notebook in the community folder (#409)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 13:03:29 -07:00
c8f0cdb74a Refresh of Distributed Hyperparameter Tuning Notebook (#454)
* notebook refresh

* linter test

* notebook refresh added corrected cleanup

* linter test

* notebook refresh added corrected cleanup

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 14:07:47 -05:00
19368fe5cc inardini google cloud pipelines dataproc tabular (#445)
* add dataproc components tabular notebook

* add src package

* add codeowner

* linter test done. almost ok except for the flake8 E231. need to follow up with andy

* fix typos based on andy review

* linter test done. review with andy

* hyperparameter_tuning_op fix

* project name

* add delete repo

* fix image

* linter test done

* fix image reference

* fix typo image reference

* minor fixes

* karl fixes

* karl fixes on links

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:10:33 -07:00
6a05e0eb6c inardini real time churn feature store demo (#448)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:21:22 -05:00
40d643f11c Change bq://bigquery-public-data:iowa_liquor_sales_forecasting.2021_sales_predict for PREDICTION_DATASET_BQ_PATH (#423)
Co-authored-by: Jungwoon Lee <jungwoonlee@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 09:10:10 -05:00
Andrew FerlitschandGitHub 72009cd21b fix: misspelling of BigQuery 2022-04-06 20:15:07 -07:00
Andrew FerlitschandGitHub cc9a50f40b Update get_started_with_vertex_private_endpoints.ipynb 2022-04-06 19:56:51 -07:00
Andrew FerlitschandGitHub e3135e8875 Update README.md 2022-04-06 17:42:45 -07:00
Andrew FerlitschandGitHub 59eb297151 feat: add notebook for private endpoints (#450)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: notebook for private endpoints

* feat: notebook for private endpoints
2022-04-06 17:41:10 -07:00
32b0c1c89e Mco mvmm (#420) - move model monitoring notebook from community to official
* license tweak

* remove unused import json

* fixed a missing import

* add sleep(300) to test my theory

* add missing newline

* put sleep behind a conditional

* revert new notebook name to previous name for compatibility with extant links

* fix quoting syntax error

* reformatted due to relint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-06 22:37:53 +01:00
3328a8190d Adding sample to use (auto) scaling config for Feature Store online store (#367)
* Add example using auto scale

* Format with nbqa

* Complete sentence

* Give the sample for CreateFeaturestoreRequest only, instead of actual call to create FS to avoid duplicate resource or extra cleanup.

* Remove unused import

* Remove version pinning

* Add try block to avoid error when test was not cleanup properly.

* Lint

* Fix import

* Merge print lro result with the call in the same try block

* Fix typo

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-04-05 17:02:49 -07:00
7aa6acdca6 fix UnboundLocalError in TF-Agents Bandits Guide (#446)
In "Step by Step Guide to Building Reinforcement Learning Applications using Vertex AI", the replay_buffer was unbound if training_data_spec_transformation_fn was provided to the train() function

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-05 16:30:40 -05:00
Andrew FerlitschandGitHub 7926ff1264 Update README.md 2022-04-05 11:10:12 -07:00
Andrew FerlitschandGitHub 67b926dfb4 feat: add notebook for FastAPI server (#447)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server
2022-04-05 11:08:09 -07:00
327f9e7a4b Fix typo in notebook heading. (#443)
* Fix typo in notebook heading.

* Fix linting issues.

Co-authored-by: Win Woo <wwoo@google.com>
2022-04-05 08:43:47 -05:00
Andrew FerlitschandGitHub 8be220d089 fix missing + 2022-04-04 14:40:27 -07:00
Andrew FerlitschandGitHub 2dad40f49f bucket setting fine-tuning 2022-04-04 14:39:45 -07:00
Andrew FerlitschandGitHub 99b724028f Update README.md 2022-04-04 13:51:43 -07:00
Andrew FerlitschandGitHub 909fbcb0d4 feat: notebook for TF Serving binary (#442)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions

* feat: notebook for TF Serving

* feat: notebook for TF Serving
2022-04-04 13:49:39 -07:00
Andrew FerlitschandGitHub 351fc3e4d3 fix: remove unused print_op 2022-04-04 09:05:33 -07:00
252b3d31a3 Inardini bqml components pipeline official blog (#416)
* bqml pipeline notebook for official blog

* add notebook to CODEOWNERS

* add author name

* requirements commenting fix

* linter test done

* unpin the maintenance version for kfp

* fix: install conflicts

* Update google_cloud_pipeline_components_bqml_text.ipynb

* add karl fix

* lint test done

* add andy fixes

* linter test done

* flip order of the special METADATA fix

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
2022-04-04 09:00:17 -07:00
Andrew FerlitschandGitHub bfdfaab38c Update README.md 2022-04-01 16:11:28 -07:00
Andrew FerlitschandGitHub 21a5963f84 feat: notebook for tf serving functions (#438)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions
2022-04-01 16:09:39 -07:00
9452249dce Added a new section called "Grant Dataproc roles to the Service Account" (#433)
* Ml ops 7v2 (#429)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* Update README.md

* Add files via upload

* Update README.md

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* feat: new notebook on endpoints (#430)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* wrong location

* Create README.md

* Update README.md

* Update README.md

* Update README.md

* Update README.md

* fix: links

* fix: title

* fix: example for reconfiguring the traffic split (#431)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* Add section on granting Dataproc IAM roles.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Win Woo <wwoo@google.com>
2022-03-31 20:14:16 -07:00
Andrew FerlitschandGitHub 49a9df058f fix: example for reconfiguring the traffic split (#431)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint
2022-03-31 15:27:27 -07:00
Andrew FerlitschandGitHub f99b7e5d17 fix: title 2022-03-31 12:28:15 -07:00
Andrew FerlitschandGitHub ac03c57a94 fix: links 2022-03-31 12:27:47 -07:00
Andrew FerlitschandGitHub 2e4cf648c5 Update README.md 2022-03-31 12:27:01 -07:00
Andrew FerlitschandGitHub f000baa328 Update README.md 2022-03-31 12:26:35 -07:00
Andrew FerlitschandGitHub 113f89604a Update README.md 2022-03-31 12:26:01 -07:00
Andrew FerlitschandGitHub 5019a004ce Update README.md 2022-03-31 12:25:42 -07:00
Andrew FerlitschandGitHub a577f3844a Create README.md 2022-03-31 12:25:31 -07:00
Andrew FerlitschandGitHub 88c7f0f690 wrong location 2022-03-31 12:24:20 -07:00
Andrew FerlitschandGitHub a18792499a feat: new notebook on endpoints (#430)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue
2022-03-31 12:23:22 -07:00
Andrew FerlitschandGitHub 0b5fc8bb3c Delete stage6b.png 2022-03-30 19:34:52 -07:00
Andrew FerlitschandGitHub 1f77410fda Add files via upload 2022-03-30 19:34:31 -07:00
Andrew FerlitschandGitHub 45fb57f29c Delete stage6c.png 2022-03-30 19:34:11 -07:00
Andrew FerlitschandGitHub 3380b394eb Delete stage6b.png 2022-03-30 19:34:03 -07:00
Andrew FerlitschandGitHub 1286cc5044 Add files via upload 2022-03-30 19:33:20 -07:00
Andrew FerlitschandGitHub 1ce1af791c Delete stage6c.png 2022-03-30 19:31:24 -07:00
Andrew FerlitschandGitHub 2587e329ee Delete stage6b.png 2022-03-30 19:31:15 -07:00
Andrew FerlitschandGitHub 37d4816051 Update README.md 2022-03-30 19:30:19 -07:00
Andrew FerlitschandGitHub d9dff882b8 Add files via upload 2022-03-30 19:29:41 -07:00
Andrew FerlitschandGitHub 26cc2c5278 Update README.md 2022-03-30 19:21:49 -07:00
Andrew FerlitschandGitHub 69aff1bdc4 Ml ops 7v2 (#429)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:20:41 -07:00
Andrew FerlitschandGitHub 567994f2b1 fix: add missing details to objective in endpoint notebooks (#428)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:16:02 -07:00
Andrew FerlitschandGitHub e316c7b8aa Update README.md 2022-03-30 17:31:59 -07:00
Andrew FerlitschandGitHub c07a059a8b Update README.md 2022-03-30 17:30:46 -07:00
Andrew FerlitschandGitHub 7b4bbffc41 feat: add endpoint notebook (#427)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example

* feat: add endpoint notebook

* feat: add endpoint notebook
2022-03-30 15:44:54 -07:00
bdc011ef34 Made some minor changes to get_started_vertex_training_pytorch (#406)
* Added notebook

* Ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-30 08:21:22 -05:00
Andrew FerlitschandGitHub 44ea0d7c61 Update README.md 2022-03-28 17:00:01 -07:00
Andrew FerlitschandGitHub aa950e5ee4 feat: add TFHub model example (#422)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example
2022-03-28 16:57:04 -07:00
Andrew FerlitschandGitHub 247906e50e fix: WORKDIR in Dockerfile 2022-03-28 15:52:28 -07:00
81b2493a44 Made minor changes to get_started_vertex_training_r (#417)
* addd file

* modified file

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-28 13:26:54 -07:00
WhiteSource RenovateandGitHub 97b0edb222 chore(deps): update dependency black to v22.3.0 (#421) 2022-03-28 14:23:25 -05:00
sudarshan-SpringMLandGitHub f0a9e4b9fe added mlops folder to tested_folders file (#418) 2022-03-28 10:37:21 -05:00
Andrew FerlitschandGitHub f35bbcaec5 update: details on dsl.Condition (#415)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition
2022-03-26 09:51:01 -07:00
Andrew FerlitschandGitHub 2822061dc9 Update README.md 2022-03-25 16:00:46 -07:00
Andrew FerlitschandGitHub be481c8d17 feat: add data labeling notebook (#414)
* feat: add data labeling notebook

* feat: add data labeling notebook
2022-03-25 15:56:22 -07:00
Andrew FerlitschandGitHub 605a972122 fix: testing issues (#413)
* fix: testing issues

* fix: testing issues
2022-03-25 13:26:53 -07:00
Andrew FerlitschandGitHub 66d98d9fe7 fix: testing issues (#412)
* fix: test failures

* fix: test failures
2022-03-25 10:58:39 -07:00
Krishna Chaitanya MovvaandGitHub 6445ed37c9 Updates the Mlops/stage2/ get-started-vertex-experiments notebook in the community folder (#410)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test
2022-03-25 10:52:21 -05:00
Andrew FerlitschandGitHub ca745aeee8 fix: better cleanup (#407)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook

* fix: better cleanup

* fix: better cleanup
2022-03-24 18:58:43 -07:00
f806b4927b Adds updated Mlops/stage1/get-started-bq notebook to the community folder (#392)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:51 -05:00
2942eb5d7f minor changes on Sdk automl tabular regression online bq1 (#369)
* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* Fix Bucket name variable

* run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:30 -05:00
2a5d6650ee Adds updated Mlops/stage2/get-started-bqml-training notebook to the community folder (#397)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:11:01 -05:00
Andrew FerlitschandGitHub 43e971f57a Update README.md 2022-03-24 11:38:17 -07:00
Andrew FerlitschandGitHub 785779613b feat: add dataproc notebook (#405)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook
2022-03-23 15:43:53 -07:00
Andrew FerlitschandGitHub 481193f0ca cleanup: delete created resources in the pipeline (#404)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline
2022-03-23 14:06:58 -07:00
Karl WeinmeisterandGitHub 2cb3cccd14 Fix: Linting issues in two tower notebook (#402) 2022-03-22 16:08:12 -05:00
7c16766994 minor changes in sdk automl image object detection batch (#370)
* Add minor changes to automl image object detection

* run linter

* Correct the milli nodes hours

* fix errors

* fix getenv

* Run linter

* remove tabular notebook, wrongly added

* Correct the bucket varible and minor changes to text

* Run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-22 13:18:27 -07:00
Andrew FerlitschandGitHub 448d18deca update: for official (#401)
* update: for official

* update: for official
2022-03-22 09:26:34 -07:00
97022b0733 Feat: Add Pluto on Workbench tutorial (#399)
* Initial commit

* Undo master commit

* Initial commit

* Update CODEOWNERS

* Add links to resolve PR comments

Co-authored-by: Ward K Harold <wkh@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 10:10:46 -05:00
c2a3e2d4cd deprecate: gapic XAI notebooks replaced by SDK notebooks (#394)
* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 09:46:47 -05:00
manuelamunateguiandGitHub b2dfcf17c8 E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Training for Scikit-Learn (#398)
* notebook refresh

* linter test after refresh
2022-03-22 09:37:09 -05:00
Andrew FerlitschandGitHub d061f09281 fix: replace os.environ with os.getenv - 2nd batch (#396)
* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv
2022-03-19 12:02:47 -05:00
daa64efd40 fix: replace os.environ with os.getenv (#393)
* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-18 16:44:34 -05:00
Andrew FerlitschandGitHub a37deabe27 Update README.md 2022-03-18 13:15:34 -07:00
Andrew FerlitschandGitHub 6009ef0def Update README.md 2022-03-18 13:14:34 -07:00
Andrew FerlitschandGitHub edc644b0d0 Update README.md 2022-03-18 13:13:15 -07:00
Andrew FerlitschandGitHub 1297af8baf Create README.md 2022-03-18 13:11:38 -07:00
Andrew FerlitschandGitHub b8b1b6675b Update README.md 2022-03-18 13:09:51 -07:00
Andrew FerlitschandGitHub 7d3b7abc44 fix: review updates (#395)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl

* review: edits per Erwin review

* review: edits per Erwin review
2022-03-18 12:09:53 -07:00
Rajesh ThallamandGitHub 9a572f298e [community-content] Notebook to demo NVIDIA Triton Inference Server on Vertex AI Prediction (#391)
* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Fixes based on feedback to NVIDIA Triton on Vertex AI Prediction community notebook
2022-03-18 11:31:01 -05:00
b53ca9e678 Tabnet (#375)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-17 17:20:01 -05:00
Andrew FerlitschandGitHub 9aceec161a Update README.md 2022-03-17 14:50:24 -07:00
Andrew FerlitschandGitHub 98b186ed55 feat: notebook for bqml+automl combined (#390)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl
2022-03-17 14:46:29 -07:00
sudarshan-SpringMLandGitHub f23ee1b5a8 Made small changes to Get started vertex vizier notebook (#389)
* modified notebook

* ran linter test

* modified notebook changed copyright licence year

* ran linter test
2022-03-17 10:03:19 -05:00
c6d779f1fc Featurestore colab update (#387)
* update featurestore colab comment

* delete some changes

* delete some changes 2

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-16 21:31:22 -05:00
Andrew FerlitschandGitHub 8908b27b08 feat: finish CPR notebook (#388)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook
2022-03-16 14:00:03 -07:00
Andrew FerlitschandGitHub 8947c9b116 feat: more CPR (#385)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook
2022-03-15 11:56:29 -07:00
Andrew FerlitschandGitHub 9464caac6e Update README.md 2022-03-14 17:40:15 -07:00
Andrew FerlitschandGitHub 98ce91c575 feat: add CPR notebook (#384)
* feat: add CPR notebook

* feat: add CPR notebook
2022-03-14 17:38:47 -07:00
Andrew FerlitschandGitHub 07f8feda3d Update README.md 2022-03-14 11:19:31 -07:00
Andrew FerlitschandGitHub a4e0496ff5 feat: CMEK training (#383)
* feat: add FS from panda

* feat: add FS from panda

* feat: add CMEK example

* feat: add CMEK example
2022-03-14 11:15:35 -07:00
cf162c02c8 chore(deps): update dependency pyupgrade to v2.31.1 (#381)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:34:58 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
831aae94df build(deps): bump pillow (#378)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:33:36 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
3fd9f28778 build(deps): bump pillow (#379)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:32:20 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a656e8e2a8 build(deps): bump pillow (#380)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-03-14 09:30:19 -05:00
Morgan DuandGitHub 2f02152703 fix: pip install google-cloud-aiplatform (#376) 2022-03-10 12:00:08 -06:00
9d08f8ce67 Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components (#372)
* Using BQML 1st-party components and 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML components and upgrade to 1.0.0 of GCPC

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:34:12 -06:00
ec6d508793 adds automl-text-sentiment-analysis-online notebook (#293)
* adds automl-text-sentiment-analysis-online notebook

* adds the cleaned up automl-text-sentiment-analysis notebook after running linter test

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* deletes the source file from the community/sdk folder

* updates the colab, git & workbench links in the notebook

* ran linter test

* updates the license year to 2022 and simplifies the clean-up step for bucket-deletion

* ran linter test

* adds TESTING env condition while deleting the buckets

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:09:10 -06:00
WhiteSource RenovateandGitHub 772e35ea75 chore(deps): update dependency nbqa to v1.3.1 (#374) 2022-03-09 08:24:16 -06:00
Andrew FerlitschandGitHub 1d28f886c8 feat: add example of FS values from dataframe (#373)
* feat: add FS from panda

* feat: add FS from panda
2022-03-08 17:44:59 -08:00
Andrew FerlitschandGitHub d3dc8aeb9a fix: missing create dataset schema (#371)
* fix: missing dataset create

* fix: missing dataset create
2022-03-07 11:53:39 -08:00
WhiteSource RenovateandGitHub a07d762934 chore(deps): update dependency nbqa to v1.3.0 (#368) 2022-03-07 09:53:42 -06:00
Andrew FerlitschandGitHub 85ac9e127d update: v1 (#366)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* update: v1

* update: v1
2022-03-04 17:47:56 -08:00
Gal ZahaviandGitHub 011c2823ff Update CODEOWNERS (#361) 2022-03-04 22:43:10 +02:00
Karl WeinmeisterandGitHub f28a94f03f docs: Add visualization of repo structure to README.md (#364) 2022-03-04 12:46:26 -06:00
5ecfc80cb9 Adds minor changes(license year and clean-up step) to Sdk automl video action recognition batch notebook (#355)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

* updates the license year to 2022 and simplifies the lean-up step for bucket created

* ran linter test

* removes the file from the community folder

* adds the TESTING env condition while deleting the buckets

* ran linter test successfully

* adds TESTING env condition while deleting the bucket

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-04 12:44:39 -06:00
Andrew FerlitschandGitHub e5e36ba050 fix: upgrades to v1 (#360)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 20:05:36 -08:00
Andrew FerlitschandGitHub 0ad9116d6a fix: v1 upgrades (#359)
* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 17:49:45 -08:00
0516032443 Update CODEOWNERS (#354)
* Update CODEOWNERS

* Update CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:23:19 -06:00
95d211c90f Fixing minor issues in sdk_automl_text_entity_extraction_online.ipynb (#329)
* modified colab,github,vertexAI links and added vertex logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:17:48 -06:00
12d6a75ef7 Fixing minor issues in sdk_automl_video_object_tracking_batch.ipynb (#328)
* changed master to main for links and added vertex AI logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:07:50 -06:00
Andrew FerlitschandGitHub 06153dc373 Update README.md 2022-03-02 11:45:01 -08:00
Andrew FerlitschandGitHub 02afa91fc3 Ml ops 6v3 (#352)
* fix: eval comp improvement

* fix: eval comp improvement

* feat: add to KFP get started
2022-03-02 10:38:42 -08:00
Karl WeinmeisterandGitHub c8b212789f Revert "ci: Apply filter to format_and_lint_job (#348)" (#351)
This reverts commit 95256d3fcf.
2022-03-02 09:44:03 -06:00
Karl WeinmeisterandGitHub 95256d3fcf ci: Apply filter to format_and_lint_job (#348)
* ci: Apply filter to format_and_lint_job

Only run when PR contains a notebook file

* Minor fix
2022-03-02 09:29:38 -06:00
Karl WeinmeisterandGitHub 8a6d174c99 Create README.md for notebooks folder 2022-03-01 19:44:41 -06:00
WhiteSource RenovateandGitHub d36cf7f662 chore(deps): update actions/setup-python action to v3 (#337) 2022-03-01 19:04:32 -06:00
WhiteSource RenovateandGitHub 1b02a542c8 chore(deps): update actions/checkout action to v3 (#347) 2022-03-01 19:02:39 -06:00
Ivan CheungandGitHub 45430bb010 Fixed minor issues (#345) 2022-03-01 14:56:50 -06:00
Ivan CheungandGitHub be2a139ade Delete notebooks/community/feature_store/assets directory 2022-02-28 20:21:17 -05:00
70d77b24f6 feature store e2e with assets (#343)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)

* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>

* Added files in their old folder

* Deleted unneeded file

* Ran linter

* Fixed CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-28 19:23:15 -05:00
Ivan CheungandGitHub 50c25d6d7b Revert "A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)" (#338)
This reverts commit 5bcdc0bc64.
2022-02-28 11:01:39 -05:00
5bcdc0bc64 A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-28 07:47:26 -08:00
eff0f95b58 Automl links fix (#330)
* fixing links to open notebook - main and images

* linter test changes

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:57:25 -06:00
50b53d31bd Jfacevedo endpoints tfhub obj detect (#319)
* Deploying TF Hub object detection model using Vertex endpoints

* Add user to codeowners

* fix path in CODEOWNERS

* clear all outputs

* run linter

* manual lint fix

* fix more linting errors

* order imports in alphabetical order

* run linter

* made changes requested on feedback

* automate fetching endpoint model id

* fix hardcoded value in bash command

* generalize region endpoint and project in bash cell

* retrieve endpoint and model ids programatically

* fix formatting

* run linter

* Remove pipfile

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:55:54 -06:00
Andrew FerlitschandGitHub b5a56852f3 fix: automl eval component improvement (#333)
* fix: eval comp improvement

* fix: eval comp improvement
2022-02-25 12:07:06 -08:00
b7486e34ad Sdk automl video action recognition batch (#310)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 11:31:19 -06:00
3edc5f1425 Notebook template (#326)
* modified vertex AI link

* minor change

* changed master to main and added vertex logo

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 10:16:34 -06:00
65b4b73cb5 Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook (#288)
* Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook.ipynb

* format with linter

* add import for tensorflow when in the testing environment

* linter

* fix dependency issues for testing env

* address comments

* eval component  does not output gcp_resources yet, still in experimental

* added location to aip.init

* add deletion for model and batch prediction jobs

* typo, missed a comma.

* linter

* Remove tensorflow import + use gsutil to check if artifacts exist.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 15:36:35 -08:00
Ivan CheungandGitHub 186c08e8c3 Update sdk_matching_engine_for_indexing.ipynb 2022-02-24 17:47:53 -05:00
Ivan CheungandGitHub 7721aa0def Added matching engine with SDK notebook (#327)
* Matching engine

* Added notebook

* Updated CODEOWNERS

* Fixed links

* Added logo

* Renamed Workbench
2022-02-24 14:57:16 -05:00
4987c60e03 updating gcloud usage because a flag was renamed (#320)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 09:33:33 -06:00
Andrew FerlitschandGitHub cd845f7fdd feat: start on model eval notebook (#325)
* fix: bqml export format

* fix: bqml export format

* feat: start on custom model eval

* feat: start on custom model eval
2022-02-23 12:56:01 -08:00
Andrew FerlitschandGitHub 9e84d9e782 fix: bqml doc for exporting model (#324)
* fix: bqml export format

* fix: bqml export format
2022-02-23 12:44:43 -08:00
nayaknishantandGitHub 23c7fcc97f fix: changed bucket URL from pantheon to console (#323)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console
2022-02-23 13:17:12 -06:00
e4024efbc7 feat: add community notebook for Vertex AI SDK Feature Store with Pandas (#311)
* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* fix: lint

* fix: addressed feedback

* fix: format

* fix: lint

* Linted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-23 10:22:28 -08:00
Ivan CheungandGitHub c4d53108af Matching Engine: Updated location for data (#322)
Switched to gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5
2022-02-23 12:03:48 -05:00
be8fe3564d Sdk automl video classification batch (#295)
* notebook refresh from vertex ai sdk project batch 1

* successfully ran linter test

* removed global variable import file

* update with linter test changes

* removing community version of dk_automl_video_classification_batch.ipynb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:11:42 -08:00
1f95775057 Sdk automl text entity extraction online (#283)
* added notebook

* ran linter

* fix aip not defined error

* ran lint

* resolved git comments

* ran linter

* deleted file in community folder and removed globals

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:07:55 -08:00
f2a4dd875e Sdk automl video object tracking batch (#281)
* added notebook

* changed folder

* reinstalled linter

* ran linter

* pulled new changes and merged

* resolved comments

* resolved comments

* ran linter

* deleted file in community folder and removed globals in file

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-22 21:06:52 -08:00
Aaron DietzandGitHub 67dd2300c8 updating text (#309) 2022-02-22 17:17:00 -05:00
Aaron DietzandGitHub b5391b06b4 Pricing optimization update (#308)
* updating text

* rename

* rename
2022-02-22 17:13:16 -05:00
Aaron DietzandGitHub 54f2c71c13 updating text (#307) 2022-02-22 16:51:54 -05:00
Aaron DietzandGitHub 6697900126 updating text (#306) 2022-02-22 16:39:46 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
9ff3400b44 build(deps): bump tensorflow (#316)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 13:01:06 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
3ff0726ebf build(deps): bump tensorflow (#315)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 08:54:19 -06:00
Amy WuandGitHub c96c939dfe Fix RL samples (#270)
* Update step_by_step sample

* Update mlops sample and fix worker_pool_specs issue for thr trainer component

* Fix lint

* Fix lint

* Fix lint

* Fix import order

* Fix nbfmt

* Update component.yaml

* Format notebook

* Update component.yaml url

* Lint
2022-02-17 16:37:52 -08:00
719cf280c9 Updating markdown text to meet higher standard (#305)
* Updating markdown text to meet higher standard

* formatted nb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-17 17:45:15 -06:00
4ec6e2df04 [community-content] PyTorch on Google Cloud Vertex AI - Fixes based on feedback (#290)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

* PyTorch on Vertex - fixes based on review

* PyTorch on Vertex - linter fixes

* PyTorch on Vertex - fixes based on feedback

* PyTorch on Vertex - fixes based on feedback

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 17:41:48 -06:00
031a9190c3 automl-tabular-classification.ipynb: Added missing code and removed unneeded text (#255)
* Added missing code and removed unneeded text

* Ran linter

* Ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 08:03:16 -08:00
5204dcf327 update training and batch predict notebook with importer (#303)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:56 -08:00
cad623ef84 update hp tuning sample to use importer (#302)
* update hp tuning sample to use importer

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:23 -08:00
a59f58f8b6 Use importer for the bqml (#299)
* Use importer for the bqml

* Update get_started_with_bqml_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:00:44 -08:00
nayaknishantandGitHub d89c613f5d moving REGION up (#300)
* moving REGION up

* moving REGION up and csv file name
2022-02-16 17:11:46 -08:00
Andrew FerlitschandGitHub fa265ddb2f feat: fix for sklearn XAI (#301)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1

* fix: XAI for sklearn

* fix: XAI for sklearn
2022-02-16 17:00:16 -08:00
ec3dd04935 SDK Featurestore notebook (#284)
* SDK Featurestore notebook

* fixed issues, tried to make notebook more readable, style

* removed previous notebook

* moved sdk-feature-store to community (for now)

* made fixes

* moved BQ output table cells down

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-02-16 16:04:43 -08:00
Andrew FerlitschandGitHub 0c83e81410 fix: 0.3.0 breaking change 2022-02-16 14:13:57 -08:00
Andrew FerlitschandGitHub 7808a843cc fix: breaking 0.3.0 change 2022-02-16 14:02:36 -08:00
Andrew FerlitschandGitHub 615d7706af fix: breaking change in 0.3.0 2022-02-16 13:53:35 -08:00
Ivan CheungandGitHub f05ca4d06a Added project to BQ client instantiation (#285) 2022-02-16 16:27:08 -05:00
Andrew FerlitschandGitHub cb4145e2b6 test: fix for testing (#298)
* test: fixes for testing

* test: fixes for testing
2022-02-16 11:23:45 -08:00
6917c9aa7b adding initial sample notebook for Tensorboard (#286)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 09:45:01 -08:00
Andrew FerlitschandGitHub c1d2451656 feat: update to v1 (#294)
* feat: update to v1

* feat: update to v1

* feat: update to v1

* feat: update to v1
2022-02-16 09:35:41 -08:00
Ivan CheungandGitHub c41ec1fabd Cleaned up cleanup section (#291) 2022-02-16 10:28:42 -05:00
Ivan CheungandGitHub 273c91882e Delete setup_env.md 2022-02-15 20:45:06 -05:00
Ivan CheungandGitHub ad6b5e5830 Update test_notebook_vm.txt 2022-02-15 18:17:11 -05:00
Ivan CheungandGitHub d441eb9d7a Update test_notebook_vm.txt 2022-02-15 18:14:37 -05:00
Andrew FerlitschandGitHub 139d805c9f feat: update to v1 (#292)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1
2022-02-15 11:20:22 -08:00
Andrew FerlitschandGitHub 783347fc8e feat: update FS notebook to use SDK (#287)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK
2022-02-14 13:21:28 -08:00
6d722d081d Fix links (#274)
* Fixes and renames link to launch automl-text-classification.pynb in Vertex AI Workbench

* Fixes and renames link to launch sdk_automl_tabular_forecasting_batch.pynb in Vertex AI Workbench

* Fixes links for launching notebook in Vertex AI Workbench for Explainable AI samples

* Fixes link for launching notebook in Vertex AI Workbench for model monitoring sample

* Fixes links to launch pipelines notebook samples

* Fixed lint problem in automl-text-classification.ipynb

* Autofixed lint errors

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-14 11:48:41 -05:00
Andrew FerlitschandGitHub 33a8c6ca0e feat: add create component example (#279)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example
2022-02-10 14:23:22 -08:00
Karl WeinmeisterandGitHub ae043400f5 Add survey to README.md (#272) 2022-02-10 14:52:33 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
e41f96b31f build(deps): bump tensorflow (#275)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:37:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
7220f15158 build(deps): bump tensorflow (#276)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:33:59 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
b8d7eaa767 build(deps): bump tensorflow (#278)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:31:20 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a612b463a8 build(deps): bump tensorflow (#277)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-10 09:16:10 -06:00
Andrew FerlitschandGitHub 493e7e81b5 Update README.md 2022-02-09 10:19:58 -08:00
Andrew FerlitschandGitHub b6cf0dbefd feat: XAI with sklearn (#273)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn
2022-02-09 10:17:16 -08:00
Brian KangandGitHub 5d5c08f9e7 Pytorch lightning sdk example - Missed Notebook added (#269)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Revert "Adjust Tensorboard to TensorBoard"

This reverts commit 9aac52e358b4ccc27a9a5a9e3bc5ef3305553462.

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard and and run lint
2022-02-08 16:36:30 -08:00
Andrew FerlitschandGitHub bfdfac0f81 feat: XAI notebook (#271)
* feat: get started XAI

* feat: get started XAI
2022-02-08 14:13:05 -08:00
Andrew FerlitschandGitHub 9c72b7e3e7 Update README.md 2022-02-08 12:57:22 -08:00
Andrew FerlitschandGitHub 46519e5c64 Update README.md 2022-02-08 12:26:57 -08:00
Brian KangandGitHub 0ff961e203 Pytorch lightning sdk example (#268)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model
2022-02-07 17:36:40 -08:00
Andrew FerlitschandGitHub cbc17c6832 feat: use gcsfuse (#265)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU

* feat: use gcsfuse

* feat: use gcsfuse
2022-02-04 11:17:51 -08:00
Andrew FerlitschandGitHub 93e5b15cba Update README.md 2022-02-04 11:09:31 -08:00
Andrew FerlitschandGitHub 081e65d076 Update README.md 2022-02-04 10:09:45 -08:00
Ivan CheungandGitHub 4ab2cfb713 feat: Added test_notebook_vm.txt to only test fast-running notebooks. Also fix private_pool not being used for tests. (#248)
* feat: Added test_notebook_vm.txt

* Propagate private pool to child builds

* Fixed workerpool issue

* Removed private pool requirement

* Added default pool

* Fixed private pool region issue

* Added comment

* Made private_pool_id arg optionally present

* Fixed when private pool is optional

* Fix regional issue bug

* Fixed pandas requirement

* Removed flaky notebook
2022-02-03 15:48:40 -05:00
Andrew FerlitschandGitHub a73335c0af feat: add batch and TPU (#262)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU
2022-02-02 17:45:31 -08:00
0f3e257773 Pricingoptimization (#249)
* added notebook

* ran lint

* updated main

* ran lint

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-02 13:25:41 -05:00
Andrew FerlitschandGitHub 57d734d84f fix: spelling (#260)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling
2022-02-01 17:07:10 -08:00
Andrew FerlitschandGitHub 07f2e9c999 Update README.md 2022-02-01 12:15:31 -08:00
Andrew FerlitschandGitHub 401883cae3 feat: add R notebook (#259)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook
2022-02-01 12:11:26 -08:00
7bc92e1e3c Update google_cloud_pipeline_components_automl_images.ipynb (#252)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-02-01 13:33:22 -06:00
de5f8b0653 Removed unneeded lines in linter (#257)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-01 12:19:19 -05:00
cfa73ed53b chore(deps): update dependency black to v22 (#254)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-31 13:50:57 -06:00
Andrew FerlitschandGitHub 67370bb1c7 Update README.md 2022-01-31 10:39:28 -08:00
Andrew FerlitschandGitHub f60593255a feat: add Pytorch notebook (#256)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook
2022-01-31 10:38:28 -08:00
Andrew FerlitschandGitHub c6f9b97615 test: rm caching of components (#247)
* fix: testing

* fix: testing

* fix: not installing pandas
2022-01-31 13:33:18 -05:00
Andrew FerlitschandGitHub 6161a394c2 fix: predict on exported BQML model (#250)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML
2022-01-27 10:35:20 -08:00
ivanmkc b35cd42015 Added exception check for deletion method 2022-01-27 11:54:29 -05:00
Ivan CheungandGitHub 5e323993db [WIP] Relax requirements for DLVM's (#238)
* Update requirements.txt

* Relax all CI requirements
2022-01-26 16:47:09 -05:00
Andrew FerlitschandGitHub f1623e419e Update README.md 2022-01-26 12:10:16 -08:00
Andrew FerlitschandGitHub a3047fb1bb feat: xgboost notebook (#246)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training
2022-01-26 12:09:07 -08:00
Karl WeinmeisterandGitHub b4d02f486e Update CODEOWNERS with new community blog post (#244) 2022-01-26 09:16:48 -08:00
9e24893b9b feat: Add sentiment analysis notebook (#195)
* added notebook

* ran lint

* resolved comments

* ran lint

* resolved comments

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-26 08:56:40 -06:00
47dec6ecef chore(deps): update dependency pyupgrade to v2.31.0 (#241)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:53:32 -06:00
059fea672c chore(deps): update dependency nbqa to v1.2.3 (#240)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:49:47 -06:00
389e804426 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#236)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:46:09 -06:00
Andrew FerlitschandGitHub 087a638c18 Update README.md 2022-01-25 22:16:55 -08:00
Andrew FerlitschandGitHub 97757c74ca feat: sklearn training (#243)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn
2022-01-25 22:15:51 -08:00
Andrew FerlitschandGitHub 08f3ad583b feat: finish hpt components notebook (#239)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook
2022-01-25 10:02:28 -08:00
Karl WeinmeisterandGitHub 16f01d31d3 chore: Update notebook template license date to 2022 (#237)
* chore: Update notebook template license date to 2022

* chore: Add extra space to address lint error
2022-01-25 11:20:00 -06:00
e0f6c66351 chore(deps): update dependency pandas to v1.4.0 (#233)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-24 13:58:50 -06:00
Ivan CheungandGitHub 3733b28772 Updated requirements (#235) 2022-01-24 14:54:31 -05:00
24f8912134 feat: Add inventory prediction notebook (#216)
* made changes

* made changes

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-24 14:07:42 -05:00
WhiteSource RenovateandGitHub cdc8847f9b chore(deps): update dependency papermill to v2.3.4 (#234) 2022-01-24 10:46:31 -06:00
Andrew FerlitschandGitHub 25bd4b9eb5 Update README.md 2022-01-21 19:05:35 -08:00
Andrew FerlitschandGitHub d476191252 feat: add notebooks (#232)
* feat: friday update

* feat: friday update
2022-01-21 17:14:31 -08:00
nicainandGitHub bf35d6a07c Add metadata to hide cells (#226) 2022-01-21 14:57:24 -08:00
5378d38a05 chore(deps): update dependency ipython to v8.0.1 (#222)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-21 11:15:14 -06:00
Ivan CheungandGitHub 85984f1173 Fixed broken Colab link 2022-01-20 17:52:56 -05:00
Ivan CheungandGitHub 92bb40349f Cleaned up cloud build by renaming files and moving methods around (#219)
* Cleaned up cloud build

* Fixed bug

* More renaming and comment cleanup

* Added helper file

* Fixed missing return
2022-01-20 15:55:38 -05:00
Rajesh ThallamandGitHub fcee9bf738 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#227)
* PyTorch on Vertex - Adding pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook, clearing outputs

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - reverting serving Dockerfile changes

* PyTorch on Vertex - linting fixes

* PyTorch on Vertex - updates to README

* PyTorch on Vertex - linter related fixes
2022-01-20 13:20:00 -06:00
nicainandGitHub cc2f3408ad Update Run After --> Run Selected Cell and All Below (#228) 2022-01-20 08:07:31 -06:00
nicainandGitHub 89fb218041 Alphafold on gcp tutorial (#221)
* Original alphafold Dockerfile and notebook as a starting point

* Migrate dependencies from notebook into Dockerfile

* adding build_docker.sh script for building docker image

* remove cell, and replace with accelerator configuration cell. Also remove dependency on google.colab

* dockerfile remove redundant

* Changing text in launch button

* add vertexai.png

* update notebook, including permalink to vertexai.png

* updating notebook markdown and correcting the vertexai.png image display

* add div brackets and fix broken launch link

* table instead of div

* width=40

* resizing vertexai image

* updated FAQ

* updated Licence

* add back in the output_file zip

* launch button at top of notebook

* default workdir aligned with JuptyerLab home directory

* intro paragraph

* update CPU instructions

* exchange notebook title and launch header

* Dockerfile license

* collapsing cells

* splitting out sequences into un-collapsed cell

* Update licence

* update download instructions text

* Remove "double-click" text

* hide cells

* Increasing indent to pass linting for alphafold_on_gcp (#224)

* increasing indent to pass linting

* more linting

* wild

* AMBER relaxation f-string

* hidden cells

* wild commit

* move links to main
2022-01-19 18:47:21 -08:00
Andrew FerlitschandGitHub 4d0c3781e5 Update README.md 2022-01-19 12:30:01 -08:00
Andrew FerlitschandGitHub e2e319ac7f Update README.md 2022-01-19 11:08:55 -08:00
Andrew FerlitschandGitHub 63508cad3f feat: add ml metadata notebook (#223)
* weekly updates

* weekly updates

* feat: add metadata notebook

* feat: add metadata notebook
2022-01-19 10:58:03 -08:00
0b6eb6eed1 Updates to automl tabular beans pipeline (#220)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-18 15:34:57 -06:00
Polong LinandGitHub a41cfdeba5 Fix typo: Wikepedia --> Wikipedia (#217) 2022-01-18 08:28:04 -06:00
7a6763ca33 chore(deps): update dependency numpy to v1.22.1 (#214)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 17:10:52 -06:00
Sara RobinsonandGitHub 2a6e19e4f9 Update MLMD notebook to use pipeline submit() method (#215) 2022-01-14 17:09:45 -06:00
9f9526b722 Delete Dockerfile (#198)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 14:28:30 -05:00
Ivan CheungandGitHub 267684b7c3 Added private pool to cloud build config (#211) 2022-01-14 14:27:34 -05:00
Andrew FerlitschandGitHub b74dd3d576 Update README.md 2022-01-13 16:22:14 -08:00
Andrew FerlitschandGitHub 278ae48842 Update README.md 2022-01-13 16:21:28 -08:00
Andrew FerlitschandGitHub 189ca12627 Update README.md 2022-01-13 16:20:39 -08:00
Andrew FerlitschandGitHub 5108f57ba8 feat: weekly updates (#212)
* weekly updates

* weekly updates
2022-01-13 16:19:21 -08:00
6bace666e4 chore(deps): update dependency ipython to v8 (#209)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-13 15:24:51 -06:00
4c35616d30 fix: Increase timeout on explainability notebooks to prevent build failure (#205)
* test: update timeout of testing

* test: increase timeout for testing

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-13 15:13:20 -06:00
cadbc733b8 chore(deps): update dependency numpy to v1.22.0 (#207)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-13 14:19:43 -06:00
ee6088957d Update Swivel sample and Matching Engine sample (#193)
* Update swivel and matchine engine samples

* Fix lint

* format notebooks

* fix lint

* fix lint

* upgrade google-python-api-client for testing pipeline

* upgrade google-api-core for testing pipeline

* install tensorflow after other required packages

* fix lint

* upgrade google-auth for testing

* install tensorflow in testing env

* upgrade pip with user flag

* remove kfp as a dependency

* separate matching engine notebook into another commit

* fix service account extraction

* service account is optional so comment it

* submit pipeline without specifying service account

* clarify how TensorBoard relates to Vertex ML metadata

* add reference to Vertex ML metadata

* fix typo

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-01-12 17:51:23 -08:00
58118c89f7 Chicago taxi fare prediction (#196)
* added notebook

* made changes

* ran linter

* small changes

* made changes

* ran linter

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 16:51:19 -06:00
108112c9a0 Predictive maintaince usecase (#194)
* added

* ran linter

* comments resolved

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 16:49:09 -06:00
Andrew FerlitschandGitHub 4f586719e7 Update README.md 2022-01-11 12:57:16 -08:00
31e4985480 chore(deps): update dependency nbconvert to v6.4.0 (#197)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 13:32:39 -06:00
672b8bd262 chore(deps): update dependency numpy to v1.21.5 (#191)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 13:28:22 -06:00
Andrew FerlitschandGitHub c64c185407 Update README.md 2022-01-10 15:52:05 -08:00
Andrew FerlitschandGitHub 19fd6aa4e3 Add files via upload 2022-01-10 15:48:47 -08:00
Andrew FerlitschandGitHub 55746d05f3 Update README.md 2022-01-10 14:08:44 -08:00
Andrew FerlitschandGitHub ad8d6382d4 Update README.md 2022-01-10 14:07:04 -08:00
Andrew FerlitschandGitHub 5114a6c09c Update README.md 2022-01-10 14:05:09 -08:00
Andrew FerlitschandGitHub f405c109e2 fix: git links (#206)
* https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
'

* feat: updates

* feat: add BQML components

* fix: git links

* fix: git links
2022-01-10 13:08:04 -08:00
Andrew FerlitschandGitHub ff646fee07 Delete mlops_data_management.ipynb 2022-01-10 12:55:36 -08:00
Andrew FerlitschandGitHub e517a8998c Update README.md 2022-01-06 11:30:03 -08:00
Andrew FerlitschandGitHub 776a699a76 feat: BQML (#201)
* https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
'

* feat: updates

* feat: add BQML components
2022-01-06 11:25:46 -08:00
a942a63959 chore(deps): update dependency ipython to v7.31.0 (#199)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-05 19:22:15 -06:00
Andrew FerlitschandGitHub 4b275e3370 feat: updates (#200)
* https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
'

* feat: updates
2022-01-05 09:59:12 -08:00
Karl WeinmeisterandGitHub 7bb6787800 docs: Update incorrect quote mark in CONTRIBUTING.md (#190) 2021-12-21 10:20:42 -08:00
Andrew FerlitschandGitHub d314dda749 fix: friday update (#192)
* friday updates

* friday updates
2021-12-20 10:37:30 -08:00
3e955d0b83 chore(deps): update dependency pandas to v1.3.5 (#189)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-12-16 17:20:10 -06:00
WhiteSource RenovateandGitHub ae058696eb chore(deps): update dependency matplotlib to v3.5.1 (#188) 2021-12-16 17:14:30 -06:00
fa62eef2d1 chore(deps): pin dependencies (#8)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-12-16 17:06:22 -06:00
Karl WeinmeisterandGitHub 16b9dcc09f build: Add tensorflow pip install to migration notebook (#185)
* Add tensorflow pip install to migration notebook

The build is failing due to tensorflow missing. Adding this dependency.

* build: Testing change to notebook test to resolve build error

* build: Reverted change to base branch
2021-12-16 14:30:41 -08:00
Ben LackeyandGitHub ed559bd9f4 Change URL to root repo (#183) 2021-12-14 08:42:18 -06:00
Andrew FerlitschandGitHub ddb825addf fix: MLops update (#182)
* fix: friday update

* fix: friday update

* fix: friday update

* fix: friday update

* fix: friday update
2021-12-13 10:42:29 -08:00
Andrew FerlitschandGitHub b78dfa38ef Update README.md 2021-12-10 12:35:54 -08:00
Andrew FerlitschandGitHub 101abf0566 fix: MLops 3v4 update (#181)
* fix: friday update

* fix: friday update

* fix: friday update
2021-12-10 10:43:14 -08:00
Karl WeinmeisterandGitHub d121d4a51d Update CODEOWNERS to reflect current ownership (#179) 2021-12-09 11:22:48 -08:00
Ben LackeyandGitHub 5d933b9b13 Add Neo4j notebook (#173)
* Add Neo4j notebook

* delete extra line

* Across this notebook, the dataframe assignment and display occurs both within and outside with statements. Consider following the pattern of the 2nd query, where it is outside.

* Typo: unlabled

* AutoML Tables is no longer a standalone product in Vertex AI, so I suggest the naming "Vertex AI for AutoML tabular data."
2021-12-09 13:03:31 -06:00
Karl WeinmeisterandGitHub bdd0b0453a Update linter requirements.txt (#176)
Updating linter dependencies based on conversation in #173
2021-12-08 14:39:12 -08:00
639ecb962e Change to pip3 and add to PATH (#169)
Hi.  I tried to run this all through cloud shell.  pip makes to Python 2.0 there and the command fails.  So, this PR has pip3.

Also, the cloud shell path didn't know about the directory where all this stuff installed, so I've added a command to add it to PATH.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-12-07 13:54:23 -06:00
Karl WeinmeisterandGitHub b3adc0bbf3 Update .github files for main branch conversion (#170) 2021-12-07 13:25:06 -06:00
36455b8125 Pipelines rui (#158)
* feat: customm train gcpc

* feat: customm train gcpc

* feat: customm train gcpc

* feat: updates for Karl review

* fix: build issues

* fix: build issues

* fix: lint issue

* fix: build issue

* fix: build issue

* fixL]: build issue

* added back google-python-api-client

* Updated google-api-core dependency

* Fixed quote issue

* Update location of google-api-core install

* Add force reinstall flag

* Separate TF and google-api-core installs

* add missing comma

* Added reinstall of google-auth

* Added force-reinstall for Tensorflow dependencies

* fix missing comma

* trying upgrade of google core packages

* Added diagnostic step and added httplib2

* Added more debugging statements

* Try changing user_flag when IS_TESTING set

* Update google-api-python-client dependency

* Add google-auth and force reinstall

* Update google-api-python-client

* Removed diagnostics and simplified test environment installs

* fix: TW review updates

* fix: TW review

* debug: notebook testing

* TW review update

* TW  review update

* test: force retest

* fix: lint

Co-authored-by: Karl Weinmeister <kweinmeister@google.com>
2021-12-03 11:13:12 -08:00
Andrew FerlitschandGitHub 1a748c7d1c Update mlops_experimentation.ipynb 2021-12-03 10:29:50 -08:00
Andrew FerlitschandGitHub 53734bf984 Ml opml ops 3v4 (#167)
* friday updates

* friday updates

* friday updates

* friday updates

* fix: custom train

* fix: custom train

* remove debug info

* fix: remove debug

* fix: remove debug

* fix: remove debug

* fix: remove debug

* fix: remove debug
2021-12-03 10:28:47 -08:00
Andrew FerlitschandGitHub 858ed794e6 feat: MLops 3v4 (#166)
* friday updates

* friday updates

* friday updates

* friday updates

* fix: custom train

* fix: custom train

* remove debug info

* fix: remove debug
2021-12-03 10:18:18 -08:00
Andrew FerlitschandGitHub e90e0fa7bd Update README.md 2021-11-30 18:42:23 -08:00
Andrew FerlitschandGitHub 81bbcce326 fix: custom train (#165)
* friday updates

* friday updates

* friday updates

* friday updates

* fix: custom train

* fix: custom train
2021-11-30 18:41:28 -08:00
Brian KangandGitHub d271648779 TPU pipeline to community folder (#164)
* TPU pipeline to community folder

* Changes per review by Andrew F

* Lint test

* Moved to community/pipelines

* Updated codeowners to reference pipelines folder

* Update to codeowners
2021-11-30 10:35:19 -05:00
Andrew FerlitschandGitHub f832c5d120 feat: stage 3 updates (#163)
* friday updates

* friday updates

* friday updates

* friday updates
2021-11-29 12:28:11 -08:00
Andrew FerlitschandGitHub 18f12353a7 feat: stage 3 friday updates (#160)
* feat: friday updates

* feat: friday updates

* feat: Friday updates

* feat: Friday updates
2021-11-19 15:59:27 -08:00
Karl WeinmeisterandGitHub a79a283a77 build: Add step to upgrade pip (#159)
* build: Add step to upgrade pip

* Changed location for running pip upgrade

* Removed whitespace
2021-11-19 15:02:48 -06:00
f67e0f0531 Add ML Metadata + Pipelines notebook (#59)
* feat: MLMD + Pipelines notebook

* Updates from notebook execution test

* Update with changes from linter

* Update MLMD notebook from feedback, upgrade to latest sdk versions

* Add metadata notebook to codeowners file

* Resolve merge conflicts with codeowners

* Update KFP and Vertex SDK versions

* Run the linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-11-18 12:23:42 -06:00
Andrew FerlitschandGitHub d6b6eb9483 Update README.md 2021-11-16 16:29:19 -08:00
096e3e1090 Moved forecasting to official folder (#84)
* Added forecasting notebook

* Fixed forecasting notebook

* Ran linter

* Small fix

* Fixed dataset variable name conflict

* Ran linter

* Fixed cleanup bug

* fix: remove online prediction reference

* fix: rephrase title to just AutoML tabular forecasting

* fix: update training time to one hour

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2021-11-16 16:24:06 -08:00
Andrew FerlitschandGitHub 400ff8c4a4 feat: get started BQML (#157)
* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates

* feat: add BML get started

* feat: add BML get started
2021-11-16 16:22:28 -08:00
Karl WeinmeisterandGitHub 1b0a3e8f90 Linting updates for PR #154 (#155)
* Removed extra scaling call in image notebooks

* formatting/linting updates
2021-11-16 15:05:26 -08:00
Andrew FerlitschandGitHub 91e17e3d80 Add files via upload 2021-11-16 10:02:37 -08:00
Andrew FerlitschandGitHub 40b80f357d Update README.md 2021-11-16 08:57:51 -08:00
Andrew FerlitschandGitHub 868423fd09 feat: updates for stage3 (#156)
* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates
2021-11-16 08:56:00 -08:00
Karl WeinmeisterandGitHub 644612fde9 Removed extra scaling call in image notebooks (#154) 2021-11-15 17:45:02 -08:00
Ivan CheungandGitHub a2ae130378 Fixed edge case where no notebooks are detected (#152) 2021-11-15 13:11:17 -06:00
Karl WeinmeisterandGitHub dddd43c191 Revert "Temporary CI change to exempt failed notebooks (#148)" (#150)
This reverts commit 3632c5b849.
2021-11-15 13:03:46 -06:00
Andrew FerlitschandGitHub 6589d56e4c fix: install TF 2021-11-15 10:11:33 -08:00
Andrew FerlitschandGitHub 5d5c4b8e9d fix: add install for TF 2021-11-15 10:10:15 -08:00
Andrew FerlitschandGitHub d380f45485 fix: misspelling 2021-11-15 09:46:13 -08:00
Andrew FerlitschandGitHub 33d8fed6d7 fix: IS_TESTING 2021-11-15 09:32:24 -08:00
Andrew FerlitschandGitHub 6e59dec4f0 fix: IS_TESTING 2021-11-15 09:31:00 -08:00
Andrew FerlitschandGitHub fe802e118c fix: IS_TESTING 2021-11-15 09:30:06 -08:00
Andrew FerlitschandGitHub d018865a7c fix: IS_TESTING 2021-11-15 09:29:23 -08:00
Andrew FerlitschandGitHub 9c0f8fc5bf fix: IS_TESTING 2021-11-15 09:27:19 -08:00
Andrew FerlitschandGitHub bc58e05d2a fix: IS_TESTING 2021-11-15 09:26:26 -08:00
Andrew FerlitschandGitHub 977a4657fa fix: IS_TESTING 2021-11-15 09:10:46 -08:00
Andrew FerlitschandGitHub e8cbe3c5c5 fix: IS_TESTING 2021-11-15 09:09:40 -08:00
Andrew FerlitschandGitHub 8b114d3eec fix: IS_TESTING 2021-11-15 09:07:18 -08:00
Ivan CheungandGitHub 740958005a Parallel custom job notebook execution (#120)
* Initial commit

* Added parallel execution
2021-11-12 18:31:36 -05:00
Karl WeinmeisterandGitHub d65e074163 Updated doc locations for PolicyBot compliance (#149)
* Updated doc locations for policybot compliance

* Removed docs folder with duplicates
2021-11-12 16:28:02 -06:00
google-cloud-policy-bot[bot]GitHubgoogle-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
816c8f2309 chore: add SECURITY.md (#145)
Co-authored-by: google-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
2021-11-12 11:32:03 -06:00
google-cloud-policy-bot[bot]GitHubgoogle-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
a9e0b99992 chore: add CONTRIBUTING.md (#146)
Co-authored-by: google-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
2021-11-12 11:31:52 -06:00
google-cloud-policy-bot[bot]GitHubgoogle-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
a61802821d chore: add a Code of Conduct (#144)
Co-authored-by: google-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
2021-11-12 11:31:39 -06:00
Alec GlassfordandGitHub b078e50cc0 Relax language re: multi-region bucket for training (#142)
I believe you *can* use a multi-region; it just might not work as well (e.g. for latency, cost) as a regional bucket where you are doing other operations. This removes in inaccurate statement.
2021-11-12 11:22:30 -06:00
Karl WeinmeisterandGitHub 3632c5b849 Temporary CI change to exempt failed notebooks (#148)
#120 is failing due to existing notebooks failing. This change will temporarily reduce the number of folders checked, to enable this PR to be merged, which enables weekly regression tests. Then, we will address the issues with the notebooks and remove these exemptions.
2021-11-12 09:11:09 -08:00
Andrew FerlitschandGitHub 5201dc9828 Update README.md 2021-11-11 16:29:56 -08:00
Andrew FerlitschandGitHub e0861b00e4 Create README.md 2021-11-11 16:25:27 -08:00
Andrew FerlitschandGitHub 2d4cff3c2e Update README.md 2021-11-11 16:21:44 -08:00
Andrew FerlitschandGitHub 428f861b9b feat: stage 3 notebooks (#147)
* feat: stage 3 notebooks

* feat: stage 3 notebooks
2021-11-11 16:21:03 -08:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
31487745d6 build(deps): bump tensorflow (#138)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.4.1 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.4.1...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 18:02:45 -06:00
Karl WeinmeisterandGitHub d1ccf37e68 Notebook fixes to work in Workbench (#141) 2021-11-10 18:01:12 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
91440922b5 build(deps): bump tensorflow (#136)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 15:23:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
e15cc7e3cd build(deps): bump tensorflow (#137)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.1 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.1...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 15:22:56 -06:00
c6e767edaf Train and deploy end-to-end sklearn text classifier (#122)
* added sklearn-example

* nb formatting

* added readme

* added endpoint to notebook

* nb formatting

* added endpoint prediction example

* nb formatting

* fixed request

* minor woring fixes in docstrings

* added codeowner and included PR feedback

Co-authored-by: Maximilian Engelhardt <maximilian.engelhardt@ing.com>
2021-11-10 15:20:57 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
176c79033d build(deps): bump tensorflow (#135)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 15:02:46 -06:00
Andrew FerlitschandGitHub f6685cf8aa fix: friday updates (#132)
* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* feat: friday updates

* feat: friday updates
2021-11-08 09:29:31 -08:00
Andrew FerlitschandGitHub c9cc1d1675 fix: removed cleanup line 2021-11-08 09:12:35 -08:00
Karl WeinmeisterandGitHub d3ecbe578c Updated notebook template with bucket changes (#130)
* Updated notebook template with bucket changes

* Added step to delete bucket if flag set
2021-11-08 11:10:07 -06:00
Ivan CheungandGitHub c04bab95d7 Renamed migration notebooks (#125)
* Renamed migration notebooks

* Removed 'unified' from filename

* Fixed names
2021-11-08 11:54:48 -05:00
Andrew FerlitschandGitHub 651ce325c2 fix: breaking change (#131)
* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes
2021-11-07 15:13:54 -08:00
ffbf8db52c feat: Added notebook demonstrating how to evaluate a forecasting training job. (#55)
* Add notebook for Automl Forecasting

Adding a new notebook tutorial for evaluating a forecasting training job

* Format and lint automl forecasting notebook

* Add forecasting notebook

This tutorial focuses on evaluating a forecasting training job.

* Delete automl-forecasting-evaluating-a-model.ipynb

* Format and lint automl forecasting notebook

* Use column_specs instead of column_transformations

* Fixed formatting

* Fixed formatting

* Added owner for Forecasting notebooks

Co-authored-by: Mansi Achuthan <mansiachuthan@google.com>
Co-authored-by: Hardik Vala <hardikv@google.com>
Co-authored-by: thehardikv <78449654+thehardikv@users.noreply.github.com>
2021-11-05 14:46:33 -07:00
Andrew FerlitschandGitHub 57373b6fe4 fix: remove debug code 2021-11-05 10:27:16 -07:00
Andrew FerlitschandGitHub 2b66079a68 fix: breaking changes (#128)
* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes
2021-11-04 22:49:51 -07:00
Andrew FerlitschandGitHub ec759a18c9 fix: updates for 0.1.9 (#127)
* fix: breaking changes

* fix: breaking changes
2021-11-04 21:37:05 -07:00
Karl WeinmeisterandGitHub 211aa8a822 Added links to locally test for formatting & linking (#124) 2021-11-04 19:07:22 -05:00
Ivan CheungandGitHub ae7529241f Renamed brand names (#123)
* Renamed brand names

* Fixed duplicate 'Vertex AI'

* Fixed user managed notebooks reference

* Renamed to Vertex AI AutoML Image Object Detection
2021-11-03 17:48:17 -04:00
Ivan CheungandGitHub d5d8a3de5f Update CODEOWNERS 2021-11-02 16:11:23 -04:00
tubaandGitHub 7dd784bc2c update for gsutil (#60)
Adding "/*" to the path to delete the content, otherwise the bucket is removed.
2021-11-01 09:36:32 -07:00
Karl WeinmeisterandGitHub 09795308ab Added code quality checks to contributing.md (#121) 2021-11-01 09:26:40 -07:00
b4d901d725 Rapid prototyping (with fixes) (#107)
* Notebook that walks a user through an AutoML vs BQML model competition.

* adding myself to CODEOWNERS

* Fixes notebook formatting after lint fail  and adds clean-up cell at the end of the notebook

* adding W291 to list of exception so SQL queries can pass

* saving pipeline json file on the same folder as the notebook

* After linting / formatting

* Delete run_linter.sh

* putting run_linter.sh back

* reverting run_linter.sh to repo's

* Update rapid_prototyping_bqml_automl.ipynb

- Added Colab and Github buttons at the top;
- Allow for BQ region settings;
- Tested with BQ region = EU / Vertex Region = europe-west4;
- Must set delete flag to True in order to clean up;

* Markdown format + bucket-name not hard-coded

Co-authored-by: Rafa Carvalho <rafacarv@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2021-11-01 09:23:01 -07:00
Andrew FerlitschandGitHub a9ad0f8e92 Update README.md 2021-10-29 16:22:39 -07:00
Andrew FerlitschandGitHub 6827d0b754 Update README.md 2021-10-29 16:21:42 -07:00
Andrew FerlitschandGitHub fea67b2ed0 feat: friday updates (#119)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2

* feat: start on stage2

* feat: start on stage2

* feat: get started

* feat: get started

* fix: updates

* fix: updates

* fix: updates

* fix: updates

* friday updates

* friday updates

* friday updates

* friday updates
2021-10-29 16:20:09 -07:00
Andrew FerlitschandGitHub 19f8fa549c fix job ID typo 2021-10-26 10:25:44 -07:00
Andrew FerlitschandGitHub f982fedebf fix typo in job ID 2021-10-26 09:40:56 -07:00
Andrew FerlitschandGitHub e6e49f68d3 fix job id typo 2021-10-26 09:31:00 -07:00
Andrew FerlitschandGitHub 067997b2a1 fix job ID typo in 2nd HPT job 2021-10-25 17:36:50 -07:00
Andrew FerlitschandGitHub 3e914bbf45 fix job ID typo in 2nd HPT job 2021-10-25 17:35:29 -07:00
Andrew FerlitschandGitHub 5d54485642 fix typo in job ID for second HPT job 2021-10-25 17:33:48 -07:00
Morgan DuandGitHub 30b718f8c1 Feat: use gcsfuse (#109)
* fix: add replica_count

* change to gcsfuse
2021-10-25 13:31:18 -07:00
halio-gandGitHub d585692254 Changed the vizier's SDK version from v1beta1 to v1. (#103) 2021-10-25 12:21:41 -07:00
Ivan CheungandGitHub 07f2385ea9 Create CODEOWNERS 2021-10-25 14:30:15 -04:00
Ivan CheungandGitHub 9ac6cf64d7 Update CODEOWNERS 2021-10-25 14:28:10 -04:00
Ivan CheungandGitHub b12a08642b Delete CODEOWNERS 2021-10-25 14:26:39 -04:00
Ivan CheungandGitHub 5fa713d851 Update CODEOWNERS 2021-10-25 14:26:25 -04:00
624 changed files with 372329 additions and 37929 deletions
-194
View File
@@ -1,194 +0,0 @@
# Copyright 2020 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
# We want to use LTS ubuntu from our mirror because dockerhub has a
# rate limit.
# FROM mirror.gcr.io/library/ubuntu:18.04
# However, now the above image is not working, we're using our own cache
FROM gcr.io/cloud-devrel-kokoro-resources/ubuntu:20.04
ENV DEBIAN_FRONTEND noninteractive
# Ensure local Python is preferred over distribution Python.
ENV PATH /usr/local/bin:$PATH
# http://bugs.python.org/issue19846
# At the moment, setting "LANG=C" on a Linux system fundamentally breaks
# Python 3.
ENV LANG C.UTF-8
# Install dependencies.
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
apt-transport-https \
build-essential \
ca-certificates \
curl \
dirmngr \
git \
gcc \
gpg-agent \
graphviz \
libbz2-dev \
libdb5.3-dev \
libexpat1-dev \
libffi-dev \
liblzma-dev \
libmagickwand-dev \
libmemcached-dev \
libpython3-dev \
libreadline-dev \
libsnappy-dev \
libssl-dev \
libsqlite3-dev \
portaudio19-dev \
pkg-config \
redis-server \
software-properties-common \
ssh \
sudo \
systemd \
tcl \
tcl-dev \
tk \
tk-dev \
uuid-dev \
wget \
zlib1g-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install docker
RUN curl -fsSL https://download.docker.com/linux/ubuntu/gpg | sudo apt-key add -
RUN add-apt-repository \
"deb [arch=amd64] https://download.docker.com/linux/ubuntu \
$(lsb_release -cs) \
stable"
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
docker-ce \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Bazel for compiling Tink in Cloud SQL Client Side Encryption Samples
# TODO: Delete this section once google/tink#483 is resolved
RUN apt install -y curl gpgconf gpg \
&& curl -fsSL https://bazel.build/bazel-release.pub.gpg | gpg --dearmor > bazel.gpg \
&& mv bazel.gpg /etc/apt/trusted.gpg.d/ \
&& echo "deb [arch=amd64] https://storage.googleapis.com/bazel-apt stable jdk1.8" | sudo tee /etc/apt/sources.list.d/bazel.list \
&& apt update && apt install -y bazel \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Microsoft ODBC 17 Driver and unixodbc for testing SQL Server samples
RUN curl https://packages.microsoft.com/keys/microsoft.asc | apt-key add - \
&& curl https://packages.microsoft.com/config/ubuntu/20.04/prod.list > /etc/apt/sources.list.d/mssql-release.list \
&& apt-get update \
&& ACCEPT_EULA=Y apt-get install -y --no-install-recommends \
msodbcsql17 \
unixodbc-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
COPY fetch_gpg_keys.sh /tmp
# Install the desired versions of Python.
RUN set -ex \
&& export GNUPGHOME="$(mktemp -d)" \
&& echo "disable-ipv6" >> "${GNUPGHOME}/dirmngr.conf" \
&& /tmp/fetch_gpg_keys.sh \
&& for PYTHON_VERSION in 2.7.18 3.6.13 3.7.10 3.8.8 3.9.2; do \
wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz" \
&& wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz.asc "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz.asc" \
&& gpg --batch --verify python-${PYTHON_VERSION}.tar.xz.asc python-${PYTHON_VERSION}.tar.xz \
&& rm -r python-${PYTHON_VERSION}.tar.xz.asc \
&& mkdir -p /usr/src/python-${PYTHON_VERSION} \
&& tar -xJC /usr/src/python-${PYTHON_VERSION} --strip-components=1 -f python-${PYTHON_VERSION}.tar.xz \
&& rm python-${PYTHON_VERSION}.tar.xz \
&& cd /usr/src/python-${PYTHON_VERSION} \
&& ./configure \
--enable-shared \
# This works only on Python 2.7 and throws a warning on every other
# version, but seems otherwise harmless.
--enable-unicode=ucs4 \
--with-system-ffi \
--without-ensurepip \
&& make -j$(nproc) \
&& make install \
&& ldconfig \
; done \
&& rm -rf "${GNUPGHOME}" \
&& rm -rf /usr/src/python* \
&& rm -rf ~/.cache/
# Install pip on Python 3.6 only.
# If the environment variable is called "PIP_VERSION", pip explodes with
# "ValueError: invalid truth value '<VERSION>'"
ENV PYTHON_PIP_VERSION 20.2.4
RUN wget --no-check-certificate -O /tmp/get-pip.py 'https://bootstrap.pypa.io/get-pip.py' \
&& python3.6 /tmp/get-pip.py "pip==$PYTHON_PIP_VERSION" \
# we use "--force-reinstall" for the case where the version of pip we're trying to install is the same as the version bundled with Python
# ("Requirement already up-to-date: pip==8.1.2 in /usr/local/lib/python3.6/site-packages")
# https://github.com/docker-library/python/pull/143#issuecomment-241032683
&& pip3 install --no-cache-dir --upgrade --force-reinstall "pip==$PYTHON_PIP_VERSION" \
# then we use "pip list" to ensure we don't have more than one pip version installed
# https://github.com/docker-library/python/pull/100
&& [ "$(pip list |tac|tac| awk -F '[ ()]+' '$1 == "pip" { print $2; exit }')" = "$PYTHON_PIP_VERSION" ]
# Ensure Pip for python3
RUN python3 /tmp/get-pip.py
RUN rm /tmp/get-pip.py
# Install "virtualenv", since the vast majority of users of this image
# will want it.
RUN pip install --no-cache-dir virtualenv
# Setup Cloud SDK
ENV CLOUD_SDK_VERSION 339.0.0
# Use system python for cloud sdk.
ENV CLOUDSDK_PYTHON python3.6
RUN wget https://dl.google.com/dl/cloudsdk/channels/rapid/downloads/google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN tar xzf google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN /google-cloud-sdk/install.sh
ENV PATH /google-cloud-sdk/bin:$PATH
# Enable redis-server on boot.
RUN sudo systemctl enable redis-server.service
# Create a user and allow sudo
# kbuilder uid on the default Kokoro image
ARG UID=1000
ARG USERNAME=kbuilder
# Add a new user to the container image.
# This is needed for ssh and sudo access.
# Add a new user with the caller's uid and the username.
RUN useradd -d /h -u ${UID} ${USERNAME}
# Allow nopasswd sudo
RUN echo "${USERNAME} ALL=(ALL) NOPASSWD:ALL" >> /etc/sudoers
CMD ["python3.6"]
-312
View File
@@ -1,312 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import dataclasses
import datetime
import functools
import pathlib
import os
import subprocess
from pathlib import Path
from typing import List, Optional
import concurrent
from tabulate import tabulate
import ExecuteNotebook
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
def format_timedelta(delta: datetime.timedelta) -> str:
"""Formats a timedelta duration to [N days] %H:%M:%S format"""
seconds = int(delta.total_seconds())
secs_in_a_day = 86400
secs_in_a_hour = 3600
secs_in_a_min = 60
days, seconds = divmod(seconds, secs_in_a_day)
hours, seconds = divmod(seconds, secs_in_a_hour)
minutes, seconds = divmod(seconds, secs_in_a_min)
time_fmt = f"{hours:02d}:{minutes:02d}:{seconds:02d}"
if days > 0:
suffix = "s" if days > 1 else ""
return f"{days} day{suffix} {time_fmt}"
return time_fmt
@dataclasses.dataclass
class NotebookExecutionResult:
notebook: str
duration: datetime.timedelta
is_pass: bool
error_message: Optional[str]
def execute_notebook(
artifacts_path: str,
variable_project_id: str,
variable_region: str,
should_log_output: bool,
should_use_new_kernel: bool,
notebook: str,
) -> NotebookExecutionResult:
print(f"Running notebook: {notebook}")
result = NotebookExecutionResult(
notebook=notebook,
duration=datetime.timedelta(seconds=0),
is_pass=False,
error_message=None,
)
# TODO: Handle cases where multiple notebooks have the same name
time_start = datetime.datetime.now()
try:
ExecuteNotebook.execute_notebook(
notebook_file_path=notebook,
output_file_folder=artifacts_path,
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
},
should_log_output=should_log_output,
should_use_new_kernel=should_use_new_kernel,
)
result.duration = datetime.datetime.now() - time_start
result.is_pass = True
print(f"{notebook} PASSED in {format_timedelta(result.duration)}.")
except Exception as error:
result.duration = datetime.datetime.now() - time_start
result.is_pass = False
result.error_message = str(error)
print(
f"{notebook} FAILED in {format_timedelta(result.duration)}: {result.error_message}"
)
return result
def run_changed_notebooks(
test_paths_file: str,
base_branch: Optional[str],
output_folder: str,
variable_project_id: str,
variable_region: str,
should_parallelize: bool,
should_use_separate_kernels: bool,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the output_folder.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
output_folder (str):
Required. The folder to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
should_use_separate_kernels (bool):
Note: Dependencies don't install correctly when this is set to True
See https://github.com/nteract/papermill/issues/625
Required. Should run each notebook in a separate and independent virtual environment.
"""
test_paths = []
with open(test_paths_file) as file:
lines = [line.strip() for line in file.readlines()]
lines = [line for line in lines if len(line) > 0]
test_paths = [line for line in lines]
if len(test_paths) == 0:
raise RuntimeError("No test folders found.")
print(f"Checking folders: {test_paths}")
# Find notebooks
notebooks = []
if base_branch:
print(f"Looking for notebooks that changed from branch: {base_branch}")
notebooks = subprocess.check_output(
["git", "diff", "--name-only", f"origin/{base_branch}..."] + test_paths
)
else:
print(f"Looking for all notebooks.")
notebooks = subprocess.check_output(["git", "ls-files"] + test_paths)
notebooks = notebooks.decode("utf-8").split("\n")
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if Path(notebook).exists()]
# Create paths
artifacts_path = Path(output_folder)
artifacts_path.mkdir(parents=True, exist_ok=True)
artifacts_path.joinpath("success").mkdir(parents=True, exist_ok=True)
artifacts_path.joinpath("failure").mkdir(parents=True, exist_ok=True)
notebook_execution_results: List[NotebookExecutionResult] = []
if len(notebooks) > 0:
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
if should_parallelize and len(notebooks) > 1:
print(
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
)
with concurrent.futures.ThreadPoolExecutor(max_workers=None) as executor:
notebook_execution_results = list(
executor.map(
functools.partial(
execute_notebook,
artifacts_path,
variable_project_id,
variable_region,
False,
should_use_separate_kernels,
),
notebooks,
)
)
else:
notebook_execution_results = [
execute_notebook(
artifacts_path=artifacts_path,
variable_project_id=variable_project_id,
variable_region=variable_region,
notebook=notebook,
should_log_output=True,
should_use_new_kernel=should_use_separate_kernels,
)
for notebook in notebooks
]
else:
print("No notebooks modified in this pull request.")
print("\n=== RESULTS ===\n")
notebooks_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
os.path.basename(os.path.normpath(result.notebook)),
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.error_message or "--",
]
for result in notebooks_sorted
],
headers=["file", "status", "duration", "error"],
)
)
print("\n=== END RESULTS===\n")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--output_folder",
type=pathlib.Path,
help="The path to the folder to store executed notebooks.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
# Note: Dependencies don't install correctly when this is set to True
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=False,
help="Should run notebooks in parallel.",
)
# Note: This isn't guaranteed to work correctly due to existing Papermill issue
# See https://github.com/nteract/papermill/issues/625
parser.add_argument(
"--should_use_separate_kernels",
type=str2bool,
nargs="?",
const=True,
default=False,
help="(Experimental) Should run each notebook in a separate and independent virtual environment.",
)
args = parser.parse_args()
run_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
output_folder=args.output_folder,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
should_parallelize=args.should_parallelize,
should_use_separate_kernels=args.should_use_separate_kernels,
)
-175
View File
@@ -1,175 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import json
import sys
import nbformat
import os
import errno
from NotebookProcessors import RemoveNoExecuteCells, UpdateVariablesPreprocessor
from typing import Dict, Tuple
import papermill as pm
import shutil
import virtualenv
import uuid
from jupyter_client.kernelspecapp import KernelSpecManager
# This script is used to execute a notebook and write out the output notebook.
# The replaces calling the nbconvert via command-line, which doesn't write the output notebook correctly when there are errors during execution.
STAGING_FOLDER = "staging"
ENVIRONMENTS_PATH = "environments"
KERNELS_SPECS_PATH = "kernel_specs"
def create_and_install_kernel() -> Tuple[str, str]:
# Create environment
kernel_name = str(uuid.uuid4())
env_name = f"{ENVIRONMENTS_PATH}/{kernel_name}"
# venv.create(env_name, system_site_packages=True, with_pip=True)
virtualenv.cli_run([env_name, "--system-site-packages"])
# Create kernel spec
kernel_spec = {
"argv": [
f"{env_name}/bin/python",
"-m",
"ipykernel_launcher",
"-f",
"{connection_file}",
],
"display_name": "Python 3",
"language": "python",
}
kernel_spec_folder = os.path.join(KERNELS_SPECS_PATH, kernel_name)
kernel_spec_file = os.path.join(kernel_spec_folder, "kernel.json")
# Create kernel spec folder
if not os.path.exists(os.path.dirname(kernel_spec_file)):
try:
os.makedirs(os.path.dirname(kernel_spec_file))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
with open(kernel_spec_file, mode="w", encoding="utf-8") as f:
json.dump(kernel_spec, f)
# Install kernel
kernel_spec_manager = KernelSpecManager()
kernel_spec_manager.install_kernel_spec(
source_dir=kernel_spec_folder, kernel_name=kernel_name
)
return kernel_name, env_name
def execute_notebook(
notebook_file_path: str,
output_file_folder: str,
replacement_map: Dict[str, str],
should_log_output: bool,
should_use_new_kernel: bool,
):
# Create staging directory if it doesn't exist
staging_file_path = f"{STAGING_FOLDER}/{notebook_file_path}"
if not os.path.exists(os.path.dirname(staging_file_path)):
try:
os.makedirs(os.path.dirname(staging_file_path))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
file_name = os.path.basename(os.path.normpath(notebook_file_path))
# Create environments folder
if not os.path.exists(ENVIRONMENTS_PATH):
try:
os.makedirs(ENVIRONMENTS_PATH)
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
# Create and install kernel
kernel_name = next(
iter(KernelSpecManager().find_kernel_specs().keys()), None
) # Find first existing kernel and use as default
env_name = None
if should_use_new_kernel:
kernel_name, env_name = create_and_install_kernel()
# Read notebook
with open(notebook_file_path) as f:
nb = nbformat.read(f, as_version=4)
has_error = False
# Execute notebook
try:
# Create preprocessors
remove_no_execute_cells_preprocessor = RemoveNoExecuteCells()
update_variables_preprocessor = UpdateVariablesPreprocessor(
replacement_map=replacement_map
)
# Use no-execute preprocessor
(
nb,
resources,
) = remove_no_execute_cells_preprocessor.preprocess(nb)
(nb, resources) = update_variables_preprocessor.preprocess(nb, resources)
# print(f"Staging modified notebook to: {staging_file_path}")
with open(staging_file_path, mode="w", encoding="utf-8") as f:
nbformat.write(nb, f)
# Execute notebook
pm.execute_notebook(
input_path=staging_file_path,
output_path=staging_file_path,
kernel_name=kernel_name,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
)
except Exception:
# print(f"Error executing the notebook: {notebook_file_path}.\n\n")
has_error = True
raise
finally:
# Clear env
if env_name is not None:
shutil.rmtree(path=env_name)
# Copy execute notebook
output_file_path = os.path.join(
output_file_folder, "failure" if has_error else "success", file_name
)
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_path)):
try:
os.makedirs(os.path.dirname(output_file_path))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
# print(f"Writing output to: {output_file_path}")
shutil.move(staging_file_path, output_file_path)
-81
View File
@@ -1,81 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import re
"""
This script is used to update variables in the notebook via regex
It requires variables to be defined in particular format
For example, if your variable was PROJECT_ID, use:
PROJECT_ID = "[your_project_here]"
Single-quotes also work:
PROJECT_ID = '[your_project_here]'
Variables in conditionals can also be replaced:
PROJECT_ID == "[your_project_here]"
"""
def get_updated_value(content: str, variable_name: str, variable_value: str) -> str:
return re.sub(
rf"({variable_name}.*?=.*?[\",\'])\[.+?\]([\",\'].*?)",
rf"\1{variable_value}\2",
content,
flags=re.M,
)
def test_update_value():
new_content = get_updated_value(
content='asdf\nPROJECT_ID = "[your-project-id]" #@param {type:"string"} \nasdf',
variable_name="PROJECT_ID",
variable_value="sample-project",
)
assert (
new_content
== 'asdf\nPROJECT_ID = "sample-project" #@param {type:"string"} \nasdf'
)
def test_update_value_single_quotes():
new_content = get_updated_value(
content="PROJECT_ID = '[your-project-id]'",
variable_name="PROJECT_ID",
variable_value="sample-project",
)
assert new_content == "PROJECT_ID = 'sample-project'"
def test_update_value_avoidance():
new_content = get_updated_value(
content="PROJECT_ID = shell_output[0] ",
variable_name="PROJECT_ID",
variable_value="sample-project",
)
assert new_content == "PROJECT_ID = shell_output[0] "
def test_region():
new_content = get_updated_value(
content='REGION = "[your-region]" # @param {type:"string"}',
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
@@ -1 +1,2 @@
ratemate
google-cloud-aiplatform
+36 -12
View File
@@ -1,11 +1,23 @@
from typing import List
from ratemate import RateLimit
from resource_cleanup_manager import (
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
EndpointResourceCleanupManager,
ResourceCleanupManager,
MatchingEngineIndexEndpointResourceCleanupManager,
MatchingEngineIndexResourceCleanupManager,
FeatureStoreCleanupManager,
PipelineJobCleanupManager,
TrainingJobCleanupManager,
HyperparameterTuningCleanupManager,
BatchPredictionJobCleanupManager,
ExperimentCleanupManager,
BucketCleanupManager
)
rate_limit = RateLimit(max_count=25, per=60, greedy=False)
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
for manager in managers:
@@ -15,14 +27,17 @@ def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: boo
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
manager.delete(resource)
try:
if not manager.is_deletable(resource):
continue
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
rate_limit.wait() # wait before deleting
manager.delete(resource)
except Exception as exception:
print(exception)
print("")
@@ -33,10 +48,19 @@ if is_dry_run:
print("Starting cleanup in dry run mode...")
# List of all cleanup managers
managers = [
managers: List[ResourceCleanupManager] = [
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
ModelResourceCleanupManager(), # ModelResourceCleanupManager must follow EndpointResourceCleanupManager due to deployed models blocking model deletion.
MatchingEngineIndexEndpointResourceCleanupManager(),
MatchingEngineIndexResourceCleanupManager(),
FeatureStoreCleanupManager(),
PipelineJobCleanupManager(),
TrainingJobCleanupManager(),
HyperparameterTuningCleanupManager(),
BatchPredictionJobCleanupManager(),
ExperimentCleanupManager(), # Experiment missing _resource_noun
BucketCleanupManager()
]
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
@@ -1,8 +1,18 @@
'''
READ FIRST BEFORE MAKING CHANGES
- Create a convention for resources created from vertex-ai-samples GH. We already have one IIRC
- Only delete those objects as part of our clean-up script.
- Don't run any tests on python-docs-samples-tests project, especially ones that affect resources created outside of our purview
- Add --dry-run option to the clean-up script. This option will just output the list of resources the script will delete instead of actually deleting the resources.
- Have a larger conversation in DEE before touching any resources that were not created as part of vertex-ai-samples
'''
import abc
from typing import Any, Type
from google.cloud import aiplatform
from typing import Any
from proto.datetime_helpers import DatetimeWithNanoseconds
from google.cloud.aiplatform import base
from google.cloud import storage
from proto.datetime_helpers import DatetimeWithNanoseconds
# If a resource was updated within this number of seconds, do not delete.
RESOURCE_UPDATE_BUFFER_IN_SECONDS = 60 * 60 * 8
@@ -40,7 +50,7 @@ class ResourceCleanupManager(abc.ABC):
# Check that it wasn't created too recently, to prevent race conditions
if time_difference <= RESOURCE_UPDATE_BUFFER_IN_SECONDS:
print(
f"Skipping '{resource}' due update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
f"Skipping '{resource}' due to update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
)
return False
@@ -50,7 +60,7 @@ class ResourceCleanupManager(abc.ABC):
class VertexAIResourceCleanupManager(ResourceCleanupManager):
@property
@abc.abstractmethod
def vertex_ai_resource(self) -> base.VertexAiResourceNounWithFutureManager:
def vertex_ai_resource(self) -> Type[base.VertexAiResourceNounWithFutureManager]:
pass
@property
@@ -60,13 +70,15 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
def list(self) -> Any:
return self.vertex_ai_resource.list()
def resource_name(self, resource: Any) -> str:
def resource_name(
self, resource: Type[base.VertexAiResourceNounWithFutureManager]
) -> str:
return resource.display_name
def delete(self, resource):
resource.delete()
def get_seconds_since_modification(self, resource: Any) -> bool:
def get_seconds_since_modification(self, resource: Any) -> float:
update_time = resource.update_time
current_time = DatetimeWithNanoseconds.now(tz=update_time.tzinfo)
return (current_time - update_time).total_seconds()
@@ -74,14 +86,139 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
class DatasetResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.datasets._Dataset
dataset_types = [
aiplatform.ImageDataset,
aiplatform.TabularDataset,
aiplatform.TextDataset,
aiplatform.TimeSeriesDataset,
aiplatform.VideoDataset,
]
def list(self) -> Any:
return [
dataset
for dataset_type in self.dataset_types
for dataset in dataset_type.list()
]
class EndpointResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.Endpoint
def delete(self, resource):
for deployed_model_id in [
models.id for models in resource._gca_resource.deployed_models
]:
resource._undeploy(deployed_model_id=deployed_model_id)
resource.delete(force=True)
class ModelResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.Model
class MatchingEngineIndexResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.MatchingEngineIndex
class MatchingEngineIndexEndpointResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.MatchingEngineIndexEndpoint
def delete(self, resource):
resource.undeploy_all()
resource.delete(force=True)
class FeatureStoreCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.Featurestore
def resource_name(self, resource: Any) -> str:
return resource.name
class PipelineJobCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.PipelineJob
class TrainingJobCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.training_jobs._CustomTrainingJob
job_types = [
aiplatform.AutoMLImageTrainingJob,
aiplatform.AutoMLTextTrainingJob,
aiplatform.AutoMLTabularTrainingJob,
aiplatform.AutoMLVideoTrainingJob,
aiplatform.AutoMLForecastingTrainingJob,
aiplatform.CustomJob,
aiplatform.CustomTrainingJob,
aiplatform.CustomContainerTrainingJob,
aiplatform.CustomPythonPackageTrainingJob
]
def list(self) -> Any:
return [
job
for job_type in self.job_types
for job in job_type.list()
]
class HyperparameterTuningCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.HyperparameterTuningJob
class BatchPredictionJobCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.BatchPredictionJob
class ExperimentCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.Experiment
@property
def type_name(self) -> str:
return "Experiment"
def resource_name(self, resource: Any) -> str:
return resource.name
def get_seconds_since_modification(self, resource: Any) -> float:
update_time = resource._metadata_context.update_time
current_time = DatetimeWithNanoseconds.now()
return float(current_time.timestamp() - update_time.timestamp())
class BucketCleanupManager(ResourceCleanupManager):
vertex_ai_resource = storage.bucket.Bucket
def list(self) -> Any:
storage_client = storage.Client()
return list(storage_client.list_buckets())
def delete(self, resource):
try:
resource.delete(force=True)
except Exception as e:
print(e)
@property
def type_name(self) -> str:
return "Bucket"
def get_seconds_since_modification(self, resource: Any) -> float:
# Bucket has no last_update property, only time created
created_time = resource.time_created
current_time = DatetimeWithNanoseconds.now()
return float(current_time.timestamp() - created_time.timestamp())
def resource_name(self, resource: Any) -> str:
return resource.name
def is_deletable(self, resource: Any) -> bool:
time_difference = self.get_seconds_since_modification(resource)
if not self.resource_name(resource).startswith('your-bucket-name'):
print(f"Skipping '{resource}' not a Vertex AI notebook bucket")
return False
# Check that it wasn't created too recently, to prevent race conditions
if time_difference <= RESOURCE_UPDATE_BUFFER_IN_SECONDS:
print(
f"Skipping '{resource}' due to update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
)
return False
return True
+172
View File
@@ -0,0 +1,172 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
import argparse
import pathlib
import os
import execute_changed_notebooks_helper
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--test_percent",
type=int,
help="The percent of notebooks to be tested (between 1 and 100).",
required=False,
default=100,
)
parser.add_argument(
"--build_id",
type=str,
help="The build id (which may be a Cloud Build job specific or user explicit.",
required=True
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_service_account",
type=str,
help="A service account. This is used to inject a variable value into the notebook before running. This is not the account that will run the notebook.",
required=True,
)
parser.add_argument(
"--variable_vpc_network",
type=str,
help="The full VPC network name. See https://cloud.google.com/compute/docs/networks-and-firewalls#networks. Format is projects/{project}/global/networks/{network}, where {project} is a project number, as in '12345', and {network} is network name. See <https://cloud.google.com/compute/docs/reference/rest/v1/networks/insert> for details. This is used to inject a variable value into the notebook before running.",
required=False,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--timeout",
type=int,
help="Timeout in seconds",
default=86400,
required=False,
)
parser.add_argument(
"--private_pool_id",
type=str,
help="The private pool id.",
required=False,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
parser.add_argument(
"--dry_run",
type=str2bool,
default=False,
help="Dry run for testing - no execution",
)
args = parser.parse_args()
changed_notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
)
results_bucket = f"{args.artifacts_bucket}"
# artifacts_bucket may get set by trigger to a full gs:// folder path
if results_bucket.startswith("gs://"):
results_bucket = results_bucket[5:]
results_bucket = results_bucket.split('/')[0]
results_file = f"build_results/{args.build_id}.json"
if args.test_percent == 100:
notebooks = changed_notebooks
accumulative_results = {}
else:
accumulative_results = execute_changed_notebooks_helper.load_results(results_bucket, results_file)
notebooks = [changed_notebook for changed_notebook in changed_notebooks if execute_changed_notebooks_helper.select_notebook(changed_notebook, accumulative_results, args.test_percent)]
if args.dry_run:
print("Dry run ...\n")
for notebook in notebooks:
print(f"Would execute: {notebook}")
else:
execute_changed_notebooks_helper.process_and_execute_notebooks(
notebooks=notebooks,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
results_file=results_file,
should_parallelize=args.should_parallelize,
timeout=args.timeout,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
variable_service_account=args.variable_service_account,
variable_vpc_network=args.variable_vpc_network,
private_pool_id=args.private_pool_id
)
+608
View File
@@ -0,0 +1,608 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import concurrent
import dataclasses
import datetime
import functools
import json
import git
import operator
import os
import io
import json
import pathlib
import re
import subprocess
import random
from google.cloud import storage
import utils
from typing import List, Optional, Dict, Any
from utils import util
import execute_notebook_helper
import execute_notebook_remote
import nbformat
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
from ratemate import RateLimit
from tabulate import tabulate
from utils import NotebookProcessors, util
# A buffer so that workers finish before the orchestrating job
WORKER_TIMEOUT_BUFFER_IN_SECONDS: int = 60 * 60
PYTHON_VERSION = "3.9" # Set default python version
def format_timedelta(delta: datetime.timedelta) -> str:
"""Formats a timedelta duration to [N days] %H:%M:%S format"""
seconds = int(delta.total_seconds())
secs_in_a_day = 86400
secs_in_a_hour = 3600
secs_in_a_min = 60
days, seconds = divmod(seconds, secs_in_a_day)
hours, seconds = divmod(seconds, secs_in_a_hour)
minutes, seconds = divmod(seconds, secs_in_a_min)
time_fmt = f"{hours:02d}:{minutes:02d}:{seconds:02d}"
if days > 0:
suffix = "s" if days > 1 else ""
return f"{days} day{suffix} {time_fmt}"
return time_fmt
@dataclasses.dataclass
class NotebookExecutionResult:
name: str
path: str
duration: datetime.timedelta
start_time: datetime.datetime
is_pass: bool
log_url: str
output_uri: str
build_id: str
logs_bucket: str
error_message: Optional[str]
@property
def output_uri_web(self) -> Optional[str]:
if self.output_uri.startswith("gs://"):
return f"https://storage.googleapis.com/{self.output_uri[5:]}"
else:
return None
def load_results(results_bucket: str,
results_file: str) -> Dict[str,Any]:
'''
Load accumulated notebook test results
'''
print("Loading existing accumulative results ...")
accumulative_results = {}
try:
client = storage.Client()
bucket = client.bucket(results_bucket)
build_results_dir = os.path.dirname(results_file)
blobs = client.list_blobs(results_bucket, prefix=build_results_dir)
for blob in blobs:
content = util.download_blob_into_memory(results_bucket, blob.name, download_as_text=True)
build_results = json.loads(content)
for notebook in build_results:
if notebook in accumulative_results:
accumulative_results[notebook] += build_results[notebook]
else:
accumulative_results[notebook] = build_results[notebook]
print(accumulative_results)
except Exception as e:
print(e)
# If there are no accumulative results, an empty dict is returned
return accumulative_results
def select_notebook(changed_notebook: str,
accumulative_results: Dict[str, Any],
test_percent: int) -> bool:
'''
Algorithm to randomly select a notebook, but weight the propbability of selected based on past failures
'''
if changed_notebook in accumulative_results:
pass_count = accumulative_results[changed_notebook]['passed']
fail_count = accumulative_results[changed_notebook]['failed']
else:
pass_count = 1
fail_count = 0
inferred_failure_rate = fail_count / (pass_count + fail_count)
# If failure rate is high, the chance of testing should be higher
should_test_due_to_failure = random.uniform(0, 1) < inferred_failure_rate
# Additionally, only test a percentage of these
should_test_due_to_random_subset = random.uniform(0, 1) < test_percent
return should_test_due_to_failure and should_test_due_to_random_subset
def _process_notebook(
notebook_path: str,
variable_project_id: str,
variable_region: str,
variable_service_account: str,
variable_vpc_network: Optional[str],
):
# Read notebook
with open(notebook_path) as f:
nb = nbformat.read(f, as_version=4)
# Create preprocessors
remove_no_execute_cells_preprocessor = NotebookProcessors.RemoveNoExecuteCells()
update_variables_preprocessor = NotebookProcessors.UpdateVariablesPreprocessor(
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
"SERVICE_ACCOUNT": variable_service_account,
"VPC_NETWORK": variable_vpc_network,
},
)
unique_strings_preprocessor = NotebookProcessors.UniqueStringsPreprocessor()
# Use no-execute preprocessor
(
nb,
resources,
) = remove_no_execute_cells_preprocessor.preprocess(nb)
(nb, resources) = update_variables_preprocessor.preprocess(nb, resources)
(nb, resources) = unique_strings_preprocessor.preprocess(nb, resources)
with open(notebook_path, mode="w", encoding="utf-8") as new_file:
nbformat.write(nb, new_file)
def _get_notebook_python_version(notebook_path: str) -> str:
"""
Get the python version for running the notebook if it is specified in
the notebook.
"""
python_version = PYTHON_VERSION
# Load the notebook
file = open(notebook_path)
src = file.read()
nb_json = json.loads(src)
# Iterate over the cells in the ipynb
for cell in nb_json["cells"]:
if cell["cell_type"] == "markdown":
markdown = str.join("", cell["source"])
# Look for the python version specification pattern
re_match = re.search(
"python version = (\d\.\d)", markdown, flags=re.IGNORECASE
)
if re_match:
# get the version number
python_version = re_match.group(1)
break
return python_version
def _create_tag(filepath: str) -> str:
tag = os.path.basename(os.path.normpath(filepath))
tag = re.sub("[^0-9a-zA-Z_.-]+", "-", tag)
if tag.startswith(".") or tag.startswith("-"):
tag = tag[1:]
return tag
rate_limit = RateLimit(max_count=10, per=60, greedy=True)
def process_and_execute_notebook(
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
variable_service_account: str,
variable_vpc_network: Optional[str],
private_pool_id: Optional[str],
deadline: datetime.datetime,
notebook: str,
should_get_tail_logs: bool = False,
) -> NotebookExecutionResult:
rate_limit.wait() # wait before creating the task
print(f"Running notebook: {notebook}")
# Handle empty strings
if not variable_vpc_network:
variable_vpc_network = None
if not private_pool_id:
private_pool_id = None
# Create paths
notebook_output_uri = "/".join([artifacts_bucket, pathlib.Path(notebook).name])
# Create tag from notebook
tag = _create_tag(filepath=notebook)
result = NotebookExecutionResult(
name=tag,
path=notebook,
duration=datetime.timedelta(seconds=0),
start_time=datetime.datetime.now(),
is_pass=False,
output_uri=notebook_output_uri,
log_url="",
build_id="",
logs_bucket="",
error_message=None,
)
# TODO: Handle cases where multiple notebooks have the same name
operation = None
try:
# Get the python version for running the notebook if specified
notebook_exec_python_version = _get_notebook_python_version(
notebook_path=notebook
)
print(f"Running notebook with python {notebook_exec_python_version}")
# Pre-process notebook by substituting variable names
_process_notebook(
notebook_path=notebook,
variable_project_id=variable_project_id,
variable_region=variable_region,
variable_service_account=variable_service_account,
variable_vpc_network=variable_vpc_network,
)
# Upload the pre-processed code to a GCS bucket
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
# Calculate timeout in seconds
timeout_in_seconds = max(
int((deadline - datetime.datetime.now()).total_seconds()), 1
)
operation = execute_notebook_remote.execute_notebook_remote(
code_archive_uri=code_archive_uri,
notebook_uri=notebook,
notebook_output_uri=notebook_output_uri,
container_uri=container_uri,
tag=tag,
private_pool_id=private_pool_id,
private_pool_region=variable_region,
timeout_in_seconds=timeout_in_seconds,
python_version=notebook_exec_python_version,
)
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
result.build_id = operation_metadata.build.id
result.log_url = operation_metadata.build.log_url
result.logs_bucket = operation_metadata.build.logs_bucket
# Block and wait for the result
operation_result = operation.result(timeout=timeout_in_seconds)
result.duration = datetime.datetime.now() - result.start_time
result.is_pass = True
print(f"{notebook} PASSED in {format_timedelta(result.duration)}.")
except Exception as error:
result.error_message = str(error)
if operation and should_get_tail_logs:
# Extract the logs
logs_bucket = operation_metadata.build.logs_bucket
# Download tail end of logs file
log_file_uri = f"{logs_bucket}/log-{result.build_id}.txt"
# Use gcloud to get tail
try:
result.error_message = subprocess.check_output(
["gsutil", "cat", "-r", "-1000", log_file_uri], encoding="UTF-8"
)
except Exception as error:
result.error_message = str(error)
result.duration = datetime.datetime.now() - result.start_time
result.is_pass = False
print(
f"{notebook} FAILED in {format_timedelta(result.duration)}: {result.error_message}"
)
return result
def get_changed_notebooks(
test_paths_file: str,
base_branch: Optional[str] = None,
) -> List[str]:
"""
Get the notebooks that exist under the folders defined in the test_paths_file.
It only returns notebooks that have differences from the Git base_branch.
"""
test_paths = []
with open(test_paths_file) as file:
lines = [line.strip() for line in file.readlines()]
lines = [line for line in lines if len(line) > 0]
test_paths = [line for line in lines]
if len(test_paths) == 0:
raise RuntimeError("No test folders found.")
print(f"Checking folders: {test_paths}")
# Find notebooks
notebooks = []
# Instantiate GitPython objects
repo = git.Repo(os.getcwd())
index = repo.index
if base_branch:
# Get the point at which this branch branches off from main
branching_commits = repo.merge_base("HEAD", f"origin/{base_branch}")
if len(branching_commits) > 0:
branching_commit = branching_commits[0]
print(f"Looking for notebooks that changed from branch: {branching_commit}")
notebooks = [
diff.b_path
for diff in index.diff(branching_commit, paths=test_paths)
if diff.b_path is not None
]
else:
notebooks = []
else:
print(f"Looking for all notebooks.")
notebooks_str = subprocess.check_output(["git", "ls-files"] + test_paths)
notebooks = notebooks_str.decode("utf-8").split("\n")
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
if len(notebooks) > 0:
print(f"Found {len(notebooks)} notebooks:")
for notebook in notebooks:
print(f"\t{notebook}")
return notebooks
def _save_results(results: List[NotebookExecutionResult],
artifacts_bucket: str,
results_file: str):
artifacts_bucket = artifacts_bucket.replace("gs://", "").split('/')[0]
print("Updating build results ...")
build_results = {}
for result in results:
if result.is_pass:
pass_count = 1
fail_count = 0
else:
pass_count = 0
fail_count = 1
build_results[result.path] = {
'duration': result.duration.total_seconds(),
'start_time': str(result.start_time),
'passed': pass_count,
'failed': fail_count
}
print(f"adding {result.path}")
print("Saving accumulative results ...")
content = json.dumps(build_results)
client = storage.Client()
bucket = client.get_bucket(artifacts_bucket)
bucket.blob(str(results_file)).upload_from_string(content, 'text/json')
def process_and_execute_notebooks(
notebooks: List[str],
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
results_file: str,
should_parallelize: bool,
timeout: int,
variable_project_id: str,
variable_region: str,
variable_service_account: str,
variable_vpc_network: Optional[str] = None,
private_pool_id: Optional[str] = None,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
results_file (str):
Required: The path to the artifacts bucket to save results
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
timeout (str):
Required. Timeout string according to https://cloud.google.com/build/docs/build-config-file-schema#timeout.
"""
# Calculate deadline
deadline = datetime.datetime.now() + datetime.timedelta(
seconds=max(timeout - WORKER_TIMEOUT_BUFFER_IN_SECONDS, 0)
)
if len(notebooks) >= 1:
notebook_execution_results: List[NotebookExecutionResult] = []
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
if should_parallelize and len(notebooks) > 1:
print(
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
)
with concurrent.futures.ThreadPoolExecutor(max_workers=100) as executor:
print(f"Max workers: {executor._max_workers}")
notebook_execution_results = list(
executor.map(
functools.partial(
process_and_execute_notebook,
container_uri,
staging_bucket,
artifacts_bucket,
variable_project_id,
variable_region,
variable_service_account,
variable_vpc_network,
private_pool_id,
deadline,
),
notebooks,
)
)
else:
notebook_execution_results = [
process_and_execute_notebook(
container_uri=container_uri,
staging_bucket=staging_bucket,
artifacts_bucket=artifacts_bucket,
variable_project_id=variable_project_id,
variable_region=variable_region,
variable_service_account=variable_service_account,
variable_vpc_network=variable_vpc_network,
private_pool_id=private_pool_id,
deadline=deadline,
notebook=notebook,
)
for notebook in notebooks
]
print("\n=== RESULTS ===\n")
results_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
result.name,
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.log_url,
result.output_uri,
result.output_uri_web,
result.logs_bucket,
]
for result in results_sorted
],
headers=[
"build_tag",
"status",
"duration",
"log_url",
"output_uri",
"output_uri_web",
"logs_bucket",
],
)
)
if len(notebooks) == 1:
print("=" * 100)
print("The notebook execution build log:\n")
print("=" * 100)
build_id = results_sorted[0].build_id
logs_bucket_name = (results_sorted[0].logs_bucket).replace("gs://", "")
log_file_name = f"log-{build_id}.txt"
log_contents = util.download_blob_into_memory(
bucket_name=logs_bucket_name,
blob_name=log_file_name,
download_as_text=True,
)
# Remove extra steps from the log
match = re.search("starting Step #4", log_contents, flags=re.IGNORECASE)
if match is not None:
match_index = match.span()[0]
print(log_contents[match_index:])
else:
print(log_contents)
_save_results(results_sorted,
artifacts_bucket,
results_file)
print("\n=== END RESULTS===\n")
total_notebook_duration = functools.reduce(
operator.add,
[datetime.timedelta(seconds=0)]
+ [result.duration for result in results_sorted],
)
print(
f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}"
)
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
else:
print("No notebooks modified in this pull request.")
+41
View File
@@ -0,0 +1,41 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to download (optional) and run a single notebook locally"""
import argparse
import execute_notebook_helper
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
parser.add_argument(
"--notebook_source",
type=str,
help="Local filepath or GCS URI to notebook.",
required=True,
)
parser.add_argument(
"--output_file_or_uri",
type=str,
help="Local file or GCS URI to save executed notebook to.",
required=True,
)
args = parser.parse_args()
execute_notebook_helper.execute_notebook(
notebook_source=args.notebook_source,
output_file_or_uri=args.output_file_or_uri,
should_log_output=True,
)
+102
View File
@@ -0,0 +1,102 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook locally"""
import errno
import os
import shutil
import sys
import papermill as pm
from google.cloud.aiplatform import utils
from utils import util
# This script is used to execute a notebook and write out the output notebook.
# This is used to force papermill to use this kernel to run the notebook instead of any defined inside the notebook itself
DEFAULT_KERNEL_NAME = "python3"
def execute_notebook(
notebook_source: str,
output_file_or_uri: str,
should_log_output: bool,
):
"""Execute a single notebook using Papermill"""
file_name = os.path.basename(os.path.normpath(notebook_source))
# Download notebook if it's a GCS URI
if notebook_source.startswith("gs://"):
# Extract uri components
bucket_name, prefix = utils.extract_bucket_and_prefix_from_gcs_path(
notebook_source
)
# Download remote notebook to local file system
notebook_source = file_name
util.download_file(
bucket_name=bucket_name, blob_name=prefix, destination_file=notebook_source
)
execution_exception = None
print("\n=== DOWNLOAD EXECUTED NOTEBOOK ===\n")
print(f"Please debug the executed notebook by downloading the executed notebook:")
print("Option 1. Using gsutil. Run the following command in your terminal.")
print(f'\tgsutil cp "{output_file_or_uri}" .')
print("Option 2. Using this link.")
print(f"\thttps://storage.googleapis.com/{output_file_or_uri[5:]}")
print("\n======\n")
# Execute notebook
try:
# Execute notebook
pm.execute_notebook(
input_path=notebook_source,
output_path=notebook_source,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
kernel_name=DEFAULT_KERNEL_NAME,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
)
except Exception as exception:
execution_exception = exception
finally:
# Copy executed notebook
if output_file_or_uri.startswith("gs://"):
# Upload to GCS path
util.upload_file(notebook_source, remote_file_path=output_file_or_uri)
print("\n=== EXECUTION FINISHED ===\n")
else:
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_or_uri)):
try:
os.makedirs(os.path.dirname(output_file_or_uri))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
print(f"Writing output to: {output_file_or_uri}")
shutil.move(notebook_source, output_file_or_uri)
if execution_exception:
raise execution_exception
+105
View File
@@ -0,0 +1,105 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook on Google Cloud Build"""
from re import sub
from typing import Optional
import google.auth
import yaml
from google.api_core import client_options, operation
from google.cloud.aiplatform import utils
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from google.protobuf import duration_pb2
from yaml.loader import FullLoader
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
def execute_notebook_remote(
code_archive_uri: str,
notebook_uri: str,
notebook_output_uri: str,
container_uri: str,
private_pool_id: Optional[str],
private_pool_region: Optional[str],
tag: Optional[str],
timeout_in_seconds: Optional[int] = None,
python_version: Optional[str] = None
) -> operation.Operation:
"""Create and execute a single notebook on Google Cloud Build"""
# Load build steps from YAML
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
substitutions = {
"_PYTHON_IMAGE": container_uri,
"_NOTEBOOK_GCS_URI": notebook_uri,
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
"_PYTHON_VERSION" : f"python{python_version}"
}
if python_version is not None:
substitutions["_PYTHON_VERSION"] = "python" + python_version
build = cloudbuild_v1.Build()
options: Optional[client_options.ClientOptions] = None
if private_pool_id and private_pool_region:
# substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
build.options = cloudbuild_config.get("options")
build.options.pool = {"name": private_pool_id}
# Switch to the regional endpoint of the pool
options = client_options.ClientOptions(
api_endpoint=f"{private_pool_region}-{SERVICE_BASE_PATH}"
)
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
(
source_archived_file_gcs_bucket,
source_archived_file_gcs_object,
) = utils.extract_bucket_and_prefix_from_gcs_path(code_archive_uri)
build.source = Source(
storage_source=StorageSource(
bucket=source_archived_file_gcs_bucket,
object_=source_archived_file_gcs_object,
)
)
build.steps = cloudbuild_config["steps"]
build.substitutions = substitutions
build.timeout = duration_pb2.Duration(seconds=timeout_in_seconds)
build.queue_ttl = duration_pb2.Duration(seconds=timeout_in_seconds)
if tag:
build.tags = [tag]
operation = client.create_build(project_id=project_id, build=build)
# Print the in-progress operation
# print("IN PROGRESS:")
# print(operation.metadata)
# Print the completed status
# print("RESULT:", result.status)
return operation
@@ -0,0 +1,38 @@
steps:
# Show the gcloud info and check if gcloud exists
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'gcloud config list --quiet'
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- ${_PYTHON_VERSION} .cloud-build/CheckPythonVersion.py -q
# Create a virtual environment
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- ${_PYTHON_VERSION} -m venv workspace/env
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- . workspace/env/bin/activate &&
python -m pip -q install -U pip &&
python -m pip -q install -U -r .cloud-build/requirements.txt
# Install Python dependencies and run testing script
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- |
. workspace/env/bin/activate &&
python .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"
env:
- 'IS_TESTING=1'
timeout: 86400s
@@ -4,41 +4,42 @@ steps:
entrypoint: /bin/sh
args:
- -c
- 'gcloud config list'
- gcloud config list --quiet
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 .cloud-build/CheckPythonVersion.py'
# Fetch base branch if required
- python3 .cloud-build/CheckPythonVersion.py -q
# Fetch full repo for diff purposes
- name: gcr.io/cloud-builders/git
args: [fetch, --unshallow, --quiet]
# Create a virtual environment
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'if [ -n "${_BASE_BRANCH}" ]; then git fetch origin "${_BASE_BRANCH}":refs/remotes/origin/"${_BASE_BRANCH}"; else echo "Skipping fetch."; fi'
- python3 -m venv workspace/env
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: pip
args: ['install', '--upgrade', '--user', '--requirement', '.cloud-build/requirements.txt']
entrypoint: /bin/sh
args:
- -c
- . workspace/env/bin/activate &&
python3 -m pip -q install -U pip &&
python3 -m pip -q install -U -r .cloud-build/requirements.txt
# Install Python dependencies and run testing script
# TODO: Only pass in private_pool_id if it is set
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --output_folder ${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
- |
. workspace/env/bin/activate &&
python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} --variable_service_account ${_GCP_SERVICE_ACCOUNT} --variable_vpc_network "${_GPC_VPC_NETWORK_NAME}" `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi` --build_id ${BUILD_ID} --test_percent=${_TEST_PERCENT}
env:
- 'IS_TESTING=1'
# Manually copy artifacts to GCS
- name: gcr.io/cloud-builders/gsutil
entrypoint: /bin/sh
args:
- -c
- 'if [ $(ls -pR "/workspace/${BUILD_ID}" | grep -v / | grep -v ^$ | wc -l) -ne 0 ]; then gsutil -m -q rsync -r "/workspace/${BUILD_ID}" "gs://${_GCS_ARTIFACTS_BUCKET}/test-artifacts/PR_${_PR_NUMBER}/BUILD_${BUILD_ID}/"; else echo "No artifacts to copy."; fi'
# Fail if there is anything in the failure folder
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'echo "Download executed notebooks with this command: \"mkdir -p artifacts && gsutil rsync -r gs://${_GCS_ARTIFACTS_BUCKET}/test-artifacts/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} artifacts/\"" && if [ "$(ls -A /workspace/${BUILD_ID}/failure | wc -l)" -ne 0 ]; then exit 1; else exit 0; fi'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
+16 -7
View File
@@ -1,8 +1,17 @@
ipython>=7.0
jupyter>=1.0
nbconvert>=6.0
papermill>=2.3
numpy>=1.19
pandas>=1.2
matplotlib>=3.4
ipython
numpy
jupyter
nbconvert
papermill
matplotlib
tabulate
google-cloud-aiplatform
google-cloud-storage
google-cloud-build
google-cloud-storage
ratemate
GitPython
tqdm
fsspec
pandas
+40
View File
@@ -0,0 +1,40 @@
notebooks/official/training/pytorch_gcs_data_training.ipynb
notebooks/official/custom/custom_training_tensorboard_profiler.ipynb
notebooks/official/custom/custom-tabular-bq-managed-dataset.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-custom-jobs.ipynb
notebooks/official/tabnet/tabnet_vertex_tutorial.ipynb
notebooks/official/tabnet/get_started_with_tabnet.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_automl_text.ipynb
notebooks/official/pipelines/multicontender_vs_champion_deployment_method.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_automl_images.ipynb
notebooks/official/pipelines/rapid_prototyping_bqml_automl.ipynb
notebooks/official/pipelines/challenger_vs_blessed_deployment_method.ipynb
notebooks/official/matching_engine/sdk_matching_engine_create_stack_overflow_embeddings.ipynb
notebooks/official/matching_engine/sdk_matching_engine_for_indexing.ipynb
notebooks/official/matching_engine/sdk_matching_engine_create_text_to_image_embeddings.ipynb
notebooks/official/explainable_ai/sdk_custom_image_classification_online_explain.ipynb
notebooks/official/explainable_ai/xai_image_classification_feature_attributions.ipynb
notebooks/official/explainable_ai/sdk_custom_image_classification_batch_explain.ipynb
notebooks/official/tabular_workflows/tabnet_on_vertex_pipelines.ipynb
notebooks/official/model_registry/get_started_with_model_registry.ipynb
notebooks/official/model_registry/bqml_vertexai_model_registry.ipynb
notebooks/official/sdk/SDK_Custom_Training_Python_Package_Managed_Text_Dataset_Tensorflow_Serving_Container.ipynb
notebooks/official/model_monitoring/batch_prediction_model_monitoring.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_setup.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_custom.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_custom_tf_serving.ipynb
notebooks/official/model_monitoring/model_monitoring.ipynb
notebooks/official/tensorboard/tensorboard_profiler_custom_training_with_prebuilt_container.ipynb
notebooks/official/tensorboard/tensorboard_hyperparameter_tuning_with_hparams.ipynb
notebooks/official/tensorboard/tensorboard_profiler_custom_training.ipynb
notebooks/official/model_evaluation/custom_tabular_regression_model_evaluation.ipynb
notebooks/official/model_evaluation/custom_tabular_classification_model_evaluation.ipynb
notebooks/official/model_evaluation/automl_video_classification_model_evaluation.ipynb
notebooks/official/experiments/comparing_local_trained_models.ipynb
notebooks/official/automl/automl_image_classification_online_online_prediction.ipynb
notebooks/official/automl/automl-text-classification.ipynb
notebooks/official/automl/sdk_automl_video_object_tracking_batch.ipynb
notebooks/official/feature_store/sdk-feature-store-pandas.ipynb
notebooks/official/prediction/custom_batch_prediction_feature_filter.ipynb
notebooks/official/prediction/pytorch_image_classification_with_prebuilt_serving_containers.ipynb
+5
View File
@@ -0,0 +1,5 @@
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/custom/custom-tabular-bq-managed-dataset.ipynb
.cloud-build/tests/python_version_test.ipynb
+80
View File
@@ -0,0 +1,80 @@
notebooks/official/training/hyperparameter_tuning_tensorflow.ipynb
notebooks/official/training/get_started_with_vertex_distributed_training.ipynb
notebooks/official/training/hyperparameter_tuning_xgboost.ipynb
notebooks/official/training/multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb
notebooks/official/training/distributed_hyperparameter_tuning.ipynb
notebooks/official/training/pytorch-text-sentiment-classification-custom-train-deploy.ipynb
notebooks/official/training/xgboost_data_parallel_training_on_cpu_using_dask.ipynb
notebooks/official/training/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb
notebooks/official/bigquery_ml/get_started_with_bqml_training.ipynb
notebooks/official/bigquery_ml/bqml-online-prediction.ipynb
notebooks/official/custom/custom_training_container_and_model_registry.ipynb
notebooks/official/custom/sdk-custom-image-classification-online.ipynb
notebooks/official/custom/sdk-custom-image-classification-batch.ipynb
notebooks/official/custom/SDK_FBProphet_Forecasting_Online.ipynb
notebooks/official/custom/get_started_vertex_training_xgboost.ipynb
notebooks/official/custom/get_started_with_vertex_endpoint_and_shared_vm.ipynb
notebooks/official/custom/SDK_Custom_Container_Prediction.ipynb
notebooks/official/reduction_server/pytorch_distributed_training_reduction_server.ipynb
notebooks/official/tabnet/ai-explanations-tabnet-algorithm.ipynb
notebooks/official/vizier/get_started_vertex_vizier.ipynb
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/get_started_with_hpt_pipeline_components.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_automl_tabular.ipynb
notebooks/official/pipelines/custom_tabular_train_batch_pred_bq_pipeline.ipynb
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_model_upload_predict_evaluate.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_model_train_upload_deploy.ipynb
notebooks/official/pipelines/get_started_with_machine_management.ipynb
notebooks/official/pipelines/custom_model_training_and_batch_prediction.ipynb
notebooks/official/pipelines/control_flow_kfp.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_bqml_text.ipynb
notebooks/official/pipelines/pipelines_intro_kfp.ipynb
notebooks/official/pipelines/automl_tabular_classification_beans.ipynb
notebooks/official/pipelines/google_cloud_pipeline_components_dataproc_tabular.ipynb
notebooks/official/explainable_ai/sdk_automl_tabular_classification_online_explain.ipynb
notebooks/official/explainable_ai/sdk_custom_tabular_regression_online_explain.ipynb
notebooks/official/explainable_ai/sdk_automl_tabular_binary_classification_batch_explain.ipynb
notebooks/official/explainable_ai/sdk_custom_tabular_regression_online_explain_get_metadata.ipynb
notebooks/official/explainable_ai/sdk_custom_tabular_regression_batch_explain.ipynb
notebooks/official/tabular_workflows/prophet_on_vertex_pipelines.ipynb
notebooks/official/tabular_workflows/wide_and_deep_on_vertex_pipelines.ipynb
notebooks/official/sdk/SDK_AutoML_Video_Classification.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_automl.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_automl_image_batch.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_automl_image_online.ipynb
notebooks/official/model_monitoring/get_started_with_model_monitoring_xgboost.ipynb
notebooks/official/tensorboard/tensorboard_custom_training_with_custom_container.ipynb
notebooks/official/tensorboard/tensorboard_custom_training_with_prebuilt_container.ipynb
notebooks/official/tensorboard/tensorboard_vertex_ai_pipelines_integration.ipynb
notebooks/official/model_evaluation/automl_text_classification_model_evaluation.ipynb
notebooks/official/model_evaluation/get_started_with_custom_model_evaluation_import.ipynb
notebooks/official/model_evaluation/automl_tabular_classification_model_evaluation.ipynb
notebooks/official/model_evaluation/automl_tabular_regression_model_evaluation.ipynb
notebooks/official/experiments/get_started_with_vertex_experiments.ipynb
notebooks/official/experiments/comparing_pipeline_runs.ipynb
notebooks/official/experiments/get_started_with_vertex_experiments_autologging.ipynb
notebooks/official/experiments/build_model_experimentation_lineage_with_prebuild_code.ipynb
notebooks/official/experiments/delete_outdated_tensorboard_experiments.ipynb
notebooks/official/automl/sdk_automl_tabular_regression_batch_bq.ipynb
notebooks/official/automl/sdk_automl_text_sentiment_analysis_online.ipynb
notebooks/official/automl/sdk_automl_text_entity_extraction_online.ipynb
notebooks/official/automl/sdk_automl_forecasting_hierarchical_batch.ipynb
notebooks/official/automl/automl_text_entity_extraction_batch_prediction.ipynb
notebooks/official/automl/automl_image_classification_batch_prediction.ipynb
notebooks/official/automl/automl_text_sentiment_analysis_batch_prediction.ipynb
notebooks/official/automl/sdk_automl_tabular_regression_online_bq.ipynb
notebooks/official/automl/get_started_automl_training.ipynb
notebooks/official/automl/automl-tabular-classification.ipynb
notebooks/official/automl/automl_image_object_detection_export_edge.ipynb
notebooks/official/automl/sdk_automl_image_object_detection_batch.ipynb
notebooks/official/automl/automl_tabular_on_vertex_pipelines.ipynb
notebooks/official/automl/sdk_automl_video_classification_batch.ipynb
notebooks/official/automl/sdk_automl_video_action_recognition_batch.ipynb
notebooks/official/automl/sdk_automl_tabular_forecasting_batch.ipynb
notebooks/official/automl/automl_image_object_detection_online_prediction.ipynb
notebooks/official/automl/automl_forecasting_bqml_arima_plus_comparison.ipynb
notebooks/official/datasets/get_started_bq_datasets.ipynb
notebooks/official/datasets/get_started_with_data_labeling.ipynb
notebooks/official/feature_store/feature_store_streaming_ingestion_sdk.ipynb
+1
View File
@@ -0,0 +1 @@
notebooks/official/custom/custom-tabular-bq-managed-dataset.ipynb
+46
View File
@@ -0,0 +1,46 @@
# grep PASSED tests.txt | cut -c 10-100 >passed.txt
import os
repo_dir = '/home/jupyter/vertex-ai-samples/'
repo_dir_len = len(repo_dir)
official_dir = repo_dir + 'notebooks/official'
entries = os.scandir(official_dir)
folders = []
for entry in entries:
if entry.is_dir():
folders.append(entry.path)
# Passing
with open('passed.txt', 'r') as pass_file:
notebook_names = pass_file.readlines()
notebooks = []
for folder in folders:
entries = os.scandir(folder)
for entry in entries:
for notebook in notebook_names:
if entry.name == notebook.rstrip():
notebooks.append(entry.path[repo_dir_len:])
with open('passing_tests.txt', 'w') as f:
for notebook in notebooks:
f.write(notebook + '\n')
# Failing
with open('failed.txt', 'r') as fail_file:
notebook_names = fail_file.readlines()
notebooks = []
for folder in folders:
entries = os.scandir(folder)
for entry in entries:
for notebook in notebook_names:
if entry.name == notebook.rstrip():
notebooks.append(entry.path[repo_dir_len:])
with open('failing_tests.txt', 'w') as f:
for notebook in notebooks:
f.write(notebook + '\n')
@@ -0,0 +1,61 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "57a3d44ed8a8"
},
"source": [
"### Set up your Google Cloud project\n",
"\n",
"**_NOTE_**: This notebook has been tested in the following environment:\n",
"\n",
"* Python version = 3.7\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI API and Compute Engine API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,compute_component).\n",
"\n",
"1. If you are running this notebook locally, you will need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c6516f90311b"
},
"outputs": [],
"source": [
"# test if the right python version is being used\n",
"import sys\n",
"\n",
"actual_python_version = f\"{sys.version_info.major}.{sys.version_info.minor}\"\n",
"print(f\"Runtime python version: {actual_python_version}\")\n",
"\n",
"assert actual_python_version == \"3.7\", \"Wrong python version!\""
]
}
],
"metadata": {
"colab": {
"name": "python_version_test.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -13,9 +13,13 @@
# See the License for the specific language governing permissions and
# limitations under the License.
from nbconvert.preprocessors import Preprocessor
from typing import Dict
import UpdateNotebookVariables
import random
import string
from nbconvert.preprocessors import Preprocessor
from . import UpdateNotebookVariables as update_notebook_variables
class RemoveNoExecuteCells(Preprocessor):
@@ -41,7 +45,7 @@ class UpdateVariablesPreprocessor(Preprocessor):
# VARIABLE_NAME = '[description]'
for variable_name, variable_value in replacement_map.items():
content = UpdateNotebookVariables.get_updated_value(
content = update_notebook_variables.get_updated_value(
content=content,
variable_name=variable_name,
variable_value=variable_value,
@@ -60,4 +64,37 @@ class UpdateVariablesPreprocessor(Preprocessor):
executable_cells.append(cell)
notebook.cells = executable_cells
return notebook, resources
return notebook, resources
# Generate a uuid of a specifed length
def generate_uuid(length: int = 8) -> str:
return "".join(random.choices(string.ascii_lowercase + string.digits, k=length))
class UniqueStringsPreprocessor(Preprocessor):
# A preprocessor that replaces strings that end with "-unique" or "_unique" with a uuid.
@staticmethod
def update_unique_strings(content: str):
# Replace strings that end with "-unique" or "_unique" with a uuid.
unique_id = generate_uuid()
return (
content.replace('-unique"', f'-{unique_id}"')
.replace("-unique'", f'-{unique_id}"')
.replace('_unique"', f'_{unique_id}"')
.replace("_unique'", f'_{unique_id}"')
)
def preprocess(self, notebook, resources=None):
executable_cells = []
for cell in notebook.cells:
if cell.cell_type == "code":
cell.source = self.update_unique_strings(
content=cell.source,
)
executable_cells.append(cell)
notebook.cells = executable_cells
return notebook, resources
@@ -0,0 +1,42 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import re
"""
This script is used to update variables in the notebook via regex
It requires variables to be defined in particular format
For example, if your variable was PROJECT_ID, use:
PROJECT_ID = "[your_project_here]"
Single-quotes also work:
PROJECT_ID = '[your_project_here]'
Variables in conditionals can also be replaced:
PROJECT_ID == "[your_project_here]"
"""
def get_updated_value(content: str, variable_name: str, variable_value: str) -> str:
return re.sub(
rf"({variable_name}.*? = .*?[\",\'])\[.+?\]([\",\'].*?)",
rf"\g<1>{variable_value}\g<2>",
content,
flags=re.M,
)
View File
@@ -0,0 +1,14 @@
from utils import NotebookProcessors
def test_update_value():
# Test that the content was updated
preprocessor = NotebookProcessors.UniqueStringsPreprocessor()
content = 'PROJECT_ID = "your-project-id-unique"'
new_content = preprocessor.update_unique_strings(content)
assert new_content != content
assert new_content.startswith('PROJECT_ID = "your-project-id-')
assert new_content.endswith('"')
@@ -0,0 +1,63 @@
from utils import UpdateNotebookVariables
def test_update_value():
new_content = UpdateNotebookVariables.get_updated_value(
content='asdf\nPROJECT_ID = "[your-project-id]" #@param {type:"string"} \nasdf',
variable_name="PROJECT_ID",
variable_value="sample-project",
)
assert (
new_content
== 'asdf\nPROJECT_ID = "sample-project" #@param {type:"string"} \nasdf'
)
def test_update_value_single_quotes():
new_content = UpdateNotebookVariables.get_updated_value(
content="PROJECT_ID = '[your-project-id]'",
variable_name="PROJECT_ID",
variable_value="sample-project",
)
assert new_content == "PROJECT_ID = 'sample-project'"
def test_update_value_avoidance():
new_content = UpdateNotebookVariables.get_updated_value(
content="PROJECT_ID = shell_output[0] ",
variable_name="PROJECT_ID",
variable_value="sample-project",
)
assert new_content == "PROJECT_ID = shell_output[0] "
def test_region():
new_content = UpdateNotebookVariables.get_updated_value(
content='REGION = "[your-region]" # @param {type:"string"}',
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
def test_region_equal_equals_ignore():
# Tests that == is ignored
new_content = UpdateNotebookVariables.get_updated_value(
content='REGION == "[your-region]" # @param {type:"string"}',
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION == "[your-region]" # @param {type:"string"}'
def test_service_account():
# Tests that == is ignored
new_content = UpdateNotebookVariables.get_updated_value(
content='SERVICE_ACCOUNT = "[your-service-account]" # @param {type:"string"}',
variable_name="SERVICE_ACCOUNT",
variable_value="12345-compute@developer.gserviceaccount.com",
)
assert (
new_content
== 'SERVICE_ACCOUNT = "12345-compute@developer.gserviceaccount.com" # @param {type:"string"}'
)
+86
View File
@@ -0,0 +1,86 @@
import os
import subprocess
import tarfile
import uuid
from datetime import datetime
from typing import Optional, Union
from google.auth import credentials as auth_credentials
from google.cloud import storage
from google.cloud.aiplatform import utils
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
"""Copies a remote GCS file to a local path"""
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
subprocess.check_output(
["gsutil", "cp", remote_file_path, destination_file], encoding="UTF-8"
)
return destination_file
def upload_file(
local_file_path: str,
remote_file_path: str,
) -> str:
"""Copies a local file to a GCS path"""
subprocess.check_output(
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
)
return remote_file_path
def archive_code_and_upload(staging_bucket: str):
# Archive all source in current directory
unique_id = uuid.uuid4()
source_archived_file = f"source_archived_{unique_id}.tar.gz"
git_files = subprocess.check_output(
["git", "ls-tree", "-r", "HEAD", "--name-only"], encoding="UTF-8"
).split("\n")
with tarfile.open(source_archived_file, "w:gz") as tar:
for file in git_files:
if len(file) > 0 and os.path.exists(file):
tar.add(file)
# Upload archive to GCS bucket
source_archived_file_gcs = upload_file(
local_file_path=f"{source_archived_file}",
remote_file_path="/".join(
[staging_bucket, "code_archives", source_archived_file]
),
)
print(f"Uploaded source code archive to {source_archived_file_gcs}")
return source_archived_file_gcs
def download_blob_into_memory(
bucket_name: str, blob_name: str, download_as_text: Optional[bool] = False
) -> Union[bytes, str]:
"""
Downloads a blob into memory as byte or as text if
download_as_text is set to True.
"""
storage_client = storage.Client()
bucket = storage_client.bucket(bucket_name)
# Construct a client side representation of a blob.
blob = bucket.blob(blob_name)
# Download the blob content
if download_as_text:
contents = blob.download_as_text()
else:
contents = blob.download_as_bytes()
print(f"Downloaded storage object {blob_name} from bucket {bucket_name}.")
return contents
+19 -8
View File
@@ -1,17 +1,28 @@
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/notebooks/notebook_template.ipynb) as a starting point.
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.
<br>
--- YOUR PR SUMMARY GOES HERE ---
<br><br><br>
**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
<br>
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
2. If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
<br>
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) folder:
3. If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
+6 -4
View File
@@ -7,13 +7,15 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Set up Python
uses: actions/setup-python@v2
uses: actions/setup-python@v4
with:
python-version: '3.x'
- name: Fetch pull request branch
uses: actions/checkout@v2
uses: actions/checkout@v3
with:
fetch-depth: 0
- name: Fetch base master branch
run: git fetch -u "$GITHUB_SERVER_URL/$GITHUB_REPOSITORY" master:master
- name: Fetch base main branch
run: git fetch -u "$GITHUB_SERVER_URL/$GITHUB_REPOSITORY" main:main
- name: Install requirements
run: python3 -m pip install -U -r .github/workflows/linter/requirements.txt
- name: Format and lint notebooks
+20
View File
@@ -0,0 +1,20 @@
# To use this image, run this command with the desired notebook args from the top-level vertex-ai-samples directory:
# 1. To lint all changed notebooks:
# docker run -v ${PWD}:/setup/app gcr.io/python-docs-samples-tests/notebook_linter:latest
# 2. To lint specific notebooks:
# docker run -v ${PWD}:/setup/app gcr.io/python-docs-samples-tests/notebook_linter:latest notebooks/1.ipynb notebooks/2.ipynb
FROM python:3.10
WORKDIR setup
COPY ./requirements.txt .
COPY ./run_linter.sh .
# Install dependencies.
RUN pip install --upgrade pip
RUN pip install -r requirements.txt
WORKDIR app
ENTRYPOINT ["/setup/run_linter.sh"]
+6 -5
View File
@@ -2,8 +2,9 @@ git+https://github.com/tensorflow/docs
ipython
jupyter
nbconvert
black==20.8b1
pyupgrade==2.7.3
isort==5.6.4
flake8==3.9.0
nbqa==0.6.0
black==22.12.0
pyupgrade==3.4.0
isort==5.12.0
flake8==6.0.0
nbqa==1.5.3
+21 -11
View File
@@ -13,7 +13,7 @@
# See the License for the specific language governing permissions and
# limitations under the License.
# This script automatically formats and lints all notebooks that have changed from the head of the master branch.
# This script automatically formats and lints all notebooks that have changed from the head of the main branch.
#
# Options:
# -t: Test-mode. Only test if format and linting are required but make no changes to files.
@@ -47,12 +47,22 @@ done
echo "Test mode: $is_test"
# Read in user-provided notebooks
notebooks=()
for arg in "$@"; do
if [[ $arg == *.ipynb ]]; then
notebooks+=("$arg")
fi
done
# Only check notebooks in test folders modified in this pull request.
# Note: Use process substitution to persist the data in the array
notebooks=()
while read -r file || [ -n "$line" ]; do
notebooks+=("$file")
done < <(git diff --name-only master... | grep '\.ipynb$')
if [ ${#notebooks[@]} -eq 0 ]; then
echo "Checking for changed notebooked using git"
while read -r file || [ -n "$line" ]; do
notebooks+=("$file")
done < <(git diff --name-only main... | grep '\.ipynb$')
fi
problematic_notebooks=()
if [ ${#notebooks[@]} -gt 0 ]; then
@@ -68,7 +78,7 @@ if [ ${#notebooks[@]} -gt 0 ]; then
if [ "$is_test" = true ]; then
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs --test "$notebook"
python3 -m tensorflow_docs.tools.nbfmt --test "$notebook"
NBFMT_RTN=$?
# echo "Running black..."
# python3 -m nbqa black "$notebook" --check
@@ -84,19 +94,19 @@ if [ ${#notebooks[@]} -gt 0 ]; then
FLAKE8_RTN=$?
else
echo "Running black..."
python3 -m nbqa black "$notebook" --nbqa-mutate
python3 -m nbqa black "$notebook"
BLACK_RTN=$?
echo "Running pyupgrade..."
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
python3 -m nbqa pyupgrade "$notebook"
PYUPGRADE_RTN=$?
echo "Running isort..."
python3 -m nbqa isort "$notebook" --nbqa-mutate
python3 -m nbqa isort "$notebook"
ISORT_RTN=$?
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
python3 -m tensorflow_docs.tools.nbfmt "$notebook"
NBFMT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291 --nbqa-mutate
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
FLAKE8_RTN=$?
fi
+6
View File
@@ -0,0 +1,6 @@
# See https://help.github.com/en/articles/about-code-owners
# for more info about CODEOWNERS file.
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence.
* @GoogleCloudPlatform/vertex-ai-samples-owners
+43
View File
@@ -0,0 +1,43 @@
# Contributor Code of Conduct
As contributors and maintainers of this project,
and in the interest of fostering an open and welcoming community,
we pledge to respect all people who contribute through reporting issues,
posting feature requests, updating documentation,
submitting pull requests or patches, and other activities.
We are committed to making participation in this project
a harassment-free experience for everyone,
regardless of level of experience, gender, gender identity and expression,
sexual orientation, disability, personal appearance,
body size, race, ethnicity, age, religion, or nationality.
Examples of unacceptable behavior by participants include:
* The use of sexualized language or imagery
* Personal attacks
* Trolling or insulting/derogatory comments
* Public or private harassment
* Publishing other's private information,
such as physical or electronic
addresses, without explicit permission
* Other unethical or unprofessional conduct.
Project maintainers have the right and responsibility to remove, edit, or reject
comments, commits, code, wiki edits, issues, and other contributions
that are not aligned to this Code of Conduct.
By adopting this Code of Conduct,
project maintainers commit themselves to fairly and consistently
applying these principles to every aspect of managing this project.
Project maintainers who do not follow or enforce the Code of Conduct
may be permanently removed from the project team.
This code of conduct applies both within project spaces and in public spaces
when an individual is representing the project or its community.
Instances of abusive, harassing, or otherwise unacceptable behavior
may be reported by opening an issue
or contacting one or more of the project maintainers.
This Code of Conduct is adapted from the [Contributor Covenant](http://contributor-covenant.org), version 1.2.0,
available at [http://contributor-covenant.org/version/1/2/0/](http://contributor-covenant.org/version/1/2/0/)
+35
View File
@@ -15,6 +15,41 @@ You generally only need to submit a CLA once, so if you've already submitted one
(even if it was for a different project), you probably don't need to do it
again.
## Code Quality Checks
All notebooks in this project are checked for formatting and style, to ensure a
consistent experience. To test notebooks prior to submitting a pull request,
you can follow these steps.
From a command-line terminal (e.g. from Vertex Workbench or locally), install
the code analysis tools:
```shell
pip3 install --user -U nbqa black flake8 isort pyupgrade git+https://github.com/tensorflow/docs
```
You'll likely need to add the directory where these were installed to your PATH:
```shell
export PATH="$HOME/.local/bin:$PATH"
```
Then, set an environment variable for your notebook (or directory):
```shell
export notebook="your-notebook.ipynb"
```
Finally, run this code block to check for errors. Each step will attempt to
automatically fix any issues. If the fixes can't be performed automatically,
then you will need to manually address them before submitting your PR.
Note: For official, only submit one notebook per PR.
```shell
docker run -v ${PWD}:/setup/app gcr.io/cloud-devrel-public-resources/notebook_linter:latest your_notebook
```
## Code Reviews
All submissions, including submissions by project members, require review. We
+19 -2
View File
@@ -6,15 +6,32 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
## Overview
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks) and [Community Content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
## Repository structure
```bash
├── community-content - Sample code and tutorials contributed by the community
├── notebooks
│ ├── community - Notebooks contributed by the community
│ ├── official - Notebooks demonstrating use of each Vertex AI service
│ │ ├── automl
│ │ ├── custom
│ │ ├── ...
```
## Contributing
Contributions welcome! See the [Contributing Guide](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md).
Contributions welcome! See the [Contributing Guide](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/CONTRIBUTING.md).
## Getting help
Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) to provide feedback or submit a bug report.
## Disclaimer
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
## Feedback
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
+7
View File
@@ -0,0 +1,7 @@
# Security Policy
To report a security issue, please use [g.co/vulnz](https://g.co/vulnz).
The Google Security Team will respond within 5 working days of your report on g.co/vulnz.
We use g.co/vulnz for our intake, and do coordination and disclosure here using GitHub Security Advisory to privately discuss and fix the issue.
+12
View File
@@ -0,0 +1,12 @@
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/pytorch_pre_built_images_deployment @googleapis/vertex-prediction-team
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/pluto_on_workbench @wkharold
/cpr-examples @samthrasher
/Train_tabular_models_with_many_frameworks_and_import_to_Vertex_AI_using_Pipelines @Ark-kun
/pipeline_components @Ark-kun
/pipeline_components/image_ml_model_training @lakeyk
/prediction_featurestore_integration @googleapis/vertex-prediction-team
@@ -0,0 +1,83 @@
name: Train tabular classification logistic regression model using Scikit learn pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_classification_logistic_regression_model_using_Scikit_learn_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":40,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":40,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":40,"y":250,"width":180,"height":54}'
Binarize column using Pandas on CSV data:
componentRef:
digest: d699afd4d7cae862708717cc160f4394ed0c04e536e9515923ef1e8865f01d44
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1e2558325f4c708aca75827c8acc13d230ee7e9f/components/pandas/Binarize_column/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
column_name: tips
predicate: '> 0'
new_column_name: class
annotations:
editor.position: '{"x":40,"y":380,"width":180,"height":54}'
Train logistic regression model using scikit learn from CSV:
componentRef:
digest: a864625a822e4b1c8ef6fe4ae1454fd90f15438f70a6712bb4c30e0dda4d35b7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/cb44b75c9c062fcc40c2b905b2024b4493dbc62b/components/ML_frameworks/Scikit_learn/Train_logistic_regression_model/from_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: transformed_table
taskId: Binarize column using Pandas on CSV data
type: CSV
label_column_name: class
annotations:
editor.position: '{"x":40,"y":510,"width":180,"height":70}'
Upload Scikit learn pickle model to Google Cloud Vertex AI:
componentRef:
digest: 81c91c8d7d21ec97e0872f669d68bd89edea87279d703685db54aa94743bebcd
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train logistic regression model using scikit learn from CSV
type: ScikitLearnPickleModel
annotations:
editor.position: '{"x":40,"y":660,"width":180,"height":70}'
outputValues: {}
@@ -0,0 +1,73 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
binarize_column_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Binarize_column/in_CSV_format/component.yaml")
train_logistic_regression_model_using_scikit_learn_from_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/1f5cf6e06409b704064b2086c0a705e4e6b4fcde/community-content/pipeline_components/ML_frameworks/Scikit_learn/Train_logistic_regression_model/from_CSV/component.yaml")
upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_classification_logistic_regression_model_using_Scikit_learn_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
# Deploying the model might incur additional costs over time
deploy_model = False
classification_label_column = "class"
all_columns = [label_column] + feature_columns
training_data = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
training_data = select_columns_using_Pandas_on_CSV_data_op(
table=training_data,
column_names=all_columns,
).outputs["transformed_table"]
# Cleaning the NaN values.
training_data = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=training_data,
replacement_value="0",
#replacement_type_name="float",
).outputs["transformed_table"]
classification_training_data = binarize_column_using_Pandas_on_CSV_data_op(
table=training_data,
column_name=label_column,
predicate="> 0",
new_column_name=classification_label_column,
).outputs["transformed_table"]
model = train_logistic_regression_model_using_scikit_learn_from_CSV_op(
dataset=classification_training_data,
label_column_name=classification_label_column,
# Optional:
#penalty="l2",
#solver="lbfgs",
#max_iterations=100,
#multi_class_mode="auto",
#random_seed=0,
).outputs["model"]
vertex_model_name = upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op(
model=model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
sklearn_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func = train_tabular_classification_logistic_regression_model_using_Scikit_learn_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,114 @@
name: Train tabular classification model using PyTorch pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_classification_model_using_PyTorch_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":240,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":240,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":240,"y":250,"width":180,"height":54}'
Create fully connected pytorch network:
componentRef:
digest: d03d8248fd358a0275ec33568ee7dd7dce576cc112b09dfafe2651e4d97e04a9
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1a2ef3eeb77bc278f33cad0dd29008ea2431e191/components/PyTorch/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
output_activation_name: sigmoid
annotations:
editor.position: '{"x":40,"y":360,"width":180,"height":54}'
Binarize column using Pandas on CSV data:
componentRef:
digest: d699afd4d7cae862708717cc160f4394ed0c04e536e9515923ef1e8865f01d44
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1e2558325f4c708aca75827c8acc13d230ee7e9f/components/pandas/Binarize_column/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
column_name: tips
predicate: ' > 0'
new_column_name: class
annotations:
editor.position: '{"x":240,"y":360,"width":180,"height":54}'
Train pytorch model from csv:
componentRef:
digest: 40f3185eb61e9727f41a4e0c05dd3d3b44bd802aa0f378cfc31756560033949a
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/d8c4cf5e6403bc65bcf8d606e6baf87e2528a3dc/components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Create fully connected pytorch network
type: PyTorchScriptModule
training_data:
taskOutput:
outputName: transformed_table
taskId: Binarize column using Pandas on CSV data
type: CSV
label_column_name: class
loss_function_name: binary_cross_entropy
annotations:
editor.position: '{"x":240,"y":490,"width":180,"height":40}'
Create PyTorch Model Archive with base handler:
componentRef:
digest: 8298b5ee1b0f0879f893add4cf352c8dec7cf9e21bb9db134c91a2d046cdb0ec
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/46d51383e6554b7f3ab4fd8cf614d8c2b422fb22/components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml
arguments:
Model:
taskOutput:
outputName: trained_model
taskId: Train pytorch model from csv
type: PyTorchScriptModule
Model name: model
Model version: '1.0'
annotations:
editor.position: '{"x":240,"y":590,"width":180,"height":54}'
Upload PyTorch model archive to Google Cloud Vertex AI:
componentRef:
digest: 4450212fae7b9001482aca7eb78b28413c205506eccf08a04e7754a8dfa99004
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model_archive:
taskOutput:
outputName: Model archive
taskId: Create PyTorch Model Archive with base handler
type: PyTorchModelArchive
annotations:
editor.position: '{"x":240,"y":720,"width":180,"height":70}'
outputValues: {}
@@ -0,0 +1,95 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
binarize_column_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Binarize_column/in_CSV_format/component.yaml")
create_fully_connected_pytorch_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_fully_connected_network/component.yaml")
train_pytorch_model_from_csv_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml")
create_pytorch_model_archive_with_base_handler_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml")
upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_classification_model_using_PyTorch_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
# Deploying the model might incur additional costs over time
deploy_model = False
classification_label_column = "class"
all_columns = [label_column] + feature_columns
training_data = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
training_data = select_columns_using_Pandas_on_CSV_data_op(
table=training_data,
column_names=all_columns,
).outputs["transformed_table"]
# Cleaning the NaN values.
training_data = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=training_data,
replacement_value="0",
#replacement_type_name="float",
).outputs["transformed_table"]
classification_training_data = binarize_column_using_Pandas_on_CSV_data_op(
table=training_data,
column_name=label_column,
predicate=" > 0",
new_column_name=classification_label_column,
).outputs["transformed_table"]
network = create_fully_connected_pytorch_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
output_activation_name="sigmoid",
# output_size=1,
).outputs["model"]
model = train_pytorch_model_from_csv_op(
model=network,
training_data=classification_training_data,
label_column_name=classification_label_column,
loss_function_name="binary_cross_entropy",
# Optional:
#number_of_epochs=1,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
#batch_log_interval=100,
#random_seed=0,
).outputs["trained_model"]
model_archive = create_pytorch_model_archive_with_base_handler_op(
model=model,
# Optional:
# model_name="model",
# model_version="1.0",
).outputs["Model archive"]
vertex_model_name = upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op(
model_archive=model_archive,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func=train_tabular_classification_model_using_PyTorch_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,132 @@
name: Train tabular classification model using TensorFlow pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_classification_model_using_TensorFlow_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":40,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":40,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":40,"y":250,"width":180,"height":54}'
Binarize column using Pandas on CSV data:
componentRef:
digest: d699afd4d7cae862708717cc160f4394ed0c04e536e9515923ef1e8865f01d44
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1e2558325f4c708aca75827c8acc13d230ee7e9f/components/pandas/Binarize_column/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
column_name: tips
predicate: ' > 0'
new_column_name: class
annotations:
editor.position: '{"x":40,"y":370,"width":180,"height":54}'
Split rows into subsets:
componentRef:
digest: a609c3c9196484290f24a1174955f95b27f07a7b458aa5cb8cde28866cb2cb46
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/daae5a4abaa35e44501818b1534ed7827d7da073/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Binarize column using Pandas on CSV data
type: CSV
fraction_1: '0.8'
annotations:
editor.position: '{"x":170,"y":500,"width":180,"height":40}'
Create fully connected tensorflow network:
componentRef:
digest: bfcafbc5ce711b1f69cabf1338212d10d50136a73db9f9f7c984de7b80b4bfb0
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/9ca0f9eecf5f896f65b8538bbd809747052617d1/components/tensorflow/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
output_activation_name: sigmoid
annotations:
editor.position: '{"x":370,"y":500,"width":180,"height":54}'
Train model using Keras on CSV:
componentRef:
digest: 42ae60c889034dbad74815653e95b4f7d576b5f47f803173e8679c7b54984609
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c504a4010348c50eaaf6d4337586ccc008f4dcef/components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Create fully connected tensorflow network
type: TensorflowSavedModel
label_column_name: class
loss_function_name: binary_crossentropy
number_of_epochs: '10'
annotations:
editor.position: '{"x":40,"y":620,"width":180,"height":54}'
Upload Tensorflow model to Google Cloud Vertex AI:
componentRef:
digest: 2e45263ff640b1a688e359b6936e27a81b2407749a84f340af2aa5547e0cb92c
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
annotations:
editor.position: '{"x":40,"y":750,"width":180,"height":54}'
Predict with TensorFlow model on CSV data:
componentRef:
digest: 921bb1563e93a78233b8acceab87055b9154ccf5595d056028cf0396ca224cd4
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/59c759ce6f543184e30db6817d2a703879bc0f39/components/tensorflow/Predict/on_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
label_column_name: class
annotations:
editor.position: '{"x":240,"y":750,"width":180,"height":54}'
outputValues: {}
@@ -0,0 +1,106 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
binarize_column_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Binarize_column/in_CSV_format/component.yaml")
split_rows_into_subsets_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml")
create_fully_connected_tensorflow_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Create_fully_connected_network/component.yaml")
train_model_using_Keras_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml")
predict_with_TensorFlow_model_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Predict/on_CSV/component.yaml")
upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_classification_model_using_TensorFlow_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
training_set_fraction = 0.8
# Deploying the model might incur additional costs over time
deploy_model = False
classification_label_column = "class"
all_columns = [label_column] + feature_columns
dataset = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
dataset = select_columns_using_Pandas_on_CSV_data_op(
table=dataset,
column_names=all_columns,
).outputs["transformed_table"]
dataset = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=dataset,
replacement_value="0",
# # Optional:
# column_names=None, # =[...]
).outputs["transformed_table"]
classification_dataset = binarize_column_using_Pandas_on_CSV_data_op(
table=dataset,
column_name=label_column,
predicate=" > 0",
new_column_name=classification_label_column,
).outputs["transformed_table"]
split_task = split_rows_into_subsets_op(
table=classification_dataset,
fraction_1=training_set_fraction,
)
classification_training_data = split_task.outputs["split_1"]
classification_testing_data = split_task.outputs["split_2"]
network = create_fully_connected_tensorflow_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
output_activation_name="sigmoid",
# output_size=1,
).outputs["model"]
model = train_model_using_Keras_on_CSV_op(
training_data=classification_training_data,
model=network,
label_column_name=classification_label_column,
# Optional:
loss_function_name="binary_crossentropy",
number_of_epochs=10,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
#metric_names=["mean_absolute_error"],
#random_seed=0,
).outputs["trained_model"]
predictions = predict_with_TensorFlow_model_on_CSV_data_op(
dataset=classification_testing_data,
model=model,
# label_column_name needs to be set when doing prediction on a dataset that has labels
label_column_name=classification_label_column,
# Optional:
# batch_size=1000,
).outputs["predictions"]
vertex_model_name = upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op(
model=model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func = train_tabular_classification_model_using_TensorFlow_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,115 @@
name: Train tabular classification model using XGBoost pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_classification_model_using_XGBoost_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":40,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":40,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":40,"y":250,"width":180,"height":54}'
Binarize column using Pandas on CSV data:
componentRef:
digest: d699afd4d7cae862708717cc160f4394ed0c04e536e9515923ef1e8865f01d44
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1e2558325f4c708aca75827c8acc13d230ee7e9f/components/pandas/Binarize_column/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
column_name: tips
predicate: '> 0'
new_column_name: class
annotations:
editor.position: '{"x":40,"y":380,"width":180,"height":54}'
Split rows into subsets:
componentRef:
digest: a609c3c9196484290f24a1174955f95b27f07a7b458aa5cb8cde28866cb2cb46
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/daae5a4abaa35e44501818b1534ed7827d7da073/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Binarize column using Pandas on CSV data
type: CSV
fraction_1: '0.8'
annotations:
editor.position: '{"x":170,"y":510,"width":180,"height":40}'
Train XGBoost model on CSV:
componentRef:
digest: 538c5a01eb38deaf532d619f0bbeaff4efc550fe1f0f776fc06791097b68ceac
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/58d3a47f904f32a64af8403330ba7e2134cae46d/components/XGBoost/Train/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: class
objective: binary:logistic
annotations:
editor.position: '{"x":40,"y":630,"width":180,"height":40}'
Upload XGBoost model to Google Cloud Vertex AI:
componentRef:
digest: 5a5a273c403670743820986c03a4175b7cb4595a556524fefcce403656286977
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
annotations:
editor.position: '{"x":40,"y":750,"width":180,"height":54}'
Xgboost predict on CSV:
componentRef:
digest: 0876233a0c7306fefec188bd70f059b46d1fb5aa57be231799570e3bbbdd0d95
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/4694ec97baccf59284c2a1db4aa2250c22291eab/components/XGBoost/Predict/component.yaml
arguments:
data:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
label_column_name: class
annotations:
editor.position: '{"x":240,"y":750,"width":180,"height":40}'
outputValues: {}
@@ -0,0 +1,94 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
binarize_column_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Binarize_column/in_CSV_format/component.yaml")
split_rows_into_subsets_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml")
train_XGBoost_model_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Train/component.yaml")
xgboost_predict_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Predict/component.yaml")
upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_classification_model_using_XGBoost_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
training_set_fraction = 0.8
# Deploying the model might incur additional costs over time
deploy_model = False
classification_label_column = "class"
all_columns = [label_column] + feature_columns
dataset = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
dataset = select_columns_using_Pandas_on_CSV_data_op(
table=dataset,
column_names=all_columns,
).outputs["transformed_table"]
dataset = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=dataset,
replacement_value="0",
# # Optional:
# column_names=None, # =[...]
).outputs["transformed_table"]
classification_dataset = binarize_column_using_Pandas_on_CSV_data_op(
table=dataset,
column_name=label_column,
predicate="> 0",
new_column_name=classification_label_column,
).outputs["transformed_table"]
split_task = split_rows_into_subsets_op(
table=classification_dataset,
fraction_1=training_set_fraction,
)
classification_training_data = split_task.outputs["split_1"]
classification_testing_data = split_task.outputs["split_2"]
model = train_XGBoost_model_on_CSV_op(
training_data=classification_training_data,
label_column_name=classification_label_column,
objective="binary:logistic",
# Optional:
#starting_model=None,
#num_iterations=10,
#booster_params={},
#booster="gbtree",
#learning_rate=0.3,
#min_split_loss=0,
#max_depth=6,
).outputs["model"]
# Predicting on the testing data
predictions = xgboost_predict_on_CSV_op(
data=classification_testing_data,
model=model,
# label_column needs to be set when doing prediction on a dataset that has labels
label_column_name=classification_label_column,
).outputs["predictions"]
vertex_model_name = upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op(
model=model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func = train_tabular_classification_model_using_XGBoost_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,257 @@
name: Train tabular classification model using all frameworks pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_classification_model_using_all_frameworks_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":550,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":550,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":550,"y":250,"width":180,"height":54}'
Binarize column using Pandas on CSV data:
componentRef:
digest: d699afd4d7cae862708717cc160f4394ed0c04e536e9515923ef1e8865f01d44
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1e2558325f4c708aca75827c8acc13d230ee7e9f/components/pandas/Binarize_column/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
column_name: tips
predicate: ' > 0'
new_column_name: class
annotations:
editor.position: '{"x":550,"y":380,"width":180,"height":54}'
Split rows into subsets:
componentRef:
digest: a609c3c9196484290f24a1174955f95b27f07a7b458aa5cb8cde28866cb2cb46
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/daae5a4abaa35e44501818b1534ed7827d7da073/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Binarize column using Pandas on CSV data
type: CSV
fraction_1: '0.8'
annotations:
editor.position: '{"x":550,"y":490,"width":180,"height":40}'
Create fully connected pytorch network:
componentRef:
digest: d03d8248fd358a0275ec33568ee7dd7dce576cc112b09dfafe2651e4d97e04a9
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1a2ef3eeb77bc278f33cad0dd29008ea2431e191/components/PyTorch/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
output_activation_name: sigmoid
annotations:
editor.position: '{"x":380,"y":620,"width":180,"height":54}'
Create fully connected tensorflow network:
componentRef:
digest: bfcafbc5ce711b1f69cabf1338212d10d50136a73db9f9f7c984de7b80b4bfb0
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/9ca0f9eecf5f896f65b8538bbd809747052617d1/components/tensorflow/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
output_activation_name: sigmoid
annotations:
editor.position: '{"x":40,"y":630,"width":180,"height":54}'
Train model using Keras on CSV:
componentRef:
digest: 42ae60c889034dbad74815653e95b4f7d576b5f47f803173e8679c7b54984609
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c504a4010348c50eaaf6d4337586ccc008f4dcef/components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Create fully connected tensorflow network
type: TensorflowSavedModel
label_column_name: class
loss_function_name: binary_crossentropy
number_of_epochs: '10'
annotations:
editor.position: '{"x":40,"y":750,"width":180,"height":54}'
Train pytorch model from csv:
componentRef:
digest: 40f3185eb61e9727f41a4e0c05dd3d3b44bd802aa0f378cfc31756560033949a
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/d8c4cf5e6403bc65bcf8d606e6baf87e2528a3dc/components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Create fully connected pytorch network
type: PyTorchScriptModule
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: class
loss_function_name: binary_cross_entropy
annotations:
editor.position: '{"x":380,"y":750,"width":180,"height":40}'
Train XGBoost model on CSV:
componentRef:
digest: 538c5a01eb38deaf532d619f0bbeaff4efc550fe1f0f776fc06791097b68ceac
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/58d3a47f904f32a64af8403330ba7e2134cae46d/components/XGBoost/Train/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: class
objective: binary:logistic
annotations:
editor.position: '{"x":720,"y":750,"width":180,"height":40}'
Train logistic regression model using scikit learn from CSV:
componentRef:
digest: a864625a822e4b1c8ef6fe4ae1454fd90f15438f70a6712bb4c30e0dda4d35b7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/cb44b75c9c062fcc40c2b905b2024b4493dbc62b/components/ML_frameworks/Scikit_learn/Train_logistic_regression_model/from_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: class
annotations:
editor.position: '{"x":1030,"y":750,"width":180,"height":70}'
Predict with TensorFlow model on CSV data:
componentRef:
digest: 921bb1563e93a78233b8acceab87055b9154ccf5595d056028cf0396ca224cd4
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/59c759ce6f543184e30db6817d2a703879bc0f39/components/tensorflow/Predict/on_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
label_column_name: class
annotations:
editor.position: '{"x":160,"y":880,"width":180,"height":54}'
Create PyTorch Model Archive with base handler:
componentRef:
digest: 8298b5ee1b0f0879f893add4cf352c8dec7cf9e21bb9db134c91a2d046cdb0ec
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/46d51383e6554b7f3ab4fd8cf614d8c2b422fb22/components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml
arguments:
Model:
taskOutput:
outputName: trained_model
taskId: Train pytorch model from csv
type: PyTorchScriptModule
Model name: model
Model version: '1.0'
annotations:
editor.position: '{"x":380,"y":880,"width":180,"height":54}'
Xgboost predict on CSV:
componentRef:
digest: 0876233a0c7306fefec188bd70f059b46d1fb5aa57be231799570e3bbbdd0d95
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/4694ec97baccf59284c2a1db4aa2250c22291eab/components/XGBoost/Predict/component.yaml
arguments:
data:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
label_column_name: class
annotations:
editor.position: '{"x":810,"y":880,"width":180,"height":40}'
Upload Scikit learn pickle model to Google Cloud Vertex AI:
componentRef:
digest: 81c91c8d7d21ec97e0872f669d68bd89edea87279d703685db54aa94743bebcd
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train logistic regression model using scikit learn from CSV
type: ScikitLearnPickleModel
annotations:
editor.position: '{"x":1030,"y":880,"width":180,"height":70}'
Upload Tensorflow model to Google Cloud Vertex AI:
componentRef:
digest: 2e45263ff640b1a688e359b6936e27a81b2407749a84f340af2aa5547e0cb92c
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
annotations:
editor.position: '{"x":40,"y":1010,"width":180,"height":54}'
Upload PyTorch model archive to Google Cloud Vertex AI:
componentRef:
digest: 4450212fae7b9001482aca7eb78b28413c205506eccf08a04e7754a8dfa99004
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model_archive:
taskOutput:
outputName: Model archive
taskId: Create PyTorch Model Archive with base handler
type: PyTorchModelArchive
annotations:
editor.position: '{"x":380,"y":1010,"width":180,"height":70}'
Upload XGBoost model to Google Cloud Vertex AI:
componentRef:
digest: 5a5a273c403670743820986c03a4175b7cb4595a556524fefcce403656286977
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
annotations:
editor.position: '{"x":720,"y":1010,"width":180,"height":54}'
outputValues: {}
@@ -0,0 +1,224 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
binarize_column_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Binarize_column/in_CSV_format/component.yaml")
split_rows_into_subsets_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml")
# TensorFlow
create_fully_connected_tensorflow_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Create_fully_connected_network/component.yaml")
train_model_using_Keras_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml")
predict_with_TensorFlow_model_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Predict/on_CSV/component.yaml")
upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/component.yaml")
# PyTorch
create_fully_connected_pytorch_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_fully_connected_network/component.yaml")
train_pytorch_model_from_csv_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml")
create_pytorch_model_archive_with_base_handler_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml")
upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/component.yaml")
# XGBoost
train_XGBoost_model_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Train/component.yaml")
xgboost_predict_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Predict/component.yaml")
upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/component.yaml")
# Scikit-learn
#train_linear_regression_model_using_scikit_learn_from_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/1f5cf6e06409b704064b2086c0a705e4e6b4fcde/community-content/pipeline_components/ML_frameworks/Scikit_learn/Train_linear_regression_model/from_CSV/component.yaml")
train_logistic_regression_model_using_scikit_learn_from_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/1f5cf6e06409b704064b2086c0a705e4e6b4fcde/community-content/pipeline_components/ML_frameworks/Scikit_learn/Train_logistic_regression_model/from_CSV/component.yaml")
upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/component.yaml")
# Vertex AI
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_classification_model_using_all_frameworks_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
training_set_fraction = 0.8
# Deploying the model might incur additional costs over time
deploy_model = False
classification_label_column = "class"
all_columns = [label_column] + feature_columns
dataset = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
dataset = select_columns_using_Pandas_on_CSV_data_op(
table=dataset,
column_names=all_columns,
).outputs["transformed_table"]
dataset = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=dataset,
replacement_value="0",
# # Optional:
# column_names=None, # =[...]
).outputs["transformed_table"]
classification_dataset = binarize_column_using_Pandas_on_CSV_data_op(
table=dataset,
column_name=label_column,
predicate=" > 0",
new_column_name=classification_label_column,
).outputs["transformed_table"]
split_task = split_rows_into_subsets_op(
table=classification_dataset,
fraction_1=training_set_fraction,
)
classification_training_data = split_task.outputs["split_1"]
classification_testing_data = split_task.outputs["split_2"]
# TensorFlow
tensorflow_network = create_fully_connected_tensorflow_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
output_activation_name="sigmoid",
# output_size=1,
).outputs["model"]
tensorflow_model = train_model_using_Keras_on_CSV_op(
training_data=classification_training_data,
model=tensorflow_network,
label_column_name=classification_label_column,
# Optional:
loss_function_name="binary_crossentropy",
number_of_epochs=10,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
#metric_names=["mean_absolute_error"],
#random_seed=0,
).outputs["trained_model"]
tensorflow_predictions = predict_with_TensorFlow_model_on_CSV_data_op(
dataset=classification_testing_data,
model=tensorflow_model,
# label_column_name needs to be set when doing prediction on a dataset that has labels
label_column_name=classification_label_column,
# Optional:
# batch_size=1000,
).outputs["predictions"]
tensorflow_vertex_model_name = upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op(
model=tensorflow_model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
tensorflow_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=tensorflow_vertex_model_name,
).outputs["endpoint_name"]
# PyTorch
pytorch_network = create_fully_connected_pytorch_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
output_activation_name="sigmoid",
# output_size=1,
).outputs["model"]
pytorch_model = train_pytorch_model_from_csv_op(
model=pytorch_network,
training_data=classification_training_data,
label_column_name=classification_label_column,
loss_function_name="binary_cross_entropy",
# Optional:
#number_of_epochs=1,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
#batch_log_interval=100,
#random_seed=0,
).outputs["trained_model"]
pytorch_model_archive = create_pytorch_model_archive_with_base_handler_op(
model=pytorch_model,
# Optional:
# model_name="model",
# model_version="1.0",
).outputs["Model archive"]
pytorch_vertex_model_name = upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op(
model_archive=pytorch_model_archive,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
pytorch_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=pytorch_vertex_model_name,
).outputs["endpoint_name"]
# XGBoost
xgboost_model = train_XGBoost_model_on_CSV_op(
training_data=classification_training_data,
label_column_name=classification_label_column,
objective="binary:logistic",
# Optional:
#starting_model=None,
#num_iterations=10,
#booster_params={},
#booster="gbtree",
#learning_rate=0.3,
#min_split_loss=0,
#max_depth=6,
).outputs["model"]
# Predicting on the testing data
xgboost_predictions = xgboost_predict_on_CSV_op(
data=classification_testing_data,
model=xgboost_model,
# label_column needs to be set when doing prediction on a dataset that has labels
label_column_name=classification_label_column,
).outputs["predictions"]
xgboost_vertex_model_name = upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op(
model=xgboost_model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
xgboost_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=xgboost_vertex_model_name,
).outputs["endpoint_name"]
# Scikit-learn
sklearn_model = train_logistic_regression_model_using_scikit_learn_from_CSV_op(
dataset=classification_training_data,
label_column_name=classification_label_column,
# Optional:
#penalty="l2",
#solver="lbfgs",
#max_iterations=100,
#multi_class_mode="auto",
#random_seed=0,
).outputs["model"]
sklearn_vertex_model_name = upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op(
model=sklearn_model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
sklearn_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=sklearn_vertex_model_name,
).outputs["endpoint_name"]
pipeline_func=train_tabular_classification_model_using_all_frameworks_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,68 @@
name: Train tabular regression linear model using Scikit learn pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_regression_linear_model_using_Scikit_learn_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":40,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":40,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":40,"y":250,"width":180,"height":54}'
Train linear regression model using scikit learn from CSV:
componentRef:
digest: c7fe7912ab0d1fb45d201d452e9ce6be5544e7d8c6d229db7a4b931ff58560f3
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/f807e02b54d4886c65a05f40848fd51c72407f40/components/ML_frameworks/Scikit_learn/Train_linear_regression_model/from_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
label_column_name: tips
annotations:
editor.position: '{"x":40,"y":360,"width":180,"height":54}'
Upload Scikit learn pickle model to Google Cloud Vertex AI:
componentRef:
digest: 81c91c8d7d21ec97e0872f669d68bd89edea87279d703685db54aa94743bebcd
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train linear regression model using scikit learn from CSV
type: ScikitLearnPickleModel
annotations:
editor.position: '{"x":40,"y":490,"width":180,"height":70}'
outputValues: {}
@@ -0,0 +1,57 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
train_linear_regression_model_using_scikit_learn_from_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/1f5cf6e06409b704064b2086c0a705e4e6b4fcde/community-content/pipeline_components/ML_frameworks/Scikit_learn/Train_linear_regression_model/from_CSV/component.yaml")
upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_regression_linear_model_using_Scikit_learn_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
all_columns = [label_column] + feature_columns
# Deploying the model might incur additional costs over time
deploy_model = False
training_data = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
training_data = select_columns_using_Pandas_on_CSV_data_op(
table=training_data,
column_names=all_columns,
).outputs["transformed_table"]
# Cleaning the NaN values.
training_data = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=training_data,
replacement_value="0",
#replacement_type_name="float",
).outputs["transformed_table"]
model = train_linear_regression_model_using_scikit_learn_from_CSV_op(
dataset=training_data,
label_column_name=label_column,
).outputs["model"]
vertex_model_name = upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op(
model=model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
sklearn_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func = train_tabular_regression_linear_model_using_Scikit_learn_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,97 @@
name: Train tabular regression model using PyTorch pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_regression_model_using_PyTorch_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":240,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":240,"y":130,"width":180,"height":54}'
Create fully connected pytorch network:
componentRef:
digest: d03d8248fd358a0275ec33568ee7dd7dce576cc112b09dfafe2651e4d97e04a9
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1a2ef3eeb77bc278f33cad0dd29008ea2431e191/components/PyTorch/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
annotations:
editor.position: '{"x":40,"y":240,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":240,"y":240,"width":180,"height":54}'
Train pytorch model from csv:
componentRef:
digest: 40f3185eb61e9727f41a4e0c05dd3d3b44bd802aa0f378cfc31756560033949a
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/d8c4cf5e6403bc65bcf8d606e6baf87e2528a3dc/components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Create fully connected pytorch network
type: PyTorchScriptModule
training_data:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
label_column_name: tips
annotations:
editor.position: '{"x":240,"y":380,"width":180,"height":40}'
Create PyTorch Model Archive with base handler:
componentRef:
digest: 8298b5ee1b0f0879f893add4cf352c8dec7cf9e21bb9db134c91a2d046cdb0ec
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/46d51383e6554b7f3ab4fd8cf614d8c2b422fb22/components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml
arguments:
Model:
taskOutput:
outputName: trained_model
taskId: Train pytorch model from csv
type: PyTorchScriptModule
Model name: model
Model version: '1.0'
annotations:
editor.position: '{"x":240,"y":500,"width":180,"height":54}'
Upload PyTorch model archive to Google Cloud Vertex AI:
componentRef:
digest: 4450212fae7b9001482aca7eb78b28413c205506eccf08a04e7754a8dfa99004
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model_archive:
taskOutput:
outputName: Model archive
taskId: Create PyTorch Model Archive with base handler
type: PyTorchModelArchive
annotations:
editor.position: '{"x":240,"y":630,"width":180,"height":70}'
outputValues: {}
@@ -0,0 +1,85 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
create_fully_connected_pytorch_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_fully_connected_network/component.yaml")
train_pytorch_model_from_csv_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml")
create_pytorch_model_archive_with_base_handler_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml")
upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_regression_model_using_PyTorch_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
all_columns = [label_column] + feature_columns
# Deploying the model might incur additional costs over time
deploy_model = False
training_data = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
training_data = select_columns_using_Pandas_on_CSV_data_op(
table=training_data,
column_names=all_columns,
).outputs["transformed_table"]
# Cleaning the NaN values.
training_data = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=training_data,
replacement_value="0",
#replacement_type_name="float",
).outputs["transformed_table"]
network = create_fully_connected_pytorch_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
# output_activation_name=None,
# output_size=1,
).outputs["model"]
model = train_pytorch_model_from_csv_op(
model=network,
training_data=training_data,
label_column_name=label_column,
# Optional:
#loss_function_name="mse_loss",
#number_of_epochs=1,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
#batch_log_interval=100,
#random_seed=0,
).outputs["trained_model"]
model_archive = create_pytorch_model_archive_with_base_handler_op(
model=model,
# Optional:
# model_name="model",
# model_version="1.0",
).outputs["Model archive"]
vertex_model_name = upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op(
model_archive=model_archive,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func=train_tabular_regression_model_using_PyTorch_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,116 @@
name: Train tabular regression model using Tensorflow pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_regression_model_using_TensorFlow_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":40,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":40,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":40,"y":250,"width":180,"height":54}'
Split rows into subsets:
componentRef:
digest: a609c3c9196484290f24a1174955f95b27f07a7b458aa5cb8cde28866cb2cb46
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/daae5a4abaa35e44501818b1534ed7827d7da073/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
fraction_1: '0.8'
annotations:
editor.position: '{"x":170,"y":380,"width":180,"height":40}'
Create fully connected tensorflow network:
componentRef:
digest: bfcafbc5ce711b1f69cabf1338212d10d50136a73db9f9f7c984de7b80b4bfb0
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/9ca0f9eecf5f896f65b8538bbd809747052617d1/components/tensorflow/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
annotations:
editor.position: '{"x":370,"y":380,"width":180,"height":54}'
Train model using Keras on CSV:
componentRef:
digest: 42ae60c889034dbad74815653e95b4f7d576b5f47f803173e8679c7b54984609
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c504a4010348c50eaaf6d4337586ccc008f4dcef/components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Create fully connected tensorflow network
type: TensorflowSavedModel
label_column_name: tips
number_of_epochs: '10'
metric_names: '["mean_absolute_error"]'
annotations:
editor.position: '{"x":40,"y":500,"width":180,"height":54}'
Upload Tensorflow model to Google Cloud Vertex AI:
componentRef:
digest: 2e45263ff640b1a688e359b6936e27a81b2407749a84f340af2aa5547e0cb92c
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
annotations:
editor.position: '{"x":40,"y":630,"width":180,"height":54}'
Predict with TensorFlow model on CSV data:
componentRef:
digest: 921bb1563e93a78233b8acceab87055b9154ccf5595d056028cf0396ca224cd4
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/59c759ce6f543184e30db6817d2a703879bc0f39/components/tensorflow/Predict/on_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
label_column_name: tips
annotations:
editor.position: '{"x":240,"y":630,"width":180,"height":54}'
outputValues: {}
@@ -0,0 +1,97 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
split_rows_into_subsets_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml")
create_fully_connected_tensorflow_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Create_fully_connected_network/component.yaml")
train_model_using_Keras_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml")
predict_with_TensorFlow_model_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Predict/on_CSV/component.yaml")
upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_regression_model_using_Tensorflow_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
training_set_fraction = 0.8
# Deploying the model might incur additional costs over time
deploy_model = False
all_columns = [label_column] + feature_columns
dataset = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
dataset = select_columns_using_Pandas_on_CSV_data_op(
table=dataset,
column_names=all_columns,
).outputs["transformed_table"]
dataset = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=dataset,
replacement_value="0",
# # Optional:
# column_names=None, # =[...]
).outputs["transformed_table"]
split_task = split_rows_into_subsets_op(
table=dataset,
fraction_1=training_set_fraction,
)
training_data = split_task.outputs["split_1"]
testing_data = split_task.outputs["split_2"]
network = create_fully_connected_tensorflow_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
# output_activation_name=None,
# output_size=1,
).outputs["model"]
model = train_model_using_Keras_on_CSV_op(
training_data=training_data,
model=network,
label_column_name=label_column,
# Optional:
#loss_function_name="mean_squared_error",
number_of_epochs=10,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
metric_names=["mean_absolute_error"],
#random_seed=0,
).outputs["trained_model"]
predictions = predict_with_TensorFlow_model_on_CSV_data_op(
dataset=testing_data,
model=model,
# label_column_name needs to be set when doing prediction on a dataset that has labels
label_column_name=label_column,
# Optional:
# batch_size=1000,
).outputs["predictions"]
vertex_model_name = upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op(
model=model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func=train_tabular_regression_model_using_Tensorflow_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,99 @@
name: Train tabular regression model using XGBoost pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_regression_model_using_XGBoost_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":40,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":40,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":40,"y":250,"width":180,"height":54}'
Split rows into subsets:
componentRef:
digest: a609c3c9196484290f24a1174955f95b27f07a7b458aa5cb8cde28866cb2cb46
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/daae5a4abaa35e44501818b1534ed7827d7da073/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
fraction_1: '0.8'
annotations:
editor.position: '{"x":170,"y":360,"width":180,"height":40}'
Train XGBoost model on CSV:
componentRef:
digest: 538c5a01eb38deaf532d619f0bbeaff4efc550fe1f0f776fc06791097b68ceac
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/58d3a47f904f32a64af8403330ba7e2134cae46d/components/XGBoost/Train/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: tips
annotations:
editor.position: '{"x":40,"y":480,"width":180,"height":40}'
Upload XGBoost model to Google Cloud Vertex AI:
componentRef:
digest: 5a5a273c403670743820986c03a4175b7cb4595a556524fefcce403656286977
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
annotations:
editor.position: '{"x":40,"y":600,"width":180,"height":54}'
Xgboost predict on CSV:
componentRef:
digest: 0876233a0c7306fefec188bd70f059b46d1fb5aa57be231799570e3bbbdd0d95
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/4694ec97baccf59284c2a1db4aa2250c22291eab/components/XGBoost/Predict/component.yaml
arguments:
data:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
label_column_name: tips
annotations:
editor.position: '{"x":240,"y":600,"width":180,"height":40}'
outputValues: {}
@@ -0,0 +1,85 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
split_rows_into_subsets_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml")
train_XGBoost_model_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Train/component.yaml")
xgboost_predict_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Predict/component.yaml")
upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/component.yaml")
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_regression_model_using_XGBoost_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
training_set_fraction = 0.8
# Deploying the model might incur additional costs over time
deploy_model = False
all_columns = [label_column] + feature_columns
dataset = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
dataset = select_columns_using_Pandas_on_CSV_data_op(
table=dataset,
column_names=all_columns,
).outputs["transformed_table"]
dataset = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=dataset,
replacement_value="0",
# # Optional:
# column_names=None, # =[...]
).outputs["transformed_table"]
split_task = split_rows_into_subsets_op(
table=dataset,
fraction_1=training_set_fraction,
)
training_data = split_task.outputs["split_1"]
testing_data = split_task.outputs["split_2"]
model = train_XGBoost_model_on_CSV_op(
training_data=training_data,
label_column_name=label_column,
# Optional:
#starting_model=None,
#num_iterations=10,
#booster_params={},
#objective="reg:squarederror",
#booster="gbtree",
#learning_rate=0.3,
#min_split_loss=0,
#max_depth=6,
).outputs["model"]
# Predicting on the testing data
predictions = xgboost_predict_on_CSV_op(
data=testing_data,
model=model,
# label_column needs to be set when doing prediction on a dataset that has labels
label_column_name=label_column,
).outputs["predictions"]
vertex_model_name = upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op(
model=model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs["endpoint_name"]
pipeline_func = train_tabular_regression_model_using_XGBoost_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,238 @@
name: Train tabular regression model using all frameworks pipeline
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/samples/Google_Cloud_Vertex_AI/Train_tabular_regression_model_using_all_frameworks_and_import_to_Vertex_AI/pipeline.component.yaml
sdk: https://cloud-pipelines.net/pipeline-editor/
implementation:
graph:
tasks:
Download from GCS:
componentRef:
digest: 4175c9ff143cb8cc75d05451c0a0ebdf5a0d6d020816e29f5e9cefbb7d56f241
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/27a5ea25e849c9e8c0cb6ed65518bc3ece259aaf/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
GCS path: gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv
annotations:
editor.position: '{"x":550,"y":40,"width":180,"height":40}'
Select columns using Pandas on CSV data:
componentRef:
digest: 9b9500f461c1d04f1e48992de9138db14a6800f23649d73048673d5ea6dc56ad
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/8c78aae096806cff3bc331a40566f42f5c3e9d4b/components/pandas/Select_columns/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: Data
taskId: Download from GCS
column_names: '["tips", "trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"]'
annotations:
editor.position: '{"x":550,"y":140,"width":180,"height":54}'
Fill all missing values using Pandas on CSV data:
componentRef:
digest: a1b0c29a4615f2e3652aa5d31b9255fa15700e146627c755f8fc172f82e71af7
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/23405971f5f16a41b16c343129b893c52e4d1d48/components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Select columns using Pandas on CSV data
type: CSV
replacement_value: '0'
annotations:
editor.position: '{"x":550,"y":250,"width":180,"height":54}'
Split rows into subsets:
componentRef:
digest: a609c3c9196484290f24a1174955f95b27f07a7b458aa5cb8cde28866cb2cb46
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/daae5a4abaa35e44501818b1534ed7827d7da073/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml
arguments:
table:
taskOutput:
outputName: transformed_table
taskId: Fill all missing values using Pandas on CSV data
type: CSV
fraction_1: '0.8'
annotations:
editor.position: '{"x":550,"y":360,"width":180,"height":40}'
Create fully connected pytorch network:
componentRef:
digest: d03d8248fd358a0275ec33568ee7dd7dce576cc112b09dfafe2651e4d97e04a9
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/1a2ef3eeb77bc278f33cad0dd29008ea2431e191/components/PyTorch/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
annotations:
editor.position: '{"x":380,"y":490,"width":180,"height":54}'
Create fully connected tensorflow network:
componentRef:
digest: bfcafbc5ce711b1f69cabf1338212d10d50136a73db9f9f7c984de7b80b4bfb0
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/9ca0f9eecf5f896f65b8538bbd809747052617d1/components/tensorflow/Create_fully_connected_network/component.yaml
arguments:
input_size: '7'
hidden_layer_sizes: '[10]'
activation_name: elu
annotations:
editor.position: '{"x":40,"y":500,"width":180,"height":54}'
Train model using Keras on CSV:
componentRef:
digest: 42ae60c889034dbad74815653e95b4f7d576b5f47f803173e8679c7b54984609
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c504a4010348c50eaaf6d4337586ccc008f4dcef/components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Create fully connected tensorflow network
type: TensorflowSavedModel
label_column_name: tips
number_of_epochs: '10'
metric_names: '["mean_absolute_error"]'
annotations:
editor.position: '{"x":40,"y":620,"width":180,"height":54}'
Train pytorch model from csv:
componentRef:
digest: 40f3185eb61e9727f41a4e0c05dd3d3b44bd802aa0f378cfc31756560033949a
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/d8c4cf5e6403bc65bcf8d606e6baf87e2528a3dc/components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Create fully connected pytorch network
type: PyTorchScriptModule
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: tips
annotations:
editor.position: '{"x":380,"y":620,"width":180,"height":40}'
Train XGBoost model on CSV:
componentRef:
digest: 538c5a01eb38deaf532d619f0bbeaff4efc550fe1f0f776fc06791097b68ceac
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/58d3a47f904f32a64af8403330ba7e2134cae46d/components/XGBoost/Train/component.yaml
arguments:
training_data:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: tips
annotations:
editor.position: '{"x":720,"y":620,"width":180,"height":40}'
Train linear regression model using scikit learn from CSV:
componentRef:
digest: c7fe7912ab0d1fb45d201d452e9ce6be5544e7d8c6d229db7a4b931ff58560f3
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/f807e02b54d4886c65a05f40848fd51c72407f40/components/ML_frameworks/Scikit_learn/Train_linear_regression_model/from_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: split_1
taskId: Split rows into subsets
type: CSV
label_column_name: tips
annotations:
editor.position: '{"x":1030,"y":620,"width":180,"height":54}'
Predict with TensorFlow model on CSV data:
componentRef:
digest: 921bb1563e93a78233b8acceab87055b9154ccf5595d056028cf0396ca224cd4
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/59c759ce6f543184e30db6817d2a703879bc0f39/components/tensorflow/Predict/on_CSV/component.yaml
arguments:
dataset:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
label_column_name: tips
annotations:
editor.position: '{"x":160,"y":750,"width":180,"height":54}'
Create PyTorch Model Archive with base handler:
componentRef:
digest: 8298b5ee1b0f0879f893add4cf352c8dec7cf9e21bb9db134c91a2d046cdb0ec
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/46d51383e6554b7f3ab4fd8cf614d8c2b422fb22/components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml
arguments:
Model:
taskOutput:
outputName: trained_model
taskId: Train pytorch model from csv
type: PyTorchScriptModule
Model name: model
Model version: '1.0'
annotations:
editor.position: '{"x":380,"y":750,"width":180,"height":54}'
Xgboost predict on CSV:
componentRef:
digest: 0876233a0c7306fefec188bd70f059b46d1fb5aa57be231799570e3bbbdd0d95
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/4694ec97baccf59284c2a1db4aa2250c22291eab/components/XGBoost/Predict/component.yaml
arguments:
data:
taskOutput:
outputName: split_2
taskId: Split rows into subsets
type: CSV
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
label_column_name: tips
annotations:
editor.position: '{"x":810,"y":750,"width":180,"height":40}'
Upload Scikit learn pickle model to Google Cloud Vertex AI:
componentRef:
digest: 81c91c8d7d21ec97e0872f669d68bd89edea87279d703685db54aa94743bebcd
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train linear regression model using scikit learn from CSV
type: ScikitLearnPickleModel
annotations:
editor.position: '{"x":1030,"y":750,"width":180,"height":70}'
Upload Tensorflow model to Google Cloud Vertex AI:
componentRef:
digest: 2e45263ff640b1a688e359b6936e27a81b2407749a84f340af2aa5547e0cb92c
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: trained_model
taskId: Train model using Keras on CSV
type: TensorflowSavedModel
annotations:
editor.position: '{"x":40,"y":880,"width":180,"height":54}'
Upload PyTorch model archive to Google Cloud Vertex AI:
componentRef:
digest: 4450212fae7b9001482aca7eb78b28413c205506eccf08a04e7754a8dfa99004
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model_archive:
taskOutput:
outputName: Model archive
taskId: Create PyTorch Model Archive with base handler
type: PyTorchModelArchive
annotations:
editor.position: '{"x":380,"y":880,"width":180,"height":70}'
Upload XGBoost model to Google Cloud Vertex AI:
componentRef:
digest: 5a5a273c403670743820986c03a4175b7cb4595a556524fefcce403656286977
url: https://raw.githubusercontent.com/Ark-kun/pipeline_components/c6a8b67d1ada2cc17665c99ff6b410df588bee28/components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/workaround_for_buggy_KFPv2_compiler/component.yaml
arguments:
model:
taskOutput:
outputName: model
taskId: Train XGBoost model on CSV
type: XGBoostModel
annotations:
editor.position: '{"x":720,"y":880,"width":180,"height":54}'
outputValues: {}
@@ -0,0 +1,208 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
# %% Loading components
download_from_gcs_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/storage/download/component.yaml")
select_columns_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Select_columns/in_CSV_format/component.yaml")
fill_all_missing_values_using_Pandas_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/pandas/Fill_all_missing_values/in_CSV_format/component.yaml")
split_rows_into_subsets_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml")
# TensorFlow
create_fully_connected_tensorflow_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Create_fully_connected_network/component.yaml")
train_model_using_Keras_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Train_model_using_Keras/on_CSV/component.yaml")
predict_with_TensorFlow_model_on_CSV_data_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/tensorflow/Predict/on_CSV/component.yaml")
upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/component.yaml")
# PyTorch
create_fully_connected_pytorch_network_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_fully_connected_network/component.yaml")
train_pytorch_model_from_csv_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml")
create_pytorch_model_archive_with_base_handler_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml")
upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/component.yaml")
# XGBoost
train_XGBoost_model_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Train/component.yaml")
xgboost_predict_on_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/XGBoost/Predict/component.yaml")
upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/component.yaml")
# Scikit-learn
train_linear_regression_model_using_scikit_learn_from_CSV_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/1f5cf6e06409b704064b2086c0a705e4e6b4fcde/community-content/pipeline_components/ML_frameworks/Scikit_learn/Train_linear_regression_model/from_CSV/component.yaml")
upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/component.yaml")
# Vertex AI
deploy_model_to_endpoint_op = components.load_component_from_url("https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml")
# %% Pipeline definition
def train_tabular_regression_model_using_all_frameworks_pipeline():
dataset_gcs_uri = "gs://ml-pipeline-dataset/Chicago_taxi_trips/chicago_taxi_trips_2019-01-01_-_2019-02-01_limit=10000.csv"
feature_columns = ["trip_seconds", "trip_miles", "pickup_community_area", "dropoff_community_area", "fare", "tolls", "extras"] # Excluded "trip_total"
label_column = "tips"
training_set_fraction = 0.8
# Deploying the model might incur additional costs over time
deploy_model = False
all_columns = [label_column] + feature_columns
dataset = download_from_gcs_op(
gcs_path=dataset_gcs_uri
).outputs["Data"]
dataset = select_columns_using_Pandas_on_CSV_data_op(
table=dataset,
column_names=all_columns,
).outputs["transformed_table"]
dataset = fill_all_missing_values_using_Pandas_on_CSV_data_op(
table=dataset,
replacement_value="0",
# # Optional:
# column_names=None, # =[...]
).outputs["transformed_table"]
split_task = split_rows_into_subsets_op(
table=dataset,
fraction_1=training_set_fraction,
)
training_data = split_task.outputs["split_1"]
testing_data = split_task.outputs["split_2"]
# TensorFlow
tensorflow_network = create_fully_connected_tensorflow_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
# output_activation_name=None,
# output_size=1,
).outputs["model"]
tensorflow_model = train_model_using_Keras_on_CSV_op(
training_data=training_data,
model=tensorflow_network,
label_column_name=label_column,
# Optional:
#loss_function_name="mean_squared_error",
number_of_epochs=10,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
metric_names=["mean_absolute_error"],
#random_seed=0,
).outputs["trained_model"]
tensorflow_predictions = predict_with_TensorFlow_model_on_CSV_data_op(
dataset=testing_data,
model=tensorflow_model,
# label_column_name needs to be set when doing prediction on a dataset that has labels
label_column_name=label_column,
# Optional:
# batch_size=1000,
).outputs["predictions"]
tensorflow_vertex_model_name = upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op(
model=tensorflow_model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
tensorflow_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=tensorflow_vertex_model_name,
).outputs["endpoint_name"]
# PyTorch
pytorch_network = create_fully_connected_pytorch_network_op(
input_size=len(feature_columns),
# Optional:
hidden_layer_sizes=[10],
activation_name="elu",
# output_activation_name=None,
# output_size=1,
).outputs["model"]
pytorch_model = train_pytorch_model_from_csv_op(
model=pytorch_network,
training_data=training_data,
label_column_name=label_column,
# Optional:
#loss_function_name="mse_loss",
#number_of_epochs=1,
#learning_rate=0.1,
#optimizer_name="Adadelta",
#optimizer_parameters={},
#batch_size=32,
#batch_log_interval=100,
#random_seed=0,
).outputs["trained_model"]
pytorch_model_archive = create_pytorch_model_archive_with_base_handler_op(
model=pytorch_model,
# Optional:
# model_name="model",
# model_version="1.0",
).outputs["Model archive"]
pytorch_vertex_model_name = upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI_op(
model_archive=pytorch_model_archive,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
pytorch_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=pytorch_vertex_model_name,
).outputs["endpoint_name"]
# XGBoost
xgboost_model = train_XGBoost_model_on_CSV_op(
training_data=training_data,
label_column_name=label_column,
# Optional:
#starting_model=None,
#num_iterations=10,
#booster_params={},
#objective="reg:squarederror",
#booster="gbtree",
#learning_rate=0.3,
#min_split_loss=0,
#max_depth=6,
).outputs["model"]
# Predicting on the testing data
xgboost_predictions = xgboost_predict_on_CSV_op(
data=testing_data,
model=xgboost_model,
# label_column needs to be set when doing prediction on a dataset that has labels
label_column_name=label_column,
).outputs["predictions"]
xgboost_vertex_model_name = upload_XGBoost_model_to_Google_Cloud_Vertex_AI_op(
model=xgboost_model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
xgboost_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=xgboost_vertex_model_name,
).outputs["endpoint_name"]
# Scikit-learn
sklearn_model = train_linear_regression_model_using_scikit_learn_from_CSV_op(
dataset=training_data,
label_column_name=label_column,
).outputs["model"]
sklearn_vertex_model_name = upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI_op(
model=sklearn_model,
).outputs["model_name"]
# Deploying the model might incur additional costs over time
if deploy_model:
sklearn_vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=sklearn_vertex_model_name,
).outputs["endpoint_name"]
pipeline_func=train_tabular_regression_model_using_all_frameworks_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,824 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "pc5-mbsX9PZC"
},
"source": [
"# AlphaFold On Vertex AI Workbench\n",
"\n",
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
"\n",
"## ![](https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/alphafold_on_workbench/vertexai_40.png) [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
"\n",
"**Differences to AlphaFold v2.1.0**\n",
"\n",
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
"\n",
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
"\n",
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
"\n",
"**Citing this work**\n",
"\n",
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
"\n",
"**Licenses**\n",
"\n",
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
"\n",
"\n",
"**More information**\n",
"\n",
"You can find more information about how AlphaFold works in the following papers:\n",
"\n",
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
"\n",
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b7a02613eb1a"
},
"source": [
"## Download AlphaFold Data"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "woIxeCPygt7K"
},
"outputs": [],
"source": [
"import os\n",
"import subprocess\n",
"import sys\n",
"\n",
"import alphafold.common\n",
"import tqdm.notebook\n",
"from IPython.utils import io\n",
"\n",
"TQDM_BAR_FORMAT = (\n",
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
")\n",
"\n",
"SOURCE_URL = (\n",
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
")\n",
"PARAMS_DIR = \"alphafold/data/params\"\n",
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
"\n",
"try:\n",
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" with io.capture_output() as captured:\n",
"\n",
" # Download and store stereo_chemical_props.txt\n",
" !mkdir -p ~/content/alphafold/alphafold/common\n",
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
" pbar.update(18)\n",
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
"\n",
" # Download alphafold_params_colab_2021-10-27.tar\n",
" !mkdir --parents \"{PARAMS_DIR}\"\n",
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
" pbar.update(27)\n",
"\n",
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
" # !rm \"{PARAMS_PATH}\"\n",
" pbar.update(55)\n",
"\n",
"except subprocess.CalledProcessError:\n",
" print(captured)\n",
" raise"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d8926b7d5529"
},
"source": [
"## Configure GPU Acceleration"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "VzJ5iMjTtoZw"
},
"outputs": [],
"source": [
"# Confirm accelerator configuration\n",
"import jax\n",
"\n",
"if jax.local_devices()[0].platform == \"tpu\":\n",
" raise RuntimeError(\n",
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
" )\n",
"elif jax.local_devices()[0].platform == \"cpu\":\n",
" print(\n",
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
" )\n",
"else:\n",
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
"\n",
"# Make sure all necessary environment variables are set.\n",
"import os\n",
"\n",
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "W4JpOs6oA-QS"
},
"source": [
"## Making a prediction\n",
"\n",
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
"\n",
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
"\n",
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
"\n",
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b310d44229d0"
},
"outputs": [],
"source": [
"# Input sequences (type: str)\n",
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
"sequence_2 = \"\"\n",
"sequence_3 = \"\"\n",
"sequence_4 = \"\"\n",
"sequence_5 = \"\"\n",
"sequence_6 = \"\"\n",
"sequence_7 = \"\"\n",
"sequence_8 = \"\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "rowN0bVYLe9n"
},
"outputs": [],
"source": [
"from alphafold.notebooks import notebook_utils\n",
"\n",
"input_sequences = (\n",
" sequence_1,\n",
" sequence_2,\n",
" sequence_3,\n",
" sequence_4,\n",
" sequence_5,\n",
" sequence_6,\n",
" sequence_7,\n",
" sequence_8,\n",
")\n",
"\n",
"# If folding a complex target and all the input sequences are\n",
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
"# otherwise or if the origin is unknown.\n",
"\n",
"is_prokaryote = False # @param {type:\"boolean\"}\n",
"\n",
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
"MAX_MULTIMER_LENGTH = 2500\n",
"\n",
"# Validate the input.\n",
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
" input_sequences=input_sequences,\n",
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "db551d4877ea"
},
"source": [
"## Search against genetic databases\n",
"\n",
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "2tTeTTsLKPjB"
},
"outputs": [],
"source": [
"import collections\n",
"import copy\n",
"import random\n",
"from concurrent import futures\n",
"from urllib import request\n",
"\n",
"import matplotlib.pyplot as plt\n",
"import numpy as np\n",
"import py3Dmol\n",
"from alphafold.common import protein\n",
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
" pipeline_multimer)\n",
"from alphafold.data.tools import jackhmmer\n",
"from alphafold.model import config, data, model\n",
"from alphafold.relax import relax, utils\n",
"from IPython import display\n",
"from ipywidgets import GridspecLayout, Output\n",
"\n",
"# Color bands for visualizing plddt\n",
"PLDDT_BANDS = [\n",
" (0, 50, \"#FF7D45\"),\n",
" (50, 70, \"#FFDB13\"),\n",
" (70, 90, \"#65CBF3\"),\n",
" (90, 100, \"#0053D6\"),\n",
"]\n",
"\n",
"# --- Find the closest source ---\n",
"test_url_pattern = (\n",
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
")\n",
"ex = futures.ThreadPoolExecutor(3)\n",
"\n",
"\n",
"def fetch(source):\n",
" request.urlretrieve(test_url_pattern.format(source))\n",
" return source\n",
"\n",
"\n",
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
"source = None\n",
"for f in futures.as_completed(fs):\n",
" source = f.result()\n",
" ex.shutdown()\n",
" break\n",
"\n",
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
"# The z_value is the number of sequences in a database.\n",
"MSA_DATABASES = [\n",
" {\n",
" \"db_name\": \"uniref90\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 59,\n",
" \"z_value\": 135_301_051,\n",
" },\n",
" {\n",
" \"db_name\": \"smallbfd\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
" \"num_streamed_chunks\": 17,\n",
" \"z_value\": 65_984_053,\n",
" },\n",
" {\n",
" \"db_name\": \"mgnify\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
" \"num_streamed_chunks\": 71,\n",
" \"z_value\": 304_820_129,\n",
" },\n",
"]\n",
"\n",
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
" MSA_DATABASES.extend(\n",
" [\n",
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
" {\n",
" \"db_name\": \"uniprot\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 98,\n",
" \"z_value\": 219_174_961 + 565_254,\n",
" },\n",
" ]\n",
" )\n",
"\n",
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
"\n",
"MAX_HITS = {\n",
" \"uniref90\": 10_000,\n",
" \"smallbfd\": 5_000,\n",
" \"mgnify\": 501,\n",
" \"uniprot\": 50_000,\n",
"}\n",
"\n",
"\n",
"def get_msa(fasta_path):\n",
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
"\n",
" # Run the search against chunks of genetic databases.\n",
" raw_msa_results = collections.defaultdict(list)\n",
" with tqdm.notebook.tqdm(\n",
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
" ) as pbar:\n",
"\n",
" def jackhmmer_chunk_callback(i):\n",
" pbar.update(n=1)\n",
"\n",
" for db_config in MSA_DATABASES:\n",
" db_name = db_config[\"db_name\"]\n",
" pbar.set_description(f\"Searching {db_name}\")\n",
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
" binary_path=JACKHMMER_BINARY_PATH,\n",
" database_path=db_config[\"db_path\"],\n",
" get_tblout=True,\n",
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
" streaming_callback=jackhmmer_chunk_callback,\n",
" z_value=db_config[\"z_value\"],\n",
" )\n",
" # Group the results by database name.\n",
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
"\n",
" return raw_msa_results\n",
"\n",
"\n",
"features_for_chain = {}\n",
"raw_msa_results_for_sequence = {}\n",
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
"\n",
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
" with open(fasta_path, \"wt\") as f:\n",
" f.write(f\">query\\n{sequence}\")\n",
"\n",
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
" if sequence not in raw_msa_results_for_sequence:\n",
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
" else:\n",
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
"\n",
" # Extract the MSAs from the Stockholm files.\n",
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
" single_chain_msas = []\n",
" uniprot_msa = None\n",
" for db_name, db_results in raw_msa_results.items():\n",
" merged_msa = notebook_utils.merge_chunked_msa(\n",
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
" )\n",
" if merged_msa.sequences and db_name != \"uniprot\":\n",
" single_chain_msas.append(merged_msa)\n",
" msa_size = len(set(merged_msa.sequences))\n",
" print(\n",
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
" )\n",
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
" uniprot_msa = merged_msa\n",
"\n",
" notebook_utils.show_msa_info(\n",
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
" )\n",
"\n",
" # Turn the raw data into model features.\n",
" feature_dict = {}\n",
" feature_dict.update(\n",
" pipeline.make_sequence_features(\n",
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
" )\n",
" )\n",
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
" feature_dict.update(\n",
" notebook_utils.empty_placeholder_template_features(\n",
" num_templates=0, num_res=len(sequence)\n",
" )\n",
" )\n",
"\n",
" # Construct the all_seq features only for heteromers, not homomers.\n",
" if (\n",
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
" and len(set(sequences)) > 1\n",
" ):\n",
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
" \"msa_uniprot_accession_identifiers\",\n",
" \"msa_species_identifiers\",\n",
" )\n",
" all_seq_features = {\n",
" f\"{k}_all_seq\": v\n",
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
" if k in valid_feats\n",
" }\n",
" feature_dict.update(all_seq_features)\n",
"\n",
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
"\n",
"\n",
"# Do further feature post-processing depending on the model type.\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
"\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" all_chain_features = {}\n",
" for chain_id, chain_features in features_for_chain.items():\n",
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
" chain_features, chain_id\n",
" )\n",
"\n",
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
"\n",
" np_example = feature_processing.pair_and_merge(\n",
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
" )\n",
"\n",
" # Pad MSA to avoid zero-sized extra_msa.\n",
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9640643486bd"
},
"source": [
"## Run AlphaFold\n",
"\n",
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "XUo6foMQxwS2"
},
"outputs": [],
"source": [
"run_relax = True\n",
"\n",
"# --- Run the model ---\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
"\n",
"output_dir = \"prediction\"\n",
"os.makedirs(output_dir, exist_ok=True)\n",
"\n",
"plddts = {}\n",
"ranking_confidences = {}\n",
"pae_outputs = {}\n",
"unrelaxed_proteins = {}\n",
"\n",
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" for model_name in model_names:\n",
" pbar.set_description(f\"Running {model_name}\")\n",
"\n",
" cfg = config.model_config(model_name)\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" cfg.data.eval.num_ensemble = 1\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" cfg.model.num_ensemble_eval = 1\n",
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
" model_runner = model.RunModel(cfg, params)\n",
" processed_feature_dict = model_runner.process_features(\n",
" np_example, random_seed=0\n",
" )\n",
" prediction = model_runner.predict(\n",
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
" )\n",
"\n",
" mean_plddt = prediction[\"plddt\"].mean()\n",
"\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" if \"predicted_aligned_error\" in prediction:\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
" else:\n",
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
" # should never get selected.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" # Multimer models are sorted by pTM+ipTM.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
"\n",
" # Set the b-factors to the per-residue plddt.\n",
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
" unrelaxed_protein = protein.from_prediction(\n",
" processed_feature_dict,\n",
" prediction,\n",
" b_factors=b_factors,\n",
" remove_leading_feature_dimension=(\n",
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
" ),\n",
" )\n",
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
"\n",
" # Delete unused outputs to save memory.\n",
" del model_runner\n",
" del params\n",
" del prediction\n",
" pbar.update(n=1)\n",
"\n",
" # --- AMBER relax the best model ---\n",
"\n",
" # Find the best model according to the mean pLDDT.\n",
" best_model_name = max(\n",
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
" )\n",
"\n",
" if run_relax:\n",
" pbar.set_description(\"AMBER relaxation\")\n",
" amber_relaxer = relax.AmberRelaxation(\n",
" max_iterations=0,\n",
" tolerance=2.39,\n",
" stiffness=10.0,\n",
" exclude_residues=[],\n",
" max_outer_iterations=3,\n",
" )\n",
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
" prot=unrelaxed_proteins[best_model_name]\n",
" )\n",
" else:\n",
" print(\"Warning: Running without the relaxation stage.\")\n",
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
" pbar.update(n=1) # Finished AMBER relax.\n",
"\n",
"# Construct multiclass b-factors to indicate confidence bands\n",
"# 0=very low, 1=low, 2=confident, 3=very high\n",
"banded_b_factors = []\n",
"for plddt in plddts[best_model_name]:\n",
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
" if plddt >= min_val and plddt <= max_val:\n",
" banded_b_factors.append(idx)\n",
" break\n",
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
"\n",
"\n",
"# Write out the prediction\n",
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
"with open(pred_output_path, \"w\") as f:\n",
" f.write(relaxed_pdb)\n",
"\n",
"\n",
"# --- Visualise the prediction & confidence ---\n",
"show_sidechains = True\n",
"\n",
"\n",
"def plot_plddt_legend():\n",
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
" thresh = [\n",
" \"Very low (pLDDT < 50)\",\n",
" \"Low (70 > pLDDT > 50)\",\n",
" \"Confident (90 > pLDDT > 70)\",\n",
" \"Very high (pLDDT > 90)\",\n",
" ]\n",
"\n",
" colors = [x[2] for x in PLDDT_BANDS]\n",
"\n",
" plt.figure(figsize=(2, 2))\n",
" for c in colors:\n",
" plt.bar(0, 0, color=c)\n",
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
" plt.xticks([])\n",
" plt.yticks([])\n",
" ax = plt.gca()\n",
" ax.spines[\"right\"].set_visible(False)\n",
" ax.spines[\"top\"].set_visible(False)\n",
" ax.spines[\"left\"].set_visible(False)\n",
" ax.spines[\"bottom\"].set_visible(False)\n",
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
" return plt\n",
"\n",
"\n",
"# Show the structure coloured by chain if the multimer model has been used.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" multichain_view = py3Dmol.view(width=800, height=600)\n",
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
" multichain_view.zoomTo()\n",
" multichain_view.show()\n",
"\n",
"# Color the structure by per-residue pLDDT\n",
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
"view = py3Dmol.view(width=800, height=600)\n",
"view.addModelsAsFrames(to_visualize_pdb)\n",
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
"if show_sidechains:\n",
" style[\"stick\"] = {}\n",
"view.setStyle({\"model\": -1}, style)\n",
"view.zoomTo()\n",
"\n",
"grid = GridspecLayout(1, 2)\n",
"out = Output()\n",
"with out:\n",
" view.show()\n",
"grid[0, 0] = out\n",
"\n",
"out = Output()\n",
"with out:\n",
" plot_plddt_legend().show()\n",
"grid[0, 1] = out\n",
"\n",
"display.display(grid)\n",
"\n",
"# Display pLDDT and predicted aligned error (if output by the model).\n",
"if pae_outputs:\n",
" num_plots = 2\n",
"else:\n",
" num_plots = 1\n",
"\n",
"plt.figure(figsize=[8 * num_plots, 6])\n",
"plt.subplot(1, num_plots, 1)\n",
"plt.plot(plddts[best_model_name])\n",
"plt.title(\"Predicted LDDT\")\n",
"plt.xlabel(\"Residue\")\n",
"plt.ylabel(\"pLDDT\")\n",
"\n",
"if num_plots == 2:\n",
" plt.subplot(1, 2, 2)\n",
" pae, max_pae = list(pae_outputs.values())[0]\n",
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
" plt.colorbar(fraction=0.046, pad=0.04)\n",
"\n",
" # Display lines at chain boundaries.\n",
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
" chain_ids = best_unrelaxed_prot.chain_index\n",
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
" if chain_boundary.size:\n",
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
"\n",
" plt.title(\"Predicted Aligned Error\")\n",
" plt.xlabel(\"Scored residue\")\n",
" plt.ylabel(\"Aligned residue\")\n",
"\n",
"# Save the predicted aligned error (if it exists).\n",
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
"if pae_outputs:\n",
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
" with open(pae_output_path, \"w\") as f:\n",
" f.write(pae_data)\n",
"\n",
"!zip -q -r {output_dir}.zip {output_dir}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lUQAn5LYC5n4"
},
"source": [
"### Interpreting the prediction\n",
"\n",
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
"\n",
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jeb2z8DIA4om"
},
"source": [
"## FAQ & Troubleshooting\n",
"\n",
"\n",
"* How do I get a predicted protein structure for my protein?\n",
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
"* How long will this take?\n",
" * The search against genetic databases can take minutes to hours.\n",
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
"* My notebook no longer seems to be doing anything, what should I do?\n",
" * Some steps may take minutes to hours to complete.\n",
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
"* How does this compare to the open-source version of AlphaFold?\n",
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
"* Does this tool install anything on my computer?\n",
" * No, everything happens in the VM instance within your Google Cloud project.\n",
"* How should I share feedback and bug reports?\n",
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
"\n",
"\n",
"## Related work\n",
"\n",
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
"\n",
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "YfPhvYgKC81B"
},
"source": [
"# License and Disclaimer\n",
"\n",
"This is not an officially-supported Google product.\n",
"\n",
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
"\n",
"Copyright 2021 DeepMind Technologies Limited.\n",
"\n",
"\n",
"## AlphaFold Code License\n",
"\n",
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
"\n",
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
"\n",
"## Model Parameters License\n",
"\n",
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
"\n",
"\n",
"## Third-party software\n",
"\n",
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
"\n",
"\n",
"## Mirrored Databases\n",
"\n",
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
]
}
],
"metadata": {
"accelerator": "GPU",
"colab": {
"collapsed_sections": [],
"name": "AlphaFold.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,82 @@
# Copyright 2022 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
ARG CUDA_MAJOR=11
ARG CUDA_MINOR=0
FROM gcr.io/deeplearning-platform-release/base-cu110
ARG CUDA_MAJOR
ARG CUDA_MINOR
SHELL ["/bin/bash", "-c"]
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
build-essential \
cmake \
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
git \
hmmer \
kalign \
tzdata \
wget \
&& rm -rf /var/lib/apt/lists/*
# Compile HHsuite from source.
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
&& mkdir /tmp/hh-suite/build \
&& pushd /tmp/hh-suite/build \
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
&& make -j 4 && make install \
&& ln -s /opt/hhsuite/bin/* /usr/bin \
&& popd \
&& rm -rf /tmp/hh-suite
ENV PATH="/opt/conda/bin:$PATH"
RUN conda update -qy conda \
&& conda install -y -c conda-forge \
openmm=7.5.1 \
cudatoolkit==${CUDA_VERSION} \
pdbfixer \
pip \
python=3.7
COPY . /app/alphafold
# Install pip packages.
RUN pip3 install --upgrade pip \
&& pip3 install -r /app/alphafold/requirements.txt \
&& pip3 install py3Dmol tqdm \
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
https://storage.googleapis.com/jax-releases/jax_releases.html
# Install alphafold.
WORKDIR /app/alphafold
RUN python setup.py install
# Apply OpenMM patch.
WORKDIR /opt/conda/lib/python3.7/site-packages
RUN patch -p0 < /app/alphafold/docker/openmm.patch
# Creating a tmp location for jackhmmr; not mounting through to host though.
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
# details.
# ENTRYPOINT does not support easily running multiple commands, so instead we
# write a shell script to wrap them up.
WORKDIR /home/jupyter
RUN echo '#!/bin/bash\nldconfig\n\'
+20
View File
@@ -0,0 +1,20 @@
#!/usr/bin/env bash
set -e
# Prod (Publicly viewable)
PROJECT=cloud-devrel-public-resources
REPOSITORY=alphafold
LOCAL_IMAGE=alphafold-on-gcp
REMOTE_IMAGE=${LOCAL_IMAGE?}
TAG=latest
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
git clone https://github.com/deepmind/alphafold.git
cp Dockerfile alphafold/docker/Dockerfile
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
sudo docker push ${REGISTRY?}
Binary file not shown.

After

Width:  |  Height:  |  Size: 3.1 KiB

@@ -0,0 +1,5 @@
testdata/*
build.py
test.py
state_dict.pth
config.json
@@ -0,0 +1,6 @@
cpr_model_server.py
entrypoint.py
state_dict.pth
config.json
**/__pycache__
!testdata/**
@@ -0,0 +1,110 @@
# CPR Example: PyTorch Image Models (timm)
## About CPR
CPR ([custom prediction routines](https://github.com/googleapis/python-aiplatform/blob/main/google/cloud/aiplatform/prediction/README.md)) is a framework designed by Google Cloud developers to make it easier to combine machine learning models with custom preprocessing and postprocessing logic in a real-time serving application.
## Using this example
This code is a self-contained example of a custom model server project built using CPR.
As is, you can use it to serve the ViT-Small image classification model from Ross Wightman's [`timm`](https://github.com/rwightman/pytorch-image-models) library of image model implementations in PyTorch. Both CPU and GPU are supported.
You can also consider using the code here as a template for your own CPR project if you want to use a different model from `timm`, a different PyTorch model, or an entirely different framework.
### Requirements
In order to use this example, you'll need Docker and Python 3 installed on your system.
To get started, first create a virtual environment in an empty directory:
```sh
mkdir cpr-example
python3 -m venv cpr-example
cd cpr-example && source bin/activate
```
Then, clone the [vertex-ai-samples repo](https://github.com/GoogleCloudPlatform/vertex-ai-samples) in that directory:
```sh
git clone https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
cd vertex-ai-samples/community-content/cpr-examples/timm_serving
```
Finally, install the Python modules required to build and run the model server:
```sh
pip install -r requirements.txt
```
### Auth
This example uses Google Cloud Storage for hosting model artifacts and Artifact Registry to store the container image.
You'll need to authorize yourself before you can interact with these.
First, log in to GCP with application default credentials:
```sh
gcloud auth application-default login
```
Next, if you haven't done so already, set up the [gcloud credential helper](https://cloud.google.com/artifact-registry/docs/docker/authentication)
for the Artifact Registry region where you intend to host the image.
```
gcloud auth configure-docker <region>-docker.pkg.dev
```
### Predictor
The `TimmPredictor` class in `timm_serving/predictor.py` implements most of the important logic for the server.
- `load(artifacts_dir)`: The predictor's `load` method is called when the server starts up in order to set up the predictor, usually by loading model weights and any artifacts needed for preprocessing and postprocessing. In this example, we initialize the saved model from the `state_dict.pth` file located inside the `artifacts_dir` folder and create the preprocessing transform from the model config.
- `preprocess`, `predict`, `postprocess`: These methods are applied in sequence to the deserialized JSON data from each request.
- `preprocess` decodes images from base64 and apply cropping, scaling and normalizing transforms.
- `predict` runs the ViT-Small model on the preprocessed images and returns class scores.
- `postprocess` finds the top five classes and packs the class names, probabilities, and indices in a serializable result.
### Building the container
To build the model server locally, run the build command:
```sh
python build.py build
```
You can edit configuration values such as the model server's base image, the name and tag assigned to the image, and the path where model weights are stored locally.
When you run the build command, model weights are downloaded and the model server container is built.
### Running local tests
`test.py` contains a suite of unit tests for the predictor as well as end-to-end tests for the model server.
To run the tests:
```sh
python test.py
```
All of the test images are public domain.
- [Cat](https://commons.wikimedia.org/wiki/File:Stray_cat_on_wall.jpg)
- [Airplane](https://commons.wikimedia.org/wiki/File:Airplanes_jets.jpg)
- The infamous [mandrill](https://commons.wikimedia.org/wiki/File:Wikipedia-sipi-image-db-mandrill-4.2.03.png)
### Deploying to Vertex AI
Before uploading or deploying the container, you'll need to modify `config.py` to set appropriate values for:
- `project_id`: Your GCP project id.
- `region`: Region where the model will be uploaded and deployed.
- `repository`: [Artifact Registry repository](https://cloud.google.com/artifact-registry/docs/repositories/create-repos) in your project where the container image will be uploaded.
- `artifacts_gcs_dir`: Folder in a [Google Cloud Storage bucket](https://cloud.google.com/storage/docs/creating-buckets) where the model weights will be uploaded.
Once this is done, first upload the model:
```sh
python build.py upload
```
Then deploy it:
```sh
python build.py deploy
```
If you run the deploy command again, it will create a new endpoint. If you want to undeploy the model, you can do so using the Vertex AI dashboard on the Google Cloud console, or use `gcloud ai endpoints undeploy` from the command line.
After deploying successfully, you can run `python build.py probe` to send a sample request to the deployed model.
@@ -0,0 +1,117 @@
# Copyright 2022 Google LLC
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# https://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Build the model server container."""
import json
import logging
import os
import pathlib
from typing import Sequence
from absl import app
from absl import logging
from config import CPRConfig
from google.cloud import aiplatform
from google.cloud.aiplatform import prediction as cpr
import smart_open
import timm
from timm_serving import predictor
import torch
def build_container(config: CPRConfig, tag: str) -> cpr.LocalModel:
"""Build the model server container.
Args:
tag: Output image tag.
Returns:
LocalModel exposing the built model server.
"""
return cpr.LocalModel.build_cpr_model(
src_dir=os.path.join(os.getcwd()),
output_image_uri=tag,
base_image=config.base_image,
predictor=predictor.TimmPredictor,
requirements_path=os.path.join(os.getcwd(), "requirements.txt"),
)
def save_model_artifact(destination: str) -> None:
"""Save a copy of the model state dict."""
model = timm.create_model(predictor.TimmPredictor.TIMM_MODEL_NAME, pretrained=True)
dest_file = os.path.join(destination, predictor.TimmPredictor.WEIGHTS_FILE)
with smart_open.open(dest_file, "wb") as f:
torch.save(model, f)
logging.info("Saved model to %s", dest_file)
logging.info("%s parameters", sum(p.numel() for p in model.parameters()))
def upload_model(config: CPRConfig) -> aiplatform.Model:
"""Tag and upload the model server."""
ar_tag = (
f"{config.region}-docker.pkg.dev/{config.project_id}"
f"/{config.repository}/{config.image}"
)
local_model = build_container(config, tag=ar_tag)
aiplatform.init(project=config.project_id, location=config.region)
local_model.push_image()
aip_model = aiplatform.Model.upload(
local_model=local_model,
display_name=predictor.TimmPredictor.TIMM_MODEL_NAME,
artifact_uri=config.artifact_gcs_dir,
)
config.model_name = aip_model.resource_name
config.save()
return aip_model
def deploy_model(config: CPRConfig) -> aiplatform.Endpoint:
"""Deploy the model server to a Vertex Prediction endpoint."""
aiplatform.init(project=config.project_id, location=config.region)
aip_model = aiplatform.Model(model_name=config.model_name)
endpoint = aip_model.deploy(machine_type=config.machine_type)
config.endpoint_name = endpoint.resource_name
config.save()
return endpoint
def probe_prediction(config: CPRConfig, request_path: str) -> None:
"""Send a sample prediction request to the Vertex Prediction endpoint."""
aiplatform.init(project=config.project_id, location=config.region)
aip_endpoint = aiplatform.Endpoint(endpoint_name=config.endpoint_name)
with open(request_path) as f:
logging.info(aip_endpoint.predict(**json.load(f)))
def main(argv: Sequence[str]):
config = CPRConfig()
if pathlib.Path(config.config_file).exists():
config.load()
actions = set(argv[1:])
if "build" in actions:
build_container(config, config.image)
save_model_artifact(config.artifact_local_dir)
if "upload" in actions:
save_model_artifact(config.artifact_gcs_dir)
upload_model(config)
if "deploy" in actions:
deploy_model(config)
if "probe" in actions:
probe_prediction(config, request_path="sample_request.json")
if __name__ == "__main__":
app.run(main)
@@ -0,0 +1,76 @@
# Copyright 2022 Google LLC
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# https://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import dataclasses
import json
@dataclasses.dataclass
class CPRConfig(object):
"""Configure the build process by editing the default values here.
config_file: File path used to save values in this config. (Some
values, such as the model name, are generated at build time and
depended on by future steps, so saving it allows this script to
deploy the model without re-uploading it, for example.)
base_image: Base Docker image on top of which the model server will
be built. By default, a Debian-based Python 3 image without GPU
support will be used.
image: Name and tag assigned to the built model server image.
artifact_local_dir: Local directory where a copy of the pretrained model weights
will be saved.
region: Google Cloud Region where the model will be uploaded during the
build process.
project_id: Google Cloud project ID.
repository: Name of the Artifact Registry repository where the container
will be uploaded.
artifact_gcs_dir: Location on GCS where a copy of the pretrained model
weights will be uploaded.
model_name: Full resource path of the uploaded model. This is a write-only
field, the value is generated by Vertex AI when the model is uploaded.
endpoint_name: Full resource path of the created endpoint. This is a
write-only field, the value is generated by Vertex AI when the model is
deployed to an endpoint.
machine_type: Machine type to use when deploying the model.
"""
config_file: str = "config.json"
base_image: str = "python:3.10-bullseye"
image: str = "timm_predictor:latest"
artifact_local_dir: str = ""
region: str = "us-central1"
project_id: str = "<your project ID here>"
repository: str = "cpr-images"
artifact_gcs_dir: str = "gs://<your bucket ID here>/timm-vit224/"
model_name: str = ""
endpoint_name: str = ""
machine_type: str = "n1-standard-2"
def save(self):
with open(self.config_file, "w") as f:
json.dump(dataclasses.asdict(self), f, indent=2)
def load(self):
with open(self.config_file) as f:
self.__init__(**json.load(f))
@@ -0,0 +1,8 @@
absl-py==1.1.0
fastapi==0.75.2
uvicorn==0.18.2
timm==0.5.4
smart_open==6.0.0
google-cloud-storage>=1.26.0,<2.0.0dev
google-cloud-aiplatform[prediction]>=1.16.0
File diff suppressed because one or more lines are too long
@@ -0,0 +1,255 @@
"""Test the timm_serving predictor."""
import base64
import json
import logging
import os
import pickle
from typing import List, Dict
from absl import flags
from absl import logging
from absl.testing import absltest
from config import CPRConfig
import fastapi
from google.cloud import aiplatform
from google.cloud.aiplatform import prediction as cpr
import PIL
from timm_serving import predictor
import torch
VIT_SMALL_PARAMS = 22878952
def b64_encode_file(path: str) -> str:
"""Encode a file's contents as base64.
Args:
path: Path to the file.
Returns:
Base64-encoded contents of the file.
"""
with open(path, "rb") as f:
return str(base64.b64encode(f.read()), encoding="utf-8")
def make_instance_dict(
image_paths: List[str], base64_encodings: List[str]
) -> Dict[str, List[str]]:
"""Generate a dictionary similar to a parsed prediction server request.
Args:
image_paths: Paths to image files to include.
base64_encodings: Pre-encoded base64 strings.
Returns:
Dictionary of instances in the format accepted by the preprocessor.
"""
instances = [s for s in base64_encodings]
for path in image_paths:
instances.append(b64_encode_file(path))
return {"instances": instances}
def count_parameters(model: torch.nn.Module):
"""Count the parameters in a Pytorch model.
Args:
model: Pytorch model (nn.Module).
Returns:
Number of parameters in the model.
"""
return sum(p.numel() for p in model.parameters())
class PredictorUnitTests(absltest.TestCase):
"""Unit tests for timm_serving.predictor."""
def setUp(self):
super().setUp()
self.config = CPRConfig()
try:
self.config.load()
except FileNotFoundError:
logging.info("No saved config file found, using default values.")
self.predictor = predictor.TimmPredictor()
def test_load_from_saved_state_dict_ok(self):
self.predictor.load(self.config.artifact_local_dir)
self.assertEqual(count_parameters(self.predictor._model), VIT_SMALL_PARAMS)
def test_load_bad_path(self):
with self.assertRaises(FileNotFoundError):
self.predictor.load("testdata/")
with self.assertRaisesRegex(ValueError, "not a directory"):
self.predictor.load("blah")
def test_load_bad_data(self):
with self.assertRaises(pickle.UnpicklingError):
self.predictor.load("testdata/bad_model_1")
with self.assertRaisesRegex(RuntimeError, "Invalid magic number"):
self.predictor.load("testdata/bad_model_2")
def test_preprocess_ok(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = make_instance_dict(
base64_encodings=[],
image_paths=[
"testdata/airplane.jpg",
"testdata/mandrill.tiff",
"testdata/mandrill.tiff",
"testdata/cat_alpha.png",
],
)
result = self.predictor.preprocess(instance_dict)
self.assertEqual(result.size(), torch.Size([4, 3, 224, 224]))
self.assertEqual(result.dtype, torch.float32)
def test_preprocess_no_instances(self):
self.predictor.load(self.config.artifact_local_dir)
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess({})
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, 'must contain "instances"')
def test_preprocess_wrong_shape_instances(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = {"instances": [[b64_encode_file("testdata/mandrill.tiff")]]}
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess(instance_dict)
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, "not 'list'")
def test_preprocess_bad_base64(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = make_instance_dict(base64_encodings=["!@#$"], image_paths=[])
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess(instance_dict)
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, "[Bb]ase64")
def test_preprocess_not_image_data(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = make_instance_dict(
base64_encodings=[], image_paths=["testdata/bad.jpg"]
)
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess(instance_dict)
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, "image file")
def test_predict_ok(self):
self.predictor.load(self.config.artifact_local_dir)
inputs = torch.zeros(size=[2, 3, 224, 224], dtype=torch.float32)
if torch.cuda.device_count() > 0:
inputs = inputs.cuda()
result = self.predictor.predict(inputs)
self.assertEqual(result.size(), torch.Size([2, 1000]))
self.assertEqual(result.dtype, torch.float32)
def test_postprocess_ok(self):
class_probs = torch.zeros(size=[2, 1000])
class_probs[0, 0] = 1
class_probs[1, 123] = 1
result = self.predictor.postprocess(class_probs)
predictions = result["predictions"]
self.assertLen(predictions[0]["class_names"], 5)
self.assertLen(predictions[0]["indices"], 5)
self.assertLen(predictions[0]["probabilities"], 5)
self.assertLen(predictions[1]["class_names"], 5)
self.assertLen(predictions[1]["indices"], 5)
self.assertLen(predictions[1]["probabilities"], 5)
self.assertContainsSubsequence(predictions[0]["class_names"][0], "tench")
self.assertContainsSubsequence(
predictions[1]["class_names"][0], "spiny lobster"
)
class ServerEndToEndTests(absltest.TestCase):
"""End-to-end tests for the model server, using LocalEndpoint."""
def setUp(self):
super().setUp()
self.config = CPRConfig()
try:
self.config.load()
except FileNotFoundError:
logging.info("No saved config file found, using default values.")
self.local_model = cpr.LocalModel(
serving_container_spec=aiplatform.gapic.ModelContainerSpec(
image_uri=self.config.image
)
)
self.local_endpoint = self.local_model.deploy_to_local_endpoint(
artifact_uri=self.config.artifact_local_dir or os.getcwd()
)
self.local_endpoint.serve()
def tearDown(self):
self.local_endpoint.stop()
super().tearDown()
def test_e2e_healthcheck_ok(self):
health_check_response = self.local_endpoint.run_health_check()
self.assertEqual(health_check_response.status_code, 200)
self.assertEqual(health_check_response.content, b"{}")
def test_e2e_predict_ok(self):
predict_request = json.dumps(
make_instance_dict(
base64_encodings=[],
image_paths=[
"testdata/mandrill.tiff",
],
)
)
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 200)
predictions = response.json()["predictions"]
self.assertContainsSubsequence(predictions[0]["class_names"][0], "baboon")
def test_e2e_predict_bad_json_returns_400(self):
predict_request = "blah"
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
def test_e2e_predict_no_instances_returns_400(self):
predict_request = json.dumps({})
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
def test_e2e_predict_bad_base64_returns_400(self):
predict_request = json.dumps(
make_instance_dict(base64_encodings=["blah"], image_paths=[])
)
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
def test_e2e_predict_bad_image_returns_400(self):
predict_request = json.dumps(
make_instance_dict(base64_encodings=[], image_paths=["testdata/bad.jpg"])
)
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
if __name__ == "__main__":
absltest.main()
Binary file not shown.

After

Width:  |  Height:  |  Size: 30 KiB

@@ -0,0 +1 @@
some non-image data
@@ -0,0 +1 @@
some non-image data
@@ -0,0 +1 @@
blah
Binary file not shown.

After

Width:  |  Height:  |  Size: 348 KiB

File diff suppressed because it is too large Load Diff
@@ -0,0 +1,178 @@
# Copyright 2022 Google LLC
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# https://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Adapts a pretrained TIMM image classification model to the CPR framework.
Documentation for the TIMM (Torch IMage Models) library is here:
https://rwightman.github.io/pytorch-image-models/
Its source can also be found here:
https://github.com/rwightman/pytorch-image-models
"""
import base64
import binascii
import io
import os
from typing import Dict, List, Union
from fastapi import HTTPException
from google.cloud.aiplatform import prediction as cpr
from pathlib import Path
import PIL
import smart_open
import timm
import torch
import torch.nn.functional as F
with open(Path(__file__).parent.absolute().joinpath("imagenet.txt")) as f:
IMAGENET_CLASSES = f.read().splitlines()
class TimmPredictor(cpr.predictor.Predictor):
"""Predictor class for image models based on TIMM."""
TIMM_MODEL_NAME = os.getenv("TIMM_MODEL_NAME", default="vit_small_patch32_224")
WEIGHTS_FILE = "state_dict.pth"
NUM_TOP_CLASSES_TO_RETURN = 5
def __init__(self):
self._cuda = torch.cuda.device_count() > 0
def load(self, artifacts_uri: str = ""):
"""Initializes the model and preprocessing transforms.
Args:
artifacts_uri: Directory where state dict is stored. Can be a
GCS URI or local path.
"""
if artifacts_uri:
artifact_path = os.path.join(artifacts_uri)
if not (os.path.isdir(artifact_path) or artifact_path.startswith("gs://")):
raise ValueError("Provided artifact_uri is not a directory.")
else:
artifact_path = os.getcwd()
artifact_path = os.path.join(artifact_path, self.WEIGHTS_FILE)
with smart_open.open(artifact_path, "rb") as f:
self._model = torch.load(f)
if self._cuda:
self._model.cuda()
config = timm.data.resolve_data_config(model=self.TIMM_MODEL_NAME, args=[])
self._transform = timm.data.create_transform(
is_training=False, use_prefetcher=False, **config
)
def preprocess(self, request_dict: Dict[str, List[str]]) -> torch.Tensor:
"""Performs preprocessing.
By default, the server expects a request body consisting of a valid JSON
object. This will be parsed by the handler before it's evaluated by the
preprocess method.
Args:
request_dict: Parsed request body. We expect that the input consists of
a list of base64-encoded image files under the "instances" key. (Any
image format that PIL.image.open can handle is okay.)
Returns:
torch.Tensor containing the preprocessed images as a batch. If GPU is
available, the result tensor will be stored on GPU.
"""
if "instances" not in request_dict:
raise HTTPException(
status_code=400,
detail='Request must contain "instances" as a top-level key.',
)
tensors = []
for (i, image) in enumerate(request_dict["instances"]):
# We use Base64 encoding to handle image data.
# This is probably the best we can do while still using JSON input.
# Overriding the input format requires building a custom Handler.
try:
image_bytes = base64.b64decode(image, validate=True)
except (binascii.Error, TypeError) as e:
raise HTTPException(
status_code=400,
detail=f"Base64 decoding of the input image at index {i} failed:"
f" {str(e)}",
)
try:
pil_image = PIL.Image.open(io.BytesIO(image_bytes)).convert("RGB")
except PIL.UnidentifiedImageError:
raise HTTPException(
status_code=400,
detail=f"The input image at index {i} could not be identified as an"
" image file.",
)
tensors.append(self._transform(pil_image))
with torch.inference_mode():
result = torch.stack(tensors)
if self._cuda:
result = result.cuda()
return result
def predict(self, instances: torch.Tensor) -> torch.Tensor:
"""Performs prediction.
Args:
instances: torch.Tensor with type torch.float32 and shape
[?, 3, 224, 224], containing the pre-processed input images.
Returns:
Vector of scores with type torch.float32 and shape [?, 1000],
representing the model's estimate of the likelihood that the
input belongs to the Imagenet class with that index.
"""
with torch.inference_mode():
class_scores = self._model(instances)
return class_scores
def postprocess(
self, class_scores: torch.Tensor
) -> Dict[str, List[Dict[str, Union[str, int, float]]]]:
"""Translate the model output into a classification result.
Args:
class_scores: torch.Tensor with type torch.float32 and shape
[?, 1000], containing the scores assigned to each class by
the model.
Returns:
Dictionary containing the list of classification results. Each
classification result contains the probabilities, class names, and
class indices of the classes with the top class scores as reported by
the model.
"""
class_probs = F.softmax(class_scores, dim=1)
top_k = class_probs.topk(self.NUM_TOP_CLASSES_TO_RETURN)
top_k_values = top_k.values.numpy().tolist()
top_k_indices = top_k.indices.numpy().tolist()
predictions = [
dict(
probabilities=values,
indices=indices,
class_names=[IMAGENET_CLASSES[int(class_num)] for class_num in indices],
)
for (values, indices) in zip(top_k_values, top_k_indices)
]
return {"predictions": predictions}
@@ -0,0 +1,64 @@
name: Train linear regression model using scikit learn from CSV
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/ML_frameworks/Scikit_learn/Train_linear_regression_model/from_CSV/component.yaml'}
inputs:
- {name: dataset, type: CSV}
- {name: label_column_name, type: String}
outputs:
- {name: model, type: ScikitLearnPickleModel}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'scikit-learn==1.0.2' 'pandas==1.4.3' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'scikit-learn==1.0.2' 'pandas==1.4.3'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def train_linear_regression_model_using_scikit_learn_from_CSV(
dataset_path,
model_path,
label_column_name,
):
import pandas
import pickle
from sklearn import linear_model
df = pandas.read_csv(dataset_path)
model = linear_model.LinearRegression()
model.fit(
X=df.drop(columns=label_column_name),
y=df[label_column_name],
)
with open(model_path, "wb") as f:
pickle.dump(model, f)
import argparse
_parser = argparse.ArgumentParser(prog='Train linear regression model using scikit learn from CSV', description='')
_parser.add_argument("--dataset", dest="dataset_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--label-column-name", dest="label_column_name", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--model", dest="model_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parsed_args = vars(_parser.parse_args())
_outputs = train_linear_regression_model_using_scikit_learn_from_CSV(**_parsed_args)
args:
- --dataset
- {inputPath: dataset}
- --label-column-name
- {inputValue: label_column_name}
- --model
- {outputPath: model}
@@ -0,0 +1,163 @@
name: Train logistic regression model using scikit learn from CSV
description: Train logistic regression model using Scikit-learn
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/ML_frameworks/Scikit_learn/Train_logistic_regression_model/from_CSV/component.yaml'}
inputs:
- {name: dataset, type: CSV}
- {name: label_column_name, type: String}
- {name: penalty, type: String, default: l2, optional: true}
- {name: solver, type: String, default: lbfgs, optional: true}
- {name: max_iterations, type: Integer, default: '100', optional: true}
- {name: multi_class_mode, type: String, default: auto, optional: true}
- {name: random_seed, type: Integer, default: '0', optional: true}
outputs:
- {name: model, type: ScikitLearnPickleModel}
- {name: model_parameters, type: JsonObject}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'scikit-learn==1.0.2' 'pandas==1.4.3' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'scikit-learn==1.0.2' 'pandas==1.4.3'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def train_logistic_regression_model_using_scikit_learn_from_CSV(
dataset_path,
model_path,
label_column_name,
penalty = "l2", # l1, l2, elasticnet, none
solver = "lbfgs", # newton-cg, lbfgs, liblinear, sag, saga
max_iterations = 100,
multi_class_mode = "auto", # auto, ovr, multinomial
random_seed = 0,
):
"""Train logistic regression model using Scikit-learn
See https://scikit-learn.org/stable/modules/generated/sklearn.linear_model.LogisticRegression.html
"""
import json
import pandas
import pickle
from sklearn import linear_model
df = pandas.read_csv(dataset_path)
model = linear_model.LogisticRegression(
penalty=penalty,
#dual=False,
#tol=1e-4,
#C=1.0,
#fit_intercept=True,
#intercept_scaling=1,
#class_weight=None,
random_state=random_seed,
solver=solver,
max_iter=max_iterations,
multi_class=multi_class_mode,
#l1_ratio=None,
verbose=1,
)
model_parameters = model.get_params()
model_parameters_json = json.dumps(model_parameters, indent=2)
print("Model parameters:")
print(model_parameters_json)
print()
model.fit(
X=df.drop(columns=label_column_name),
y=df[label_column_name],
)
with open(model_path, "wb") as f:
pickle.dump(model, f)
return (model_parameters_json,)
def _serialize_json(obj) -> str:
if isinstance(obj, str):
return obj
import json
def default_serializer(obj):
if hasattr(obj, 'to_struct'):
return obj.to_struct()
else:
raise TypeError("Object of type '%s' is not JSON serializable and does not have .to_struct() method." % obj.__class__.__name__)
return json.dumps(obj, default=default_serializer, sort_keys=True)
import argparse
_parser = argparse.ArgumentParser(prog='Train logistic regression model using scikit learn from CSV', description='Train logistic regression model using Scikit-learn')
_parser.add_argument("--dataset", dest="dataset_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--label-column-name", dest="label_column_name", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--penalty", dest="penalty", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--solver", dest="solver", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--max-iterations", dest="max_iterations", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--multi-class-mode", dest="multi_class_mode", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--random-seed", dest="random_seed", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--model", dest="model_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=1)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = train_logistic_regression_model_using_scikit_learn_from_CSV(**_parsed_args)
_output_serializers = [
_serialize_json,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --dataset
- {inputPath: dataset}
- --label-column-name
- {inputValue: label_column_name}
- if:
cond: {isPresent: penalty}
then:
- --penalty
- {inputValue: penalty}
- if:
cond: {isPresent: solver}
then:
- --solver
- {inputValue: solver}
- if:
cond: {isPresent: max_iterations}
then:
- --max-iterations
- {inputValue: max_iterations}
- if:
cond: {isPresent: multi_class_mode}
then:
- --multi-class-mode
- {inputValue: multi_class_mode}
- if:
cond: {isPresent: random_seed}
then:
- --random-seed
- {inputValue: random_seed}
- --model
- {outputPath: model}
- '----output-paths'
- {outputPath: model_parameters}
@@ -0,0 +1,41 @@
name: Create PyTorch Model Archive with base handler
inputs:
- {name: Model, type: PyTorchScriptModule}
- {name: Model name, type: String, default: model}
- {name: Model version, type: String, default: "1.0"}
outputs:
- {name: Model archive, type: PyTorchModelArchive}
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/PyTorch/Create_PyTorch_Model_Archive/with_base_handler/component.yaml'
implementation:
container:
image: pytorch/torchserve:0.6.0-cpu
command:
- bash
- -exc
- |
model_path=$0
model_name=$1
model_version=$2
output_model_archive_path=$3
mkdir -p "$(dirname "$output_model_archive_path")"
# TODO: Use the built-in base_handler once my fix is merged: https://github.com/pytorch/serve/pull/1682
echo '
from ts.torch_handler import base_handler
class BaseHandler(base_handler.BaseHandler):
pass
' > base_handler.py # torch-model-archiver needs the handler to have .py extension
torch-model-archiver --model-name "$model_name" --version "$model_version" --serialized-file "$model_path" --handler base_handler.py
# torch-model-archiver does not allow specifying the output path, but always writes to "${model_name}.<format>"
expected_model_archive_path="${model_name}.mar"
mv "$expected_model_archive_path" "$output_model_archive_path"
- {inputPath: Model}
- {inputValue: Model name}
- {inputValue: Model version}
- {outputPath: Model archive}
@@ -0,0 +1,117 @@
name: Create fully connected pytorch network
description: Creates fully-connected network in PyTorch ScriptModule format
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/PyTorch/Create_fully_connected_network/component.yaml'}
inputs:
- {name: input_size, type: Integer}
- {name: hidden_layer_sizes, type: JsonArray, default: '[]', optional: true}
- {name: output_size, type: Integer, default: '1', optional: true}
- {name: activation_name, type: String, default: relu, optional: true}
- {name: output_activation_name, type: String, optional: true}
- {name: random_seed, type: Integer, default: '0', optional: true}
outputs:
- {name: model, type: PyTorchScriptModule}
implementation:
container:
image: pytorch/pytorch:1.7.1-cuda11.0-cudnn8-runtime
command:
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def create_fully_connected_pytorch_network(
input_size,
model_path,
hidden_layer_sizes = [],
output_size = 1,
activation_name = 'relu',
output_activation_name = None,
random_seed = 0,
):
'''Creates fully-connected network in PyTorch ScriptModule format'''
import torch
torch.manual_seed(random_seed)
activation = getattr(torch, activation_name, None) or getattr(torch.nn.functional, activation_name, None)
if not activation:
raise ValueError(f'Activation "{activation_name}" was not found.')
class ActivationLayer(torch.nn.Module):
def forward(self, input):
return activation(input)
layers = []
prev_layer_size = input_size
for layer_size in hidden_layer_sizes:
layer = torch.nn.Linear(prev_layer_size, layer_size)
prev_layer_size = layer_size
layers.append(layer)
layers.append(ActivationLayer())
# Adding the output layer
layers.append(torch.nn.Linear(prev_layer_size, output_size))
# Adding the optional activation after the output layer
if output_activation_name:
output_activation = getattr(torch, output_activation_name, None) or getattr(torch.nn.functional, output_activation_name, None)
class OutputActivationLayer(torch.nn.Module):
def forward(self, input):
return output_activation(input)
layers.append(OutputActivationLayer())
network = torch.nn.Sequential(*layers)
script_module = torch.jit.script(network)
print(script_module)
script_module.save(model_path)
import json
import argparse
_parser = argparse.ArgumentParser(prog='Create fully connected pytorch network', description='Creates fully-connected network in PyTorch ScriptModule format')
_parser.add_argument("--input-size", dest="input_size", type=int, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--hidden-layer-sizes", dest="hidden_layer_sizes", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--output-size", dest="output_size", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--activation-name", dest="activation_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--output-activation-name", dest="output_activation_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--random-seed", dest="random_seed", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--model", dest="model_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parsed_args = vars(_parser.parse_args())
_outputs = create_fully_connected_pytorch_network(**_parsed_args)
args:
- --input-size
- {inputValue: input_size}
- if:
cond: {isPresent: hidden_layer_sizes}
then:
- --hidden-layer-sizes
- {inputValue: hidden_layer_sizes}
- if:
cond: {isPresent: output_size}
then:
- --output-size
- {inputValue: output_size}
- if:
cond: {isPresent: activation_name}
then:
- --activation-name
- {inputValue: activation_name}
- if:
cond: {isPresent: output_activation_name}
then:
- --output-activation-name
- {inputValue: output_activation_name}
- if:
cond: {isPresent: random_seed}
then:
- --random-seed
- {inputValue: random_seed}
- --model
- {outputPath: model}
@@ -0,0 +1,209 @@
name: Train pytorch model from csv
description: Trains PyTorch model
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/PyTorch/Train_PyTorch_model/from_CSV/component.yaml'
inputs:
- {name: model, type: PyTorchScriptModule}
- {name: training_data, type: CSV}
- {name: label_column_name, type: String}
- {name: loss_function_name, type: String, default: mse_loss, optional: true}
- {name: number_of_epochs, type: Integer, default: '1', optional: true}
- {name: learning_rate, type: Float, default: '0.1', optional: true}
- {name: optimizer_name, type: String, default: Adadelta, optional: true}
- {name: optimizer_parameters, type: JsonObject, optional: true}
- {name: batch_size, type: Integer, default: '32', optional: true}
- {name: batch_log_interval, type: Integer, default: '100', optional: true}
- {name: random_seed, type: Integer, default: '0', optional: true}
outputs:
- {name: trained_model, type: PyTorchScriptModule}
implementation:
container:
image: pytorch/pytorch:1.7.1-cuda11.0-cudnn8-runtime
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'pandas==1.4.3' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet
--no-warn-script-location 'pandas==1.4.3' --user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def train_pytorch_model_from_csv(
model_path,
training_data_path,
trained_model_path,
label_column_name,
loss_function_name = 'mse_loss',
number_of_epochs = 1,
learning_rate = 0.1,
optimizer_name = 'Adadelta',
optimizer_parameters = None,
batch_size = 32,
batch_log_interval = 100,
random_seed = 0,
):
'''Trains PyTorch model'''
import pandas
import torch
torch.manual_seed(random_seed)
use_cuda = torch.cuda.is_available()
device = torch.device("cuda" if use_cuda else "cpu")
model = torch.jit.load(model_path)
model.to(device)
model.train()
optimizer_class = getattr(torch.optim, optimizer_name, None)
if not optimizer_class:
raise ValueError(f'Optimizer "{optimizer_name}" was not found.')
optimizer_parameters = optimizer_parameters or {}
optimizer_parameters['lr'] = learning_rate
optimizer = optimizer_class(model.parameters(), **optimizer_parameters)
loss_function = getattr(torch, loss_function_name, None) or getattr(torch.nn, loss_function_name, None) or getattr(torch.nn.functional, loss_function_name, None)
if not loss_function:
raise ValueError(f'Loss function "{loss_function_name}" was not found.')
class CsvDataset(torch.utils.data.Dataset):
def __init__(self, file_path, label_column_name, drop_nan_columns_or_rows = 'columns'):
dataframe = pandas.read_csv(file_path).convert_dtypes()
# Preventing error: default_collate: batch must contain tensors, numpy arrays, numbers, dicts or lists; found object
if drop_nan_columns_or_rows == 'columns':
non_nan_data = dataframe.dropna(axis='columns')
removed_columns = set(dataframe.columns) - set(non_nan_data.columns)
if removed_columns:
print('Skipping columns with NaNs: ' + str(removed_columns))
dataframe = non_nan_data
if drop_nan_columns_or_rows == 'rows':
non_nan_data = dataframe.dropna(axis='index')
number_of_removed_rows = len(dataframe) - len(non_nan_data)
if number_of_removed_rows:
print(f'Skipped {number_of_removed_rows} rows with NaNs.')
dataframe = non_nan_data
numerical_data = dataframe.select_dtypes(include='number')
non_numerical_data = dataframe.select_dtypes(exclude='number')
if not non_numerical_data.empty:
print('Skipping non-number columns:')
print(non_numerical_data.dtypes)
self._dataframe = dataframe
self.labels = numerical_data[[label_column_name]]
self.features = numerical_data.drop(columns=[label_column_name])
def __len__(self):
return len(self._dataframe)
def __getitem__(self, index):
return [self.features.loc[index].to_numpy(dtype='float32'), self.labels.loc[index].to_numpy(dtype='float32')]
dataset = CsvDataset(
file_path=training_data_path,
label_column_name=label_column_name,
)
train_loader = torch.utils.data.DataLoader(
dataset=dataset,
batch_size=batch_size,
shuffle=True,
)
last_full_batch_loss = None
for epoch in range(1, number_of_epochs + 1):
for batch_idx, (data, target) in enumerate(train_loader):
data, target = data.to(device), target.to(device)
optimizer.zero_grad()
output = model(data)
loss = loss_function(output, target)
loss.backward()
optimizer.step()
if len(data) == batch_size:
last_full_batch_loss = loss.item()
if batch_idx % batch_log_interval == 0:
print('Train Epoch: {} [{}/{} ({:.0f}%)]\tLoss: {:.6f}'.format(
epoch, batch_idx * len(data), len(train_loader.dataset),
100. * batch_idx / len(train_loader), loss.item()))
print(f'Training epoch {epoch} completed. Last full batch loss: {last_full_batch_loss:.6f}')
# print(optimizer.state_dict())
model.save(trained_model_path)
import json
import argparse
_parser = argparse.ArgumentParser(prog='Train pytorch model from csv', description='Trains PyTorch model')
_parser.add_argument("--model", dest="model_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--training-data", dest="training_data_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--label-column-name", dest="label_column_name", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--loss-function-name", dest="loss_function_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--number-of-epochs", dest="number_of_epochs", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--learning-rate", dest="learning_rate", type=float, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--optimizer-name", dest="optimizer_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--optimizer-parameters", dest="optimizer_parameters", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--batch-size", dest="batch_size", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--batch-log-interval", dest="batch_log_interval", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--random-seed", dest="random_seed", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--trained-model", dest="trained_model_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parsed_args = vars(_parser.parse_args())
_outputs = train_pytorch_model_from_csv(**_parsed_args)
args:
- --model
- {inputPath: model}
- --training-data
- {inputPath: training_data}
- --label-column-name
- {inputValue: label_column_name}
- if:
cond: {isPresent: loss_function_name}
then:
- --loss-function-name
- {inputValue: loss_function_name}
- if:
cond: {isPresent: number_of_epochs}
then:
- --number-of-epochs
- {inputValue: number_of_epochs}
- if:
cond: {isPresent: learning_rate}
then:
- --learning-rate
- {inputValue: learning_rate}
- if:
cond: {isPresent: optimizer_name}
then:
- --optimizer-name
- {inputValue: optimizer_name}
- if:
cond: {isPresent: optimizer_parameters}
then:
- --optimizer-parameters
- {inputValue: optimizer_parameters}
- if:
cond: {isPresent: batch_size}
then:
- --batch-size
- {inputValue: batch_size}
- if:
cond: {isPresent: batch_log_interval}
then:
- --batch-log-interval
- {inputValue: batch_log_interval}
- if:
cond: {isPresent: random_seed}
then:
- --random-seed
- {inputValue: random_seed}
- --trained-model
- {outputPath: trained_model}
@@ -0,0 +1,110 @@
name: Xgboost predict on CSV
description: Makes predictions using a trained XGBoost model.
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/XGBoost/Predict/component.yaml'}
inputs:
- {name: data, type: CSV, description: Feature data in Apache Parquet format.}
- {name: model, type: XGBoostModel, description: Trained model in binary XGBoost format.}
- {name: label_column_name, type: String, description: Optional. Name of the column
containing the label data that is excluded during the prediction., optional: true}
outputs:
- {name: predictions, description: Model predictions.}
implementation:
container:
image: python:3.10
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'xgboost==1.6.1' 'pandas==1.4.3' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'xgboost==1.6.1' 'pandas==1.4.3'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def xgboost_predict_on_CSV(
data_path,
model_path,
predictions_path,
label_column_name = None,
):
"""Makes predictions using a trained XGBoost model.
Args:
data_path: Feature data in Apache Parquet format.
model_path: Trained model in binary XGBoost format.
predictions_path: Model predictions.
label_column_name: Optional. Name of the column containing the label data that is excluded during the prediction.
Annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
"""
from pathlib import Path
import numpy
import pandas
import xgboost
df = pandas.read_csv(
data_path,
).convert_dtypes()
print("Evaluation data information:")
df.info(verbose=True)
# Converting column types that XGBoost does not support
for column_name, dtype in df.dtypes.items():
if dtype in ["string", "object"]:
print(f"Treating the {dtype.name} column '{column_name}' as categorical.")
df[column_name] = df[column_name].astype("category")
print(f"Inferred {len(df[column_name].cat.categories)} categories for the '{column_name}' column.")
# Working around the XGBoost issue with nullable floats: https://github.com/dmlc/xgboost/issues/8213
if pandas.api.types.is_float_dtype(dtype):
# Converting from "Float64" to "float64"
df[column_name] = df[column_name].astype(dtype.name.lower())
print("Final evaluation data information:")
df.info(verbose=True)
if label_column_name is not None:
df = df.drop(columns=[label_column_name])
testing_data = xgboost.DMatrix(
data=df,
enable_categorical=True,
)
model = xgboost.Booster(model_file=model_path)
predictions = model.predict(testing_data)
Path(predictions_path).parent.mkdir(parents=True, exist_ok=True)
numpy.savetxt(predictions_path, predictions)
import argparse
_parser = argparse.ArgumentParser(prog='Xgboost predict on CSV', description='Makes predictions using a trained XGBoost model.')
_parser.add_argument("--data", dest="data_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--model", dest="model_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--label-column-name", dest="label_column_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--predictions", dest="predictions_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parsed_args = vars(_parser.parse_args())
_outputs = xgboost_predict_on_CSV(**_parsed_args)
args:
- --data
- {inputPath: data}
- --model
- {inputPath: model}
- if:
cond: {isPresent: label_column_name}
then:
- --label-column-name
- {inputValue: label_column_name}
- --predictions
- {outputPath: predictions}
@@ -0,0 +1,241 @@
name: Train XGBoost model on CSV
description: Trains an XGBoost model.
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/XGBoost/Train/component.yaml'}
inputs:
- {name: training_data, type: CSV, description: Training data in CSV format.}
- {name: label_column_name, type: String, description: Name of the column containing
the label data.}
- {name: starting_model, type: XGBoostModel, description: Existing trained model to
start from (in the binary XGBoost format)., optional: true}
- {name: num_iterations, type: Integer, description: Number of boosting iterations.,
default: '10', optional: true}
- name: objective
type: String
description: |-
The learning task and the corresponding learning objective.
See https://xgboost.readthedocs.io/en/latest/parameter.html#learning-task-parameters
The most common values are:
"reg:squarederror" - Regression with squared loss (default).
"reg:logistic" - Logistic regression.
"binary:logistic" - Logistic regression for binary classification, output probability.
"binary:logitraw" - Logistic regression for binary classification, output score before logistic transformation
"rank:pairwise" - Use LambdaMART to perform pairwise ranking where the pairwise loss is minimized
"rank:ndcg" - Use LambdaMART to perform list-wise ranking where Normalized Discounted Cumulative Gain (NDCG) is maximized
default: reg:squarederror
optional: true
- {name: booster, type: String, description: 'The booster to use. Can be `gbtree`,
`gblinear` or `dart`; `gbtree` and `dart` use tree based models while `gblinear`
uses linear functions.', default: gbtree, optional: true}
- {name: learning_rate, type: Float, description: 'Step size shrinkage used in update
to prevents overfitting. Range: [0,1].', default: '0.3', optional: true}
- name: min_split_loss
type: Float
description: |-
Minimum loss reduction required to make a further partition on a leaf node of the tree.
The larger `min_split_loss` is, the more conservative the algorithm will be. Range: [0,Inf].
default: '0'
optional: true
- name: max_depth
type: Integer
description: |-
Maximum depth of a tree. Increasing this value will make the model more complex and more likely to overfit.
0 indicates no limit on depth. Range: [0,Inf].
default: '6'
optional: true
- {name: booster_params, type: JsonObject, description: 'Parameters for the booster.
See https://xgboost.readthedocs.io/en/latest/parameter.html', optional: true}
outputs:
- {name: model, type: XGBoostModel, description: Trained model in the binary XGBoost
format.}
- {name: model_config, type: XGBoostModelConfig, description: The internal parameter
configuration of Booster as a JSON string.}
implementation:
container:
image: python:3.10
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'xgboost==1.6.1' 'pandas==1.4.3' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'xgboost==1.6.1' 'pandas==1.4.3'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def train_XGBoost_model_on_CSV(
training_data_path,
model_path,
model_config_path,
label_column_name,
starting_model_path = None,
num_iterations = 10,
# Booster parameters
objective = "reg:squarederror",
booster = "gbtree",
learning_rate = 0.3,
min_split_loss = 0,
max_depth = 6,
booster_params = None,
):
"""Trains an XGBoost model.
Args:
training_data_path: Training data in CSV format.
model_path: Trained model in the binary XGBoost format.
model_config_path: The internal parameter configuration of Booster as a JSON string.
starting_model_path: Existing trained model to start from (in the binary XGBoost format).
label_column_name: Name of the column containing the label data.
num_iterations: Number of boosting iterations.
booster_params: Parameters for the booster. See https://xgboost.readthedocs.io/en/latest/parameter.html
objective: The learning task and the corresponding learning objective.
See https://xgboost.readthedocs.io/en/latest/parameter.html#learning-task-parameters
The most common values are:
"reg:squarederror" - Regression with squared loss (default).
"reg:logistic" - Logistic regression.
"binary:logistic" - Logistic regression for binary classification, output probability.
"binary:logitraw" - Logistic regression for binary classification, output score before logistic transformation
"rank:pairwise" - Use LambdaMART to perform pairwise ranking where the pairwise loss is minimized
"rank:ndcg" - Use LambdaMART to perform list-wise ranking where Normalized Discounted Cumulative Gain (NDCG) is maximized
booster: The booster to use. Can be `gbtree`, `gblinear` or `dart`; `gbtree` and `dart` use tree based models while `gblinear` uses linear functions.
learning_rate: Step size shrinkage used in update to prevents overfitting. Range: [0,1].
min_split_loss: Minimum loss reduction required to make a further partition on a leaf node of the tree.
The larger `min_split_loss` is, the more conservative the algorithm will be. Range: [0,Inf].
max_depth: Maximum depth of a tree. Increasing this value will make the model more complex and more likely to overfit.
0 indicates no limit on depth. Range: [0,Inf].
Annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
"""
import pandas
import xgboost
df = pandas.read_csv(
training_data_path,
).convert_dtypes()
print("Training data information:")
df.info(verbose=True)
# Converting column types that XGBoost does not support
for column_name, dtype in df.dtypes.items():
if dtype in ["string", "object"]:
print(f"Treating the {dtype.name} column '{column_name}' as categorical.")
df[column_name] = df[column_name].astype("category")
print(f"Inferred {len(df[column_name].cat.categories)} categories for the '{column_name}' column.")
# Working around the XGBoost issue with nullable floats: https://github.com/dmlc/xgboost/issues/8213
if pandas.api.types.is_float_dtype(dtype):
# Converting from "Float64" to "float64"
df[column_name] = df[column_name].astype(dtype.name.lower())
print()
print("Final training data information:")
df.info(verbose=True)
training_data = xgboost.DMatrix(
data=df.drop(columns=[label_column_name]),
label=df[[label_column_name]],
enable_categorical=True,
)
booster_params = booster_params or {}
booster_params.setdefault("objective", objective)
booster_params.setdefault("booster", booster)
booster_params.setdefault("learning_rate", learning_rate)
booster_params.setdefault("min_split_loss", min_split_loss)
booster_params.setdefault("max_depth", max_depth)
starting_model = None
if starting_model_path:
starting_model = xgboost.Booster(model_file=starting_model_path)
print()
print("Training the model:")
model = xgboost.train(
params=booster_params,
dtrain=training_data,
num_boost_round=num_iterations,
xgb_model=starting_model,
evals=[(training_data, "training_data")],
)
# Saving the model in binary format
model.save_model(model_path)
model_config_str = model.save_config()
with open(model_config_path, "w") as model_config_file:
model_config_file.write(model_config_str)
import json
import argparse
_parser = argparse.ArgumentParser(prog='Train XGBoost model on CSV', description='Trains an XGBoost model.')
_parser.add_argument("--training-data", dest="training_data_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--label-column-name", dest="label_column_name", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--starting-model", dest="starting_model_path", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--num-iterations", dest="num_iterations", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--objective", dest="objective", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--booster", dest="booster", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--learning-rate", dest="learning_rate", type=float, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--min-split-loss", dest="min_split_loss", type=float, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--max-depth", dest="max_depth", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--booster-params", dest="booster_params", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--model", dest="model_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--model-config", dest="model_config_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parsed_args = vars(_parser.parse_args())
_outputs = train_XGBoost_model_on_CSV(**_parsed_args)
args:
- --training-data
- {inputPath: training_data}
- --label-column-name
- {inputValue: label_column_name}
- if:
cond: {isPresent: starting_model}
then:
- --starting-model
- {inputPath: starting_model}
- if:
cond: {isPresent: num_iterations}
then:
- --num-iterations
- {inputValue: num_iterations}
- if:
cond: {isPresent: objective}
then:
- --objective
- {inputValue: objective}
- if:
cond: {isPresent: booster}
then:
- --booster
- {inputValue: booster}
- if:
cond: {isPresent: learning_rate}
then:
- --learning-rate
- {inputValue: learning_rate}
- if:
cond: {isPresent: min_split_loss}
then:
- --min-split-loss
- {inputValue: min_split_loss}
- if:
cond: {isPresent: max_depth}
then:
- --max-depth
- {inputValue: max_depth}
- if:
cond: {isPresent: booster_params}
then:
- --booster-params
- {inputValue: booster_params}
- --model
- {outputPath: model}
- --model-config
- {outputPath: model_config}
@@ -0,0 +1,204 @@
name: Split rows into subsets
description: Splits the data table according to the split fractions.
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/dataset_manipulation/Split_rows_into_subsets/in_CSV/component.yaml'}
inputs:
- {name: table, type: CSV}
- {name: fraction_1, type: Float, description: 'The proportion of the lines to put
into the 1st split. Range: [0, 1]'}
- name: fraction_2
type: Float
description: |-
The proportion of the lines to put into the 2nd split. Range: [0, 1]
If fraction_2 is not specified, then fraction_2 = 1 - fraction_1.
The remaining lines go to the 3rd split (if any).
optional: true
- {name: random_seed, type: Integer, default: '0', optional: true}
outputs:
- {name: split_1, type: CSV}
- {name: split_2, type: CSV}
- {name: split_3, type: CSV}
- {name: split_1_count, type: Integer}
- {name: split_2_count, type: Integer}
- {name: split_3_count, type: Integer}
implementation:
container:
image: python:3.9
command:
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def _make_parent_dirs_and_return_path(file_path: str):
import os
os.makedirs(os.path.dirname(file_path), exist_ok=True)
return file_path
def split_rows_into_subsets(
table_path,
split_1_path,
split_2_path,
split_3_path,
fraction_1,
fraction_2 = None,
random_seed = 0,
):
"""Splits the data table according to the split fractions.
Args:
fraction_1: The proportion of the lines to put into the 1st split. Range: [0, 1]
fraction_2: The proportion of the lines to put into the 2nd split. Range: [0, 1]
If fraction_2 is not specified, then fraction_2 = 1 - fraction_1.
The remaining lines go to the 3rd split (if any).
"""
import random
random.seed(random_seed)
SHUFFLE_BUFFER_SIZE = 10000
num_splits = 3
if fraction_1 < 0 or fraction_1 > 1:
raise ValueError("fraction_1 must be in between 0 and 1.")
if fraction_2 is None:
fraction_2 = 1 - fraction_1
if fraction_2 < 0 or fraction_2 > 1:
raise ValueError("fraction_2 must be in between 0 and 1.")
fraction_3 = 1 - fraction_1 - fraction_2
fractions = [
fraction_1,
fraction_2,
fraction_3,
]
assert sum(fractions) == 1
written_line_counts = [0] * num_splits
output_files = [
open(split_1_path, "wb"),
open(split_2_path, "wb"),
open(split_3_path, "wb"),
]
with open(table_path, "rb") as input_file:
# Writing the headers
header_line = input_file.readline()
for output_file in output_files:
output_file.write(header_line)
while True:
line_buffer = []
for i in range(SHUFFLE_BUFFER_SIZE):
line = input_file.readline()
if not line:
break
line_buffer.append(line)
# We need to exactly partition the lines between the output files
# To overcome possible systematic bias, we could calculate the total numbers
# of lines written to each file and take that into account.
num_read_lines = len(line_buffer)
number_of_lines_for_files = [0] * num_splits
# List that will have the index of the destination file for each line
file_index_for_line = []
remaining_lines = num_read_lines
remaining_fraction = 1
for i in range(num_splits):
number_of_lines_for_file = (
round(remaining_lines * (fractions[i] / remaining_fraction))
if remaining_fraction > 0
else 0
)
number_of_lines_for_files[i] = number_of_lines_for_file
remaining_lines -= number_of_lines_for_file
remaining_fraction -= fractions[i]
file_index_for_line.extend([i] * number_of_lines_for_file)
assert remaining_lines == 0, f"{remaining_lines}"
assert len(file_index_for_line) == num_read_lines
random.shuffle(file_index_for_line)
for i in range(num_read_lines):
output_files[file_index_for_line[i]].write(line_buffer[i])
written_line_counts[file_index_for_line[i]] += 1
# Exit if the file ended before we were able to fully fill the buffer
if len(line_buffer) != SHUFFLE_BUFFER_SIZE:
break
for output_file in output_files:
output_file.close()
return written_line_counts
def _serialize_int(int_value: int) -> str:
if isinstance(int_value, str):
return int_value
if not isinstance(int_value, int):
raise TypeError('Value "{}" has type "{}" instead of int.'.format(str(int_value), str(type(int_value))))
return str(int_value)
import argparse
_parser = argparse.ArgumentParser(prog='Split rows into subsets', description='Splits the data table according to the split fractions.')
_parser.add_argument("--table", dest="table_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--fraction-1", dest="fraction_1", type=float, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--fraction-2", dest="fraction_2", type=float, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--random-seed", dest="random_seed", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--split-1", dest="split_1_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--split-2", dest="split_2_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--split-3", dest="split_3_path", type=_make_parent_dirs_and_return_path, required=True, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=3)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = split_rows_into_subsets(**_parsed_args)
_output_serializers = [
_serialize_int,
_serialize_int,
_serialize_int,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --table
- {inputPath: table}
- --fraction-1
- {inputValue: fraction_1}
- if:
cond: {isPresent: fraction_2}
then:
- --fraction-2
- {inputValue: fraction_2}
- if:
cond: {isPresent: random_seed}
then:
- --random-seed
- {inputValue: random_seed}
- --split-1
- {outputPath: split_1}
- --split-2
- {outputPath: split_2}
- --split-3
- {outputPath: split_3}
- '----output-paths'
- {outputPath: split_1_count}
- {outputPath: split_2_count}
- {outputPath: split_3_count}
@@ -0,0 +1,241 @@
name: Deploy model to endpoint for Google Cloud Vertex AI Model
description: Deploys Google Cloud Vertex AI Model to a Google Cloud Vertex AI Endpoint.
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/KFPv2_hell/components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/workaround_for_buggy_KFPv2_compiler/component.yaml'}
inputs:
- {name: model_name, type: String, description: Full resource name of a Google Cloud
Vertex AI Model}
- name: endpoint_name
type: String
description: |-
Optional. Full name of Google Cloud Vertex Endpoint. A new
endpoint is created if the name is not passed.
optional: true
- name: machine_type
type: String
description: |-
The type of the machine. See the [list of machine types
supported for prediction
](https://cloud.google.com/vertex-ai/docs/predictions/configure-compute#machine-types).
Defaults to "n1-standard-2"
default: n1-standard-2
optional: true
- name: min_replica_count
type: Integer
description: |-
Optional. The minimum number of machine replicas this deployed
model will be always deployed on. If traffic against it increases,
it may dynamically be deployed onto more replicas, and as traffic
decreases, some of these extra replicas may be freed.
default: '1'
optional: true
- name: max_replica_count
type: Integer
description: |-
Optional. The maximum number of replicas this deployed model may
be deployed on when the traffic against it increases. If requested
value is too large, the deployment will error, but if deployment
succeeds then the ability to scale the model to that many replicas
is guaranteed (barring service outages). If traffic against the
deployed model increases beyond what its replicas at maximum may
handle, a portion of the traffic will be dropped. If this value
is not provided, the smaller value of min_replica_count or 1 will
be used.
default: '1'
optional: true
- name: accelerator_type
type: String
description: |-
Optional. Hardware accelerator type. Must also set accelerator_count if used.
One of ACCELERATOR_TYPE_UNSPECIFIED, NVIDIA_TESLA_K80, NVIDIA_TESLA_P100,
NVIDIA_TESLA_V100, NVIDIA_TESLA_P4, NVIDIA_TESLA_T4
optional: true
- {name: accelerator_count, type: Integer, description: Optional. The number of accelerators
to attach to a worker replica., optional: true}
outputs:
- {name: endpoint_name, type: String}
- {name: endpoint_dict, type: JsonObject}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-aiplatform==1.7.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'google-cloud-aiplatform==1.7.0'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def deploy_model_to_endpoint_for_Google_Cloud_Vertex_AI_Model(
model_name,
endpoint_name = None,
machine_type = "n1-standard-2",
min_replica_count = 1,
max_replica_count = 1,
accelerator_type = None,
accelerator_count = None,
#
# Uncomment when anyone requests these:
# deployed_model_display_name: str = None,
# traffic_percentage: int = 0,
# traffic_split: dict = None,
# service_account: str = None,
# explanation_metadata: "google.cloud.aiplatform_v1.types.explanation_metadata.ExplanationMetadata" = None,
# explanation_parameters: "google.cloud.aiplatform_v1.types.explanation.ExplanationParameters" = None,
#
# encryption_spec_key_name: str = None,
):
"""Deploys Google Cloud Vertex AI Model to a Google Cloud Vertex AI Endpoint.
Args:
model_name: Full resource name of a Google Cloud Vertex AI Model
endpoint_name: Optional. Full name of Google Cloud Vertex Endpoint. A new
endpoint is created if the name is not passed.
machine_type: The type of the machine. See the [list of machine types
supported for prediction
](https://cloud.google.com/vertex-ai/docs/predictions/configure-compute#machine-types).
Defaults to "n1-standard-2"
min_replica_count (int):
Optional. The minimum number of machine replicas this deployed
model will be always deployed on. If traffic against it increases,
it may dynamically be deployed onto more replicas, and as traffic
decreases, some of these extra replicas may be freed.
max_replica_count (int):
Optional. The maximum number of replicas this deployed model may
be deployed on when the traffic against it increases. If requested
value is too large, the deployment will error, but if deployment
succeeds then the ability to scale the model to that many replicas
is guaranteed (barring service outages). If traffic against the
deployed model increases beyond what its replicas at maximum may
handle, a portion of the traffic will be dropped. If this value
is not provided, the smaller value of min_replica_count or 1 will
be used.
accelerator_type (str):
Optional. Hardware accelerator type. Must also set accelerator_count if used.
One of ACCELERATOR_TYPE_UNSPECIFIED, NVIDIA_TESLA_K80, NVIDIA_TESLA_P100,
NVIDIA_TESLA_V100, NVIDIA_TESLA_P4, NVIDIA_TESLA_T4
accelerator_count (int):
Optional. The number of accelerators to attach to a worker replica.
"""
import json
from google.cloud import aiplatform
model = aiplatform.Model(model_name=model_name)
if endpoint_name:
endpoint = aiplatform.Endpoint(endpoint_name=endpoint_name)
else:
endpoint_display_name = model.display_name[:118] + "_endpoint"
endpoint = aiplatform.Endpoint.create(
display_name=endpoint_display_name,
project=model.project,
location=model.location,
# encryption_spec_key_name=encryption_spec_key_name,
labels={"component-source": "github-com-ark-kun-pipeline-components"},
)
endpoint = model.deploy(
endpoint=endpoint,
# deployed_model_display_name=deployed_model_display_name,
machine_type=machine_type,
min_replica_count=min_replica_count,
max_replica_count=max_replica_count,
accelerator_type=accelerator_type,
accelerator_count=accelerator_count,
# service_account=service_account,
# explanation_metadata=explanation_metadata,
# explanation_parameters=explanation_parameters,
# encryption_spec_key_name=encryption_spec_key_name,
)
endpoint_json = json.dumps(endpoint.to_dict(), indent=2)
print(endpoint_json)
return (endpoint.resource_name, endpoint_json)
def _serialize_json(obj) -> str:
if isinstance(obj, str):
return obj
import json
def default_serializer(obj):
if hasattr(obj, 'to_struct'):
return obj.to_struct()
else:
raise TypeError("Object of type '%s' is not JSON serializable and does not have .to_struct() method." % obj.__class__.__name__)
return json.dumps(obj, default=default_serializer, sort_keys=True)
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import argparse
_parser = argparse.ArgumentParser(prog='Deploy model to endpoint for Google Cloud Vertex AI Model', description='Deploys Google Cloud Vertex AI Model to a Google Cloud Vertex AI Endpoint.')
_parser.add_argument("--model-name", dest="model_name", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--endpoint-name", dest="endpoint_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--machine-type", dest="machine_type", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--min-replica-count", dest="min_replica_count", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--max-replica-count", dest="max_replica_count", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--accelerator-type", dest="accelerator_type", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--accelerator-count", dest="accelerator_count", type=int, required=False, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=2)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = deploy_model_to_endpoint_for_Google_Cloud_Vertex_AI_Model(**_parsed_args)
_output_serializers = [
_serialize_str,
_serialize_json,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --model-name
- {inputValue: model_name}
- if:
cond: {isPresent: endpoint_name}
then:
- --endpoint-name
- {inputValue: endpoint_name}
- if:
cond: {isPresent: machine_type}
then:
- --machine-type
- {inputValue: machine_type}
- if:
cond: {isPresent: min_replica_count}
then:
- --min-replica-count
- {inputValue: min_replica_count}
- if:
cond: {isPresent: max_replica_count}
then:
- --max-replica-count
- {inputValue: max_replica_count}
- if:
cond: {isPresent: accelerator_type}
then:
- --accelerator-type
- {inputValue: accelerator_type}
- if:
cond: {isPresent: accelerator_count}
then:
- --accelerator-count
- {inputValue: accelerator_count}
- '----output-paths'
- {outputPath: endpoint_name}
- {outputPath: endpoint_dict}
@@ -0,0 +1,297 @@
name: Upload PyTorch model archive to Google Cloud Vertex AI
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/KFPv2_hell/components/google-cloud/Vertex_AI/Models/Upload_PyTorch_model_archive/workaround_for_buggy_KFPv2_compiler/component.yaml'}
inputs:
- {name: model_archive, type: PyTorchModelArchive}
- {name: torchserve_version, type: String, default: 0.6.0, optional: true}
- name: use_gpu
type: Boolean
default: "False"
optional: true
- {name: display_name, type: String, optional: true}
- {name: description, type: String, optional: true}
- {name: project, type: String, optional: true}
- {name: location, type: String, optional: true}
- {name: labels, type: JsonObject, optional: true}
- {name: staging_bucket, type: String, optional: true}
outputs:
- {name: model_name, type: String}
- {name: model_dict, type: JsonObject}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-aiplatform==1.13.1' 'google-cloud-build==3.8.3' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-aiplatform==1.13.1'
'google-cloud-build==3.8.3' --user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI(
model_archive_path,
torchserve_version = "0.6.0",
use_gpu = False,
display_name = None,
description = None,
# Uncomment when anyone requests these:
# instance_schema_uri: str = None,
# parameters_schema_uri: str = None,
# prediction_schema_uri: str = None,
# explanation_metadata: "google.cloud.aiplatform_v1.types.explanation_metadata.ExplanationMetadata" = None,
# explanation_parameters: "google.cloud.aiplatform_v1.types.explanation.ExplanationParameters" = None,
project = None,
location = None,
labels = None,
# encryption_spec_key_name: str = None,
staging_bucket = None,
):
import json
import os
from google.cloud import aiplatform
if not location:
location = os.environ.get("CLOUD_ML_REGION")
if not labels:
labels = {}
labels["component-source"] = "github-com-ark-kun-pipeline-components"
container_image_tag = torchserve_version + "-" + ("gpu" if use_gpu else "cpu")
container_image_uri = f"pytorch/torchserve:{container_image_tag}"
# Vertex Endpoints refuse to support non-Google container registries.
# We have to work around this to reduce user frustration
# TODO: Remove this code when Vertex Endpoints service starts supporting other container registries.
def copy_container_image(
src_container_image_uri,
dst_container_image_uri,
project_id,
):
from google.cloud.devtools import cloudbuild
from google import protobuf
build_client = cloudbuild.CloudBuildClient()
build_config = cloudbuild.Build(
images=[dst_container_image_uri],
steps=[
cloudbuild.BuildStep(
name="gcr.io/cloud-builders/docker",
entrypoint="bash",
args=[
"-exc",
'docker pull --quiet "$0" && docker tag "$0" "$1"',
src_container_image_uri,
dst_container_image_uri,
],
),
],
timeout=protobuf.duration_pb2.Duration(
seconds=1800,
),
)
build_operation = build_client.create_build(
project_id=project_id,
build=build_config,
)
try:
result = build_operation.result()
except:
print(f"Logs are available at [{build_operation.metadata.build.log_url}].")
raise
return result
project_id = aiplatform.initializer.global_config.project
mirrored_container_uri = f"gcr.io/{project_id}/container_mirror/{container_image_uri}"
# FIX: Only mirror when image does not exist
# docker does is unable to get the registry data from inside container (it cannot connecto to docker socket):
# docker.errors.DockerException: Error while fetching server API version: ('Connection aborted.', FileNotFoundError(2, 'No such file or directory'))
# import docker
# try:
# docker_client = docker.from_env()
# docker_client.images.get_registry_data(mirrored_container_uri)
# except docker.errors.NotFound:
if True:
print(f"Mirroring {container_image_uri} to {mirrored_container_uri}")
copy_container_image(
src_container_image_uri=container_image_uri,
dst_container_image_uri=mirrored_container_uri,
project_id=project_id,
)
container_image_uri = mirrored_container_uri
# End of container image mirroring code
model_archive_file_name = os.path.basename(model_archive_path)
model_archive_dir = os.path.dirname(model_archive_path)
model = aiplatform.Model.upload(
# FIX: Use public image or mirror the official image
#serving_container_image_uri="gcr.io/avolkov-31337/mirror/pytorch/torchserve",
serving_container_image_uri=container_image_uri,
artifact_uri=model_archive_dir,
serving_container_command=[
"bash",
"-exc",
'''
model_archive_uri="$0"
#model_archive_local_path=$(mktemp --suffix ".mar")
# For some reason the model must already be inside the model-store directory.
model_archive_local_path=./model-store/model.mar
# Downloading the model archive from GCS
# TODO: Fix gsutil bugs (requires project ID, has auth issues) and use gsutil instead.
# gsutil cp "$model_archive_uri" "$model_archive_local_path"
pip install google-cloud-storage
python -c '
import sys
from google.cloud import storage
model_archive_uri = sys.argv[1]
model_archive_local_path = sys.argv[2]
storage_client = storage.Client()
blob = storage.Blob.from_string(uri=model_archive_uri, client=storage_client)
blob.download_to_filename(filename=model_archive_local_path)
' "$model_archive_uri" "$model_archive_local_path"
#Note: config.properties is owned by root. Our user is not root.
echo "
service_envelope=json
# Needed for external access
inference_address=http://0.0.0.0:8080
management_address=http://0.0.0.0:8081
" > config2.properties
torchserve --start --foreground --no-config-snapshots --models main-model="$model_archive_local_path" --model-store ./model-store/ --ts-config config2.properties
''',
"$(AIP_STORAGE_URI)/" + model_archive_file_name,
],
serving_container_predict_route="/predictions/main-model",
#serving_container_predict_route="/v1/models/main-model:predict",
serving_container_health_route="/ping",
serving_container_ports=[8080],
display_name=display_name,
description=description,
# instance_schema_uri=instance_schema_uri,
# parameters_schema_uri=parameters_schema_uri,
# prediction_schema_uri=prediction_schema_uri,
# explanation_metadata=explanation_metadata,
# explanation_parameters=explanation_parameters,
project=project,
location=location,
labels=labels,
# encryption_spec_key_name=encryption_spec_key_name,
staging_bucket=staging_bucket,
)
model_json = json.dumps(model.to_dict(), indent=2)
print(model_json)
return (model.resource_name, model_json)
def _deserialize_bool(s) -> bool:
from distutils.util import strtobool
return strtobool(s) == 1
def _serialize_json(obj) -> str:
if isinstance(obj, str):
return obj
import json
def default_serializer(obj):
if hasattr(obj, 'to_struct'):
return obj.to_struct()
else:
raise TypeError("Object of type '%s' is not JSON serializable and does not have .to_struct() method." % obj.__class__.__name__)
return json.dumps(obj, default=default_serializer, sort_keys=True)
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import json
import argparse
_parser = argparse.ArgumentParser(prog='Upload PyTorch model archive to Google Cloud Vertex AI', description='')
_parser.add_argument("--model-archive", dest="model_archive_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--torchserve-version", dest="torchserve_version", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--use-gpu", dest="use_gpu", type=_deserialize_bool, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--display-name", dest="display_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--description", dest="description", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--project", dest="project", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--location", dest="location", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--labels", dest="labels", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--staging-bucket", dest="staging_bucket", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=2)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = upload_PyTorch_model_archive_to_Google_Cloud_Vertex_AI(**_parsed_args)
_output_serializers = [
_serialize_str,
_serialize_json,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --model-archive
- {inputPath: model_archive}
- if:
cond: {isPresent: torchserve_version}
then:
- --torchserve-version
- {inputValue: torchserve_version}
- if:
cond: {isPresent: use_gpu}
then:
- --use-gpu
- {inputValue: use_gpu}
- if:
cond: {isPresent: display_name}
then:
- --display-name
- {inputValue: display_name}
- if:
cond: {isPresent: description}
then:
- --description
- {inputValue: description}
- if:
cond: {isPresent: project}
then:
- --project
- {inputValue: project}
- if:
cond: {isPresent: location}
then:
- --location
- {inputValue: location}
- if:
cond: {isPresent: labels}
then:
- --labels
- {inputValue: labels}
- if:
cond: {isPresent: staging_bucket}
then:
- --staging-bucket
- {inputValue: staging_bucket}
- '----output-paths'
- {outputPath: model_name}
- {outputPath: model_dict}
@@ -0,0 +1,181 @@
name: Upload Scikit learn pickle model to Google Cloud Vertex AI
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/KFPv2_hell/components/google-cloud/Vertex_AI/Models/Upload_Scikit-learn_pickle_model/workaround_for_buggy_KFPv2_compiler/component.yaml'}
inputs:
- {name: model, type: ScikitLearnPickleModel}
- {name: sklearn_version, type: String, optional: true}
- {name: display_name, type: String, optional: true}
- {name: description, type: String, optional: true}
- {name: project, type: String, optional: true}
- {name: location, type: String, optional: true}
- {name: labels, type: JsonObject, optional: true}
- {name: staging_bucket, type: String, optional: true}
outputs:
- {name: model_name, type: String}
- {name: model_dict, type: JsonObject}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-aiplatform==1.16.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'google-cloud-aiplatform==1.16.0'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI(
model_path,
sklearn_version = None,
display_name = None,
description = None,
# Uncomment when anyone requests these:
# instance_schema_uri: str = None,
# parameters_schema_uri: str = None,
# prediction_schema_uri: str = None,
# explanation_metadata: "google.cloud.aiplatform_v1.types.explanation_metadata.ExplanationMetadata" = None,
# explanation_parameters: "google.cloud.aiplatform_v1.types.explanation.ExplanationParameters" = None,
project = None,
location = None,
labels = None,
# encryption_spec_key_name: str = None,
staging_bucket = None,
):
import json
import os
import shutil
import tempfile
from google.cloud import aiplatform
if not location:
location = os.environ.get("CLOUD_ML_REGION")
if not labels:
labels = {}
labels["component-source"] = "github-com-ark-kun-pipeline-components"
# The serving container decides the model type based on the model file extension.
# So we need to rename the mode file (e.g. /tmp/inputs/model/data) to *.pkl
_, renamed_model_path = tempfile.mkstemp(suffix=".pkl")
shutil.copyfile(src=model_path, dst=renamed_model_path)
model = aiplatform.Model.upload_scikit_learn_model_file(
model_file_path=renamed_model_path,
sklearn_version=sklearn_version,
display_name=display_name,
description=description,
# instance_schema_uri=instance_schema_uri,
# parameters_schema_uri=parameters_schema_uri,
# prediction_schema_uri=prediction_schema_uri,
# explanation_metadata=explanation_metadata,
# explanation_parameters=explanation_parameters,
project=project,
location=location,
labels=labels,
# encryption_spec_key_name=encryption_spec_key_name,
staging_bucket=staging_bucket,
)
model_json = json.dumps(model.to_dict(), indent=2)
print(model_json)
return (model.resource_name, model_json)
def _serialize_json(obj) -> str:
if isinstance(obj, str):
return obj
import json
def default_serializer(obj):
if hasattr(obj, 'to_struct'):
return obj.to_struct()
else:
raise TypeError("Object of type '%s' is not JSON serializable and does not have .to_struct() method." % obj.__class__.__name__)
return json.dumps(obj, default=default_serializer, sort_keys=True)
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import json
import argparse
_parser = argparse.ArgumentParser(prog='Upload Scikit learn pickle model to Google Cloud Vertex AI', description='')
_parser.add_argument("--model", dest="model_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--sklearn-version", dest="sklearn_version", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--display-name", dest="display_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--description", dest="description", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--project", dest="project", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--location", dest="location", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--labels", dest="labels", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--staging-bucket", dest="staging_bucket", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=2)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = upload_Scikit_learn_pickle_model_to_Google_Cloud_Vertex_AI(**_parsed_args)
_output_serializers = [
_serialize_str,
_serialize_json,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --model
- {inputPath: model}
- if:
cond: {isPresent: sklearn_version}
then:
- --sklearn-version
- {inputValue: sklearn_version}
- if:
cond: {isPresent: display_name}
then:
- --display-name
- {inputValue: display_name}
- if:
cond: {isPresent: description}
then:
- --description
- {inputValue: description}
- if:
cond: {isPresent: project}
then:
- --project
- {inputValue: project}
- if:
cond: {isPresent: location}
then:
- --location
- {inputValue: location}
- if:
cond: {isPresent: labels}
then:
- --labels
- {inputValue: labels}
- if:
cond: {isPresent: staging_bucket}
then:
- --staging-bucket
- {inputValue: staging_bucket}
- '----output-paths'
- {outputPath: model_name}
- {outputPath: model_dict}
@@ -0,0 +1,190 @@
name: Upload Tensorflow model to Google Cloud Vertex AI
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/KFPv2_hell/components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/workaround_for_buggy_KFPv2_compiler/component.yaml'}
inputs:
- {name: model, type: TensorflowSavedModel}
- {name: tensorflow_version, type: String, optional: true}
- name: use_gpu
type: Boolean
default: "False"
optional: true
- {name: display_name, type: String, optional: true}
- {name: description, type: String, optional: true}
- {name: project, type: String, optional: true}
- {name: location, type: String, optional: true}
- {name: labels, type: JsonObject, optional: true}
- {name: staging_bucket, type: String, optional: true}
outputs:
- {name: model_name, type: String}
- {name: model_dict, type: JsonObject}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-aiplatform==1.16.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'google-cloud-aiplatform==1.16.0'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def upload_Tensorflow_model_to_Google_Cloud_Vertex_AI(
model_path,
tensorflow_version = None,
use_gpu = False,
display_name = None,
description = None,
# Uncomment when anyone requests these:
# instance_schema_uri: str = None,
# parameters_schema_uri: str = None,
# prediction_schema_uri: str = None,
# explanation_metadata: "google.cloud.aiplatform_v1.types.explanation_metadata.ExplanationMetadata" = None,
# explanation_parameters: "google.cloud.aiplatform_v1.types.explanation.ExplanationParameters" = None,
project = None,
location = None,
labels = None,
# encryption_spec_key_name: str = None,
staging_bucket = None,
):
import json
import os
from google.cloud import aiplatform
if not location:
location = os.environ.get("CLOUD_ML_REGION")
if not labels:
labels = {}
labels["component-source"] = "github-com-ark-kun-pipeline-components"
model = aiplatform.Model.upload_tensorflow_saved_model(
saved_model_dir=model_path,
tensorflow_version=tensorflow_version,
use_gpu=use_gpu,
display_name=display_name,
description=description,
# instance_schema_uri=instance_schema_uri,
# parameters_schema_uri=parameters_schema_uri,
# prediction_schema_uri=prediction_schema_uri,
# explanation_metadata=explanation_metadata,
# explanation_parameters=explanation_parameters,
project=project,
location=location,
labels=labels,
# encryption_spec_key_name=encryption_spec_key_name,
staging_bucket=staging_bucket,
)
model_json = json.dumps(model.to_dict(), indent=2)
print(model_json)
return (model.resource_name, model_json)
def _deserialize_bool(s) -> bool:
from distutils.util import strtobool
return strtobool(s) == 1
def _serialize_json(obj) -> str:
if isinstance(obj, str):
return obj
import json
def default_serializer(obj):
if hasattr(obj, 'to_struct'):
return obj.to_struct()
else:
raise TypeError("Object of type '%s' is not JSON serializable and does not have .to_struct() method." % obj.__class__.__name__)
return json.dumps(obj, default=default_serializer, sort_keys=True)
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import json
import argparse
_parser = argparse.ArgumentParser(prog='Upload Tensorflow model to Google Cloud Vertex AI', description='')
_parser.add_argument("--model", dest="model_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--tensorflow-version", dest="tensorflow_version", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--use-gpu", dest="use_gpu", type=_deserialize_bool, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--display-name", dest="display_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--description", dest="description", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--project", dest="project", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--location", dest="location", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--labels", dest="labels", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--staging-bucket", dest="staging_bucket", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=2)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = upload_Tensorflow_model_to_Google_Cloud_Vertex_AI(**_parsed_args)
_output_serializers = [
_serialize_str,
_serialize_json,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --model
- {inputPath: model}
- if:
cond: {isPresent: tensorflow_version}
then:
- --tensorflow-version
- {inputValue: tensorflow_version}
- if:
cond: {isPresent: use_gpu}
then:
- --use-gpu
- {inputValue: use_gpu}
- if:
cond: {isPresent: display_name}
then:
- --display-name
- {inputValue: display_name}
- if:
cond: {isPresent: description}
then:
- --description
- {inputValue: description}
- if:
cond: {isPresent: project}
then:
- --project
- {inputValue: project}
- if:
cond: {isPresent: location}
then:
- --location
- {inputValue: location}
- if:
cond: {isPresent: labels}
then:
- --labels
- {inputValue: labels}
- if:
cond: {isPresent: staging_bucket}
then:
- --staging-bucket
- {inputValue: staging_bucket}
- '----output-paths'
- {outputPath: model_name}
- {outputPath: model_dict}
@@ -0,0 +1,181 @@
name: Upload XGBoost model to Google Cloud Vertex AI
metadata:
annotations: {author: Alexey Volkov <alexey.volkov@ark-kun.com>, canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/google-cloud/Vertex_AI/Models/Upload_XGBoost_model/workaround_for_buggy_KFPv2_compiler/component.yaml'}
inputs:
- {name: model, type: XGBoostModel}
- {name: xgboost_version, type: String, optional: true}
- {name: display_name, type: String, optional: true}
- {name: description, type: String, optional: true}
- {name: project, type: String, optional: true}
- {name: location, type: String, optional: true}
- {name: labels, type: JsonObject, optional: true}
- {name: staging_bucket, type: String, optional: true}
outputs:
- {name: model_name, type: String}
- {name: model_dict, type: JsonObject}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-aiplatform==1.16.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'google-cloud-aiplatform==1.16.0'
--user) && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp)
printf "%s" "$0" > "$program_path"
python3 -u "$program_path" "$@"
- |
def upload_XGBoost_model_to_Google_Cloud_Vertex_AI(
model_path,
xgboost_version = None,
display_name = None,
description = None,
# Uncomment when anyone requests these:
# instance_schema_uri: str = None,
# parameters_schema_uri: str = None,
# prediction_schema_uri: str = None,
# explanation_metadata: "google.cloud.aiplatform_v1.types.explanation_metadata.ExplanationMetadata" = None,
# explanation_parameters: "google.cloud.aiplatform_v1.types.explanation.ExplanationParameters" = None,
project = None,
location = None,
labels = None,
# encryption_spec_key_name: str = None,
staging_bucket = None,
):
import json
import os
import shutil
import tempfile
from google.cloud import aiplatform
if not location:
location = os.environ.get("CLOUD_ML_REGION")
if not labels:
labels = {}
labels["component-source"] = "github-com-ark-kun-pipeline-components"
# The serving container decides the model type based on the model file extension.
# So we need to rename the mode file (e.g. /tmp/inputs/model/data) to *.pkl
_, renamed_model_path = tempfile.mkstemp(suffix=".pkl")
shutil.copyfile(src=model_path, dst=renamed_model_path)
model = aiplatform.Model.upload_xgboost_model_file(
model_file_path=renamed_model_path,
xgboost_version=xgboost_version,
display_name=display_name,
description=description,
# instance_schema_uri=instance_schema_uri,
# parameters_schema_uri=parameters_schema_uri,
# prediction_schema_uri=prediction_schema_uri,
# explanation_metadata=explanation_metadata,
# explanation_parameters=explanation_parameters,
project=project,
location=location,
labels=labels,
# encryption_spec_key_name=encryption_spec_key_name,
staging_bucket=staging_bucket,
)
model_json = json.dumps(model.to_dict(), indent=2)
print(model_json)
return (model.resource_name, model_json)
def _serialize_json(obj) -> str:
if isinstance(obj, str):
return obj
import json
def default_serializer(obj):
if hasattr(obj, 'to_struct'):
return obj.to_struct()
else:
raise TypeError("Object of type '%s' is not JSON serializable and does not have .to_struct() method." % obj.__class__.__name__)
return json.dumps(obj, default=default_serializer, sort_keys=True)
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
return str_value
import json
import argparse
_parser = argparse.ArgumentParser(prog='Upload XGBoost model to Google Cloud Vertex AI', description='')
_parser.add_argument("--model", dest="model_path", type=str, required=True, default=argparse.SUPPRESS)
_parser.add_argument("--xgboost-version", dest="xgboost_version", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--display-name", dest="display_name", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--description", dest="description", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--project", dest="project", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--location", dest="location", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--labels", dest="labels", type=json.loads, required=False, default=argparse.SUPPRESS)
_parser.add_argument("--staging-bucket", dest="staging_bucket", type=str, required=False, default=argparse.SUPPRESS)
_parser.add_argument("----output-paths", dest="_output_paths", type=str, nargs=2)
_parsed_args = vars(_parser.parse_args())
_output_files = _parsed_args.pop("_output_paths", [])
_outputs = upload_XGBoost_model_to_Google_Cloud_Vertex_AI(**_parsed_args)
_output_serializers = [
_serialize_str,
_serialize_json,
]
import os
for idx, output_file in enumerate(_output_files):
try:
os.makedirs(os.path.dirname(output_file))
except OSError:
pass
with open(output_file, 'w') as f:
f.write(_output_serializers[idx](_outputs[idx]))
args:
- --model
- {inputPath: model}
- if:
cond: {isPresent: xgboost_version}
then:
- --xgboost-version
- {inputValue: xgboost_version}
- if:
cond: {isPresent: display_name}
then:
- --display-name
- {inputValue: display_name}
- if:
cond: {isPresent: description}
then:
- --description
- {inputValue: description}
- if:
cond: {isPresent: project}
then:
- --project
- {inputValue: project}
- if:
cond: {isPresent: location}
then:
- --location
- {inputValue: location}
- if:
cond: {isPresent: labels}
then:
- --labels
- {inputValue: labels}
- if:
cond: {isPresent: staging_bucket}
then:
- --staging-bucket
- {inputValue: staging_bucket}
- '----output-paths'
- {outputPath: model_name}
- {outputPath: model_dict}
@@ -0,0 +1,35 @@
name: Download from GCS
inputs:
- {name: GCS path, type: String}
outputs:
- {name: Data}
metadata:
annotations:
author: Alexey Volkov <alexey.volkov@ark-kun.com>
canonical_location: 'https://raw.githubusercontent.com/Ark-kun/pipeline_components/master/components/google-cloud/storage/download/workaround_for_buggy_KFPv2_compiler/component.yaml'
implementation:
container:
image: google/cloud-sdk
command:
- bash # Pattern comparison only works in Bash
- -ex
- -c
- |
if [ -n "${GOOGLE_APPLICATION_CREDENTIALS}" ]; then
gcloud auth activate-service-account --key-file="${GOOGLE_APPLICATION_CREDENTIALS}"
fi
uri="$0"
output_path="$1"
# Checking whether the URI points to a single blob, a directory or a URI pattern
# URI points to a blob when that URI does not end with slash and listing that URI only yields the same URI
if [[ "$uri" != */ ]] && (gsutil ls "$uri" | grep --fixed-strings --line-regexp "$uri"); then
mkdir -p "$(dirname "$output_path")"
gsutil -m cp -r "$uri" "$output_path"
else
mkdir -p "$output_path" # When source path is a directory, gsutil requires the destination to also be a directory
gsutil -m rsync -r "$uri" "$output_path" # gsutil cp has different path handling than Linux cp. It always puts the source directory (name) inside the destination directory. gsutil rsync does not have that problem.
fi
- inputValue: GCS path
- outputPath: Data
@@ -0,0 +1,112 @@
name: Load image classification model from tfhub
description: |
Loads specified model from TFHub, creates layer to receive additional (3 channel) imagery data.
Args:
class_names (Sequence[str]):
Sequence of strings of categories for classification corresponding to input data.
loaded_model_path (str):
Output path for the loaded model.
image_size_path (str):
Output path for the model expected image size.
model_name (Optional[str]):
Name of the pre-trained image classification model to load from TFHub.
Eligible model_name:
- efficientnetv2-s
- efficientnetv2-m
- efficientnetv2-l
- efficientnetv2-s-21k
- efficientnetv2-m-21k
- efficientnetv2-l-21k
- efficientnetv2-xl-21k
- efficientnetv2-b0-21k
- efficientnetv2-b1-21k
- efficientnetv2-b2-21k
- efficientnetv2-b3-21k
- efficientnetv2-s-21k-ft1k
- efficientnetv2-m-21k-ft1k
- efficientnetv2-l-21k-ft1k
- efficientnetv2-xl-21k-ft1k
- efficientnetv2-b0-21k-ft1k
- efficientnetv2-b1-21k-ft1k
- efficientnetv2-b2-21k-ft1k
- efficientnetv2-b3-21k-ft1k
- efficientnetv2-b0
- efficientnetv2-b1
- efficientnetv2-b2
- efficientnetv2-b3
- efficientnet_b0
- efficientnet_b1
- efficientnet_b2
- efficientnet_b3
- efficientnet_b4
- efficientnet_b5
- efficientnet_b6
- efficientnet_b7
- bit_s-r50x1
- inception_v3
- inception_resnet_v2
- resnet_v1_50
- resnet_v1_101
- resnet_v1_152
- resnet_v2_50
- resnet_v2_101
- resnet_v2_152
- nasnet_large
- nasnet_mobile
- pnasnet_large
- mobilenet_v2_100_224
- mobilenet_v2_130_224
- mobilenet_v2_140_224
- mobilenet_v3_small_100_224
- mobilenet_v3_small_075_224
- mobilenet_v3_large_100_224
- mobilenet_v3_large_075_224
dropout_rate (Optional[float]):
Fraction of input units to drop in the last layer. Value should be between 0.0 and 1.0.
trainable (Optional[bool]):
If true fine tuning will be performed on entire Hub model. If false only additional
layers will be trained.
l2_regularization_penalty (Optional[float]):
l2 regularization penalty.
inputs:
- {name: class_names, type: 'typing.List[str]', description: List of class names corresponding
to the input image data}
- {name: model_name, type: String, description: Name of the TFHub model to load, default: efficientnetv2-xl-21k,
optional: true}
- {name: dropout_rate, type: Float, description: Dropout rate, default: '0.2', optional: true}
- name: trainable
type: Boolean
description: True if fine tuning should be performed
default: "True"
optional: true
- {name: l2_regularization_penalty, type: Float, description: Regularization penalty,
default: '0.0001', optional: true}
outputs:
- {name: loaded_model_path, type: TensorflowSavedModel, description: Output path for
the loaded model}
- {name: image_size_path, type: HeightWidth}
implementation:
container:
image: us-docker.pkg.dev/vertex-ai/ready-to-go-image-classification/image-components:v0.1
# command is a list of strings (command-line arguments).
# The YAML language has two syntaxes for lists and you can use either of them.
# Here we use the "flow syntax" - comma-separated strings inside square brackets.
command: [
python3,
# Path of the program inside the container
/pipelines/component/src/loading_component.py,
--loaded-model-path,
{outputPath: loaded_model_path},
--class-names,
{inputValue: class_names},
--model-name,
{inputValue: model_name},
--dropout-rate,
{inputValue: dropout_rate},
--trainable,
{inputValue: trainable},
--l2-regularization-penalty,
{inputValue: l2_regularization_penalty},
--image-size-path,
{outputPath: image_size_path},
]
@@ -0,0 +1,62 @@
# python3 -m pip install "kfp<2.0.0" "google-cloud-aiplatform>=1.16.0" --upgrade --quiet
from kfp import components
from kfp.v2 import dsl
# %% Loading components
upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op = components.load_component_from_url('https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Upload_Tensorflow_model/component.yaml')
deploy_model_to_endpoint_op = components.load_component_from_url('https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/399405402d95f4a011e2d2e967c96f8508ba5688/community-content/pipeline_components/google-cloud/Vertex_AI/Models/Deploy_to_endpoint/component.yaml')
transcode_imagedataset_tfrecord_from_csv_op = components.load_component_from_url('https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/pipeline_components/image_ml_model_training/transcode_tfrecord_image_dataset_from_csv/component.yaml')
load_image_classification_model_from_tfhub_op = components.load_component_from_url('https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/b5b65198a6c2ffe8c0fa2aa70127e3325752df68/community-content/pipeline_components/image_ml_model_training/load_image_classification_model/component.yaml')
preprocess_image_data_op = components.load_component_from_url('https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/pipeline_components/image_ml_model_training/preprocess_image_data/component.yaml')
train_tensorflow_image_classification_model_op = components.load_component_from_url('https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/pipeline_components/image_ml_model_training/train_image_classification_model/component.yaml')
# %% Pipeline definition
def image_classification_pipeline():
class_names = ['daisy', 'dandelion', 'roses', 'sunflowers', 'tulips']
csv_image_data_path = 'gs://cloud-samples-data/ai-platform/flowers/flowers.csv'
deploy_model = False
image_data = dsl.importer(
artifact_uri=csv_image_data_path, artifact_class=dsl.Dataset).output
image_tfrecord_data = transcode_imagedataset_tfrecord_from_csv_op(
csv_image_data_path=image_data,
class_names=class_names
).outputs['tfrecord_image_data_path']
loaded_model_outputs = load_image_classification_model_from_tfhub_op(
class_names=class_names,
).outputs
preprocessed_data = preprocess_image_data_op(
image_tfrecord_data,
height_width_path=loaded_model_outputs['image_size_path'],
).outputs
trained_model = (train_tensorflow_image_classification_model_op(
preprocessed_training_data_path = preprocessed_data['preprocessed_training_data_path'],
preprocessed_validation_data_path = preprocessed_data['preprocessed_validation_data_path'],
model_path=loaded_model_outputs['loaded_model_path']).
set_cpu_limit('96').
set_memory_limit('128G').
add_node_selector_constraint('cloud.google.com/gke-accelerator', 'NVIDIA_TESLA_A100').
set_gpu_limit('8').
outputs['trained_model_path'])
vertex_model_name = upload_Tensorflow_model_to_Google_Cloud_Vertex_AI_op(
model=trained_model,
).outputs['model_name']
# Deploying the model might incur additional costs over time
if deploy_model:
vertex_endpoint_name = deploy_model_to_endpoint_op(
model_name=vertex_model_name,
).outputs['endpoint_name']
pipeline_func = image_classification_pipeline
# %% Pipeline submission
if __name__ == '__main__':
from google.cloud import aiplatform
aiplatform.PipelineJob.from_pipeline_func(pipeline_func=pipeline_func).submit()
@@ -0,0 +1,57 @@
name: Preprocess image data
description: |
Preprocess the image data and split between train and validation.
Args:
input_data_path (str):
Input path for the TFRecord image data. Data will be formatted as 'label' (encoded image
label), and 'image_raw' (the binary string of the image data).
height_width_path (str):
Path to square height and width to resize images to. File should contain single float value.
Value is dependent on training model.
preprocessed_training_data_path (str):
Output path for the TFRecord training data. Data will be formatted as 'label' (encoded image
label), and 'image_raw' (the binary string of the image data).
preprocessed_validation_data_path (str):
Output path for the TFRecord validation data. Data will be formatted as 'label' (encoded
image label), and 'image_raw' (the binary string of the image data).
validation_split (Optional[float]):
Fraction of data that will make up validation dataset. Value should be between 0.0 and 1.0.
seed (Optional[int]):
The global random seed to ensure the system gets a unique random sequence
that is deterministic (https://www.tensorflow.org/api_docs/python/tf/random/set_seed).
inputs:
- {name: input_data_path, type: ImageDatasetTFRecord, description: 'Input path for
the TFRecord image data,'}
- {name: height_width_path, type: HeightWidth, description: 'Path to square height and width to
resize images to,'}
- {name: validation_split, type: Float, description: 'Fraction of data that will make
up validation dataset,', default: '0.2', optional: true}
- {name: seed, type: Integer, description: Random seed, default: '0', optional: true}
outputs:
- {name: preprocessed_training_data_path, type: ImageDatasetTFRecord, description: 'Output
path for the training data,'}
- {name: preprocessed_validation_data_path, type: ImageDatasetTFRecord, description: 'Output
path for the validation data,'}
implementation:
container:
image: us-docker.pkg.dev/vertex-ai/ready-to-go-image-classification/image-components:v0.1
# command is a list of strings (command-line arguments).
# The YAML language has two syntaxes for lists and you can use either of them.
# Here we use the "flow syntax" - comma-separated strings inside square brackets.
command: [
python3,
# Path of the program inside the container
/pipelines/component/src/preprocessing_component.py,
--input-data-path,
{inputPath: input_data_path},
--height-width-path,
{inputPath: height_width_path},
--validation-split,
{inputValue: validation_split},
--seed,
{inputValue: seed},
--preprocessed-training-data-path,
{outputPath: preprocessed_training_data_path},
--preprocessed-validation-data-path,
{outputPath: preprocessed_validation_data_path},
]
@@ -0,0 +1,90 @@
name: Train tensorflow image classification model
description: |
Creates a trained image classification TensorFlow model.
Args:
preprocessed_training_data_path (str):
Input path to the TFRecord training data. Data will be formatted as 'label' (encoded image
label), and 'image_raw' (the binary string of the image data).
preprocessed_validation_data_path (str):
Input path to the TFRecord validation data. Data will be formatted as 'label' (encoded
image label), and 'image_raw' (the binary string of the image data).
model_path (str):
Input path to the loaded pre-trained model.
trained_model_path (str):
Output path to save the trained model to.
optimizer_name (Optional[str]):
Name of the tf.keras optimizer. Available optimizers are listed at
https://keras.io/api/optimizers/
optimizer_parameters (Optional[Dict[str, str]]):
Optimizer parameters.
loss_function_name (Optional[str]):
Name of the loss function.
loss_function_parameters (Optional[Dict[str, str]]):
Loss function parameters.
number_of_epochs (Optional[int]):
Number of training iterations over data.
metric_names (Optional[Sequence[str]]):
List of tf.keras.metrics to be evaluated by the model during training and testing. Available
metrics are listed at https://keras.io/api/metrics/.
seed Optional(int):
The global random seed to ensure the system gets a unique random sequence
that is deterministic (https://www.tensorflow.org/api_docs/python/tf/random/set_seed).
inputs:
- {name: preprocessed_training_data_path, type: ImageDatasetTFRecord, description: 'Input
path for the training data,'}
- {name: preprocessed_validation_data_path, type: ImageDatasetTFRecord, description: 'Input
path for the validation data,'}
- {name: model_path, type: TensorflowSavedModel, description: 'Input path for the
model,'}
- {name: optimizer_name, type: String, description: 'Name of the optimizer,', default: SGD,
optional: true}
- {name: optimizer_parameters, type: 'typing.Dict[str, str]', description: 'Optimizer
parameters,', default: '{}', optional: true}
- {name: loss_function_name, type: String, description: 'Name of the loss function,',
default: CategoricalCrossentropy, optional: true}
- {name: loss_function_parameters, type: 'typing.Dict[str, str]', description: 'Loss
function parameters,', default: '{}', optional: true}
- {name: number_of_epochs, type: Integer, description: 'Number of epochs,', default: '10',
optional: true}
- {name: metric_names, type: 'typing.List[str]', description: 'List of metrics to
use,', default: '["accuracy"]', optional: true}
- {name: seed, type: Integer, description: 'Random seed,', default: '0', optional: true}
- {name: batch_size, type: Integer, description: Batch size, default: '16', optional: true}
outputs:
- {name: trained_model_path, type: TensorflowSavedModel, description: 'Output path
for the saved model,'}
implementation:
container:
image: us-docker.pkg.dev/vertex-ai/ready-to-go-image-classification/image-components:v0.1
# command is a list of strings (command-line arguments).
# The YAML language has two syntaxes for lists and you can use either of them.
# Here we use the "flow syntax" - comma-separated strings inside square brackets.
command: [
python3,
# Path of the program inside the container
/pipelines/component/src/training_component.py,
--preprocessed-training-data-path,
{inputPath: preprocessed_training_data_path},
--preprocessed-validation-data-path,
{inputPath: preprocessed_validation_data_path},
--model-path,
{inputPath: model_path},
--trained-model-path,
{outputPath: trained_model_path},
--optimizer-name,
{inputValue: optimizer_name},
--loss-function-name,
{inputValue: loss_function_name},
--number-of-epochs,
{inputValue: number_of_epochs},
--seed,
{inputValue: seed},
--batch-size,
{inputValue: batch_size},
--metric-names,
{inputValue: metric_names},
--optimizer-parameters,
{inputValue: optimizer_parameters},
--loss-function-parameters,
{inputValue: loss_function_parameters},
]
@@ -0,0 +1,37 @@
name: Transcode imagedataset tfrecord from csv
description: |
Transcodes CSV Data into TFRecord file of TFExamples.
Args:
csv_image_data_path (str):
Path to the CSV image data. Data must include 'image_filepath' (Path to image file) and
'image_label' (output for a prediction) fields.
class_names (Sequence[str]):
Sequence of strings of categories for classification corresponding to input data.
tfrecord_image_data_path (str):
Output path for the TFRecord image data. Data will be formatted as 'label' (encoded image
label), and 'image_raw' (the binary string of the image data).
inputs:
- {name: csv_image_data_path, type: ImageDatasetCSV, description: Input path for the
CSV image data}
- {name: class_names, type: 'typing.List[str]', description: List of class names corresponding
to the input image data}
outputs:
- {name: tfrecord_image_data_path, type: ImageDatasetTFRecord, description: Output
path for the TFRecord image data}
implementation:
container:
image: us-docker.pkg.dev/vertex-ai/ready-to-go-image-classification/image-components:v0.1
# command is a list of strings (command-line arguments).
# The YAML language has two syntaxes for lists and you can use either of them.
# Here we use the "flow syntax" - comma-separated strings inside square brackets.
command: [
python3,
# Path of the program inside the container
/pipelines/component/src/transcoding_csv_component.py,
--csv-image-data-path,
{inputPath: csv_image_data_path},
--tfrecord-image-data-path,
{outputPath: tfrecord_image_data_path},
--class-names,
{inputValue: class_names},
]
@@ -0,0 +1,39 @@
name: Transcode imagedataset tfrecord from jsonlines
description: |
Transcodes JSONL Data into TFRecord file of TFExamples.
Args:
jsonl_image_data_path (str):
Input path for the JSONL image data
Path to the JSONL image data. Each line corresponds to a JSON input describing an image.
Schema follows AutoML image classification JSONL format
https://cloud.google.com/vertex-ai/docs/image-data/classification/prepare-data#json-lines.
class_names (Sequence[str]):
Sequence of strings of categories for classification corresponding to input data.
tfrecord_image_data_path (str):
Output path for the TFRecord image data. Data will be formatted as 'label' (encoded image
label), and 'image_raw' (the binary string of the image data).
inputs:
- {name: jsonl_image_data_path, type: ImageDatasetJsonLines, description: Input path
for the JSONL image data}
- {name: class_names, type: 'typing.List[str]', description: List of class names corresponding
to the input image data}
outputs:
- {name: tfrecord_image_data_path, type: ImageDatasetTFRecord, description: Output
path for the TFRecord image data}
implementation:
container:
image: us-docker.pkg.dev/vertex-ai/ready-to-go-image-classification/image-components:v0.1
# command is a list of strings (command-line arguments).
# The YAML language has two syntaxes for lists and you can use either of them.
# Here we use the "flow syntax" - comma-separated strings inside square brackets.
command: [
python3,
# Path of the program inside the container
/pipelines/component/src/transcoding_jsonl_component.py,
--jsonl-image-data-path,
{inputPath: jsonl_image_data_path},
--tfrecord-image-data-path,
{outputPath: tfrecord_image_data_path},
--class-names,
{inputValue: class_names},
]

Some files were not shown because too many files have changed in this diff Show More