Compare commits
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
26afe67e9c | ||
|
|
6cac60f74a | ||
|
|
c6ddaa183b | ||
|
|
066c13369e | ||
|
|
7aae7a9d20 | ||
|
|
55e37f795c | ||
|
|
0998b895f6 | ||
|
|
28011f3894 | ||
|
|
81822159bf | ||
|
|
8d59de715e | ||
|
|
c030d7ef74 | ||
|
|
96be449c69 | ||
|
|
e40ddab4d5 | ||
|
|
d02bc2d56b | ||
|
|
76b641b23d | ||
|
|
bbf4345e76 | ||
|
|
058358a795 | ||
|
|
1c2f75f680 | ||
|
|
999866fad1 | ||
|
|
89f4571a2c | ||
|
|
eaff81fd97 | ||
|
|
976ed94cf2 | ||
|
|
8ab8ef9ca9 | ||
|
|
eaff80a920 | ||
|
|
8646285c26 | ||
|
|
7cad8680e1 | ||
|
|
4f66324883 | ||
|
|
468fd144d2 | ||
|
|
2503c3411c | ||
|
|
94b27550e8 | ||
|
|
3542e0b0a3 | ||
|
|
5cf3b64618 | ||
|
|
885bfd56e5 | ||
|
|
3a5eec64af | ||
|
|
8cdc7f1f79 | ||
|
|
84fd10f408 | ||
|
|
7804c860c5 | ||
|
|
ed0c1c74a6 | ||
|
|
5127a59e92 | ||
|
|
d8df732d6b | ||
|
|
9c10899db8 | ||
|
|
80770188ec | ||
|
|
fa91e45018 | ||
|
|
fa27309134 | ||
|
|
7b85f76384 | ||
|
|
40a0477b08 | ||
|
|
839c7dddb8 | ||
|
|
578cfb7da7 | ||
|
|
b129c0bf43 | ||
|
|
07b4c37135 | ||
|
|
f48fb1c650 | ||
|
|
3bbd59311c | ||
|
|
15bb4cea73 | ||
|
|
1511cc9fd1 | ||
|
|
2885a7a70f | ||
|
|
ea36f5c43e | ||
|
|
a905a6305f | ||
|
|
aeaeddcc75 | ||
|
|
161965cfb0 | ||
|
|
b9d4457474 | ||
|
|
a5b6bcfab1 | ||
|
|
5d55f5b0d2 | ||
|
|
36ace6f4a6 | ||
|
|
32d9b416c1 | ||
|
|
1c6309f401 | ||
|
|
728dec8526 | ||
|
|
7692f902dd | ||
|
|
9281403198 | ||
|
|
2be602fbef | ||
|
|
b140077eb1 | ||
|
|
d3139f7df8 | ||
|
|
72baced988 | ||
|
|
5232654705 | ||
|
|
125fe32eb2 | ||
|
|
614f4154dc | ||
|
|
970415398b | ||
|
|
a052a3d361 | ||
|
|
f8203b9f46 | ||
|
|
fac8c4c9b1 | ||
|
|
d6c13c201e | ||
|
|
8db9ce0415 | ||
|
|
8c7fb38136 | ||
|
|
acec861ad5 | ||
|
|
b5cc2b425e | ||
|
|
710e6ea0d8 | ||
|
|
4dce246b57 | ||
|
|
696efb00ee | ||
|
|
fea73bb9c0 | ||
|
|
f50ea24dd1 | ||
|
|
473e673d0a | ||
|
|
127297ee4e | ||
|
|
fb528b60c6 | ||
|
|
1c1a2b2097 | ||
|
|
8cb2a26817 | ||
|
|
3bf098b361 | ||
|
|
433cffbf76 | ||
|
|
0ec2f4fbe8 | ||
|
|
a9af97f1b9 | ||
|
|
d6431fab4c | ||
|
|
dcfde86928 | ||
|
|
5d747ffa0d | ||
|
|
53f25201cc | ||
|
|
9b17db3025 | ||
|
|
423f7ac584 | ||
|
|
aec82c7e5b | ||
|
|
b227509fbb | ||
|
|
e715e68273 | ||
|
|
406de6fe9a | ||
|
|
eacc49d911 | ||
|
|
b95959e7a1 | ||
|
|
cc2cf876de | ||
|
|
1047237335 | ||
|
|
791d589d41 | ||
|
|
f7bdf75d90 | ||
|
|
785ca9f864 | ||
|
|
aaa7d5c259 | ||
|
|
e21cb948d6 | ||
|
|
5551c5f895 | ||
|
|
e8853475bc | ||
|
|
33cb8139da | ||
|
|
0288fa3703 | ||
|
|
d48edc2cb4 | ||
|
|
7b26f01671 | ||
|
|
59cd2cda3c | ||
|
|
3ac469f57c | ||
|
|
008833422c | ||
|
|
59c85c3085 | ||
|
|
f2b5d0924e | ||
|
|
772cd44cef | ||
|
|
379a4c6a1c | ||
|
|
5cea72848e | ||
|
|
9c12dd811b | ||
|
|
844cf5b047 | ||
|
|
1492051560 | ||
|
|
40bdd5fce3 | ||
|
|
d1cc60e8d7 | ||
|
|
7ca4cf9912 | ||
|
|
294e40cb61 | ||
|
|
f69e43d3d6 | ||
|
|
582c479dbe | ||
|
|
f83660cf62 | ||
|
|
e948fae793 | ||
|
|
cd51333ff1 | ||
|
|
cf5d266bd7 | ||
|
|
8ef840affb | ||
|
|
4dcc3d0183 | ||
|
|
0bcb6a8d8e | ||
|
|
d26b385ec7 | ||
|
|
d5a2766aa4 | ||
|
|
7abfbb5473 | ||
|
|
096423da33 | ||
|
|
89a133549c | ||
|
|
648f1c34e0 | ||
|
|
3f21907c31 | ||
|
|
fce66b3e57 | ||
|
|
3b140f9caa | ||
|
|
89325d7e52 | ||
|
|
e4d44f02d6 | ||
|
|
78993c4729 | ||
|
|
c29e7d86bd | ||
|
|
a8793fb00a | ||
|
|
bb60a7d0db | ||
|
|
eef758c719 | ||
|
|
486ef17ab8 | ||
|
|
90dfef3db6 | ||
|
|
d59c87b387 | ||
|
|
9d69b77ac6 | ||
|
|
b0da5d69f8 | ||
|
|
830e10e583 | ||
|
|
db904b424e | ||
|
|
c371f05bfa | ||
|
|
5f7de16e2d | ||
|
|
3908580ad6 | ||
|
|
77d2cac20a | ||
|
|
a92d5ce473 | ||
|
|
416ec74af3 | ||
|
|
8443bbfe44 | ||
|
|
23a599068a | ||
|
|
c63bb4c464 | ||
|
|
2226e915c0 | ||
|
|
cd9f8b1d89 | ||
|
|
aae9ad0422 | ||
|
|
89d50579a6 | ||
|
|
2d6afa8313 | ||
|
|
00cfb20c36 | ||
|
|
14c87ae702 | ||
|
|
e2a6610c2d | ||
|
|
145cdd0928 | ||
|
|
04e1697bca | ||
|
|
be785d0389 | ||
|
|
976e346a3d | ||
|
|
e37caca496 | ||
|
|
7a48fe8850 | ||
|
|
915a1edba8 | ||
|
|
424f947b04 | ||
|
|
c95f73c1a8 | ||
|
|
9da033c887 | ||
|
|
f61f9bfdc2 | ||
|
|
b2a17dfc83 | ||
|
|
7072219d8b | ||
|
|
57db2f4014 | ||
|
|
4604b0a0a9 | ||
|
|
c8c26a12ba | ||
|
|
3a8fa3e312 | ||
|
|
bbfba5aaaf | ||
|
|
e30b2182b0 | ||
|
|
4c4dade55a | ||
|
|
5690d50430 | ||
|
|
10c33f934f | ||
|
|
0c43cbd563 | ||
|
|
b640a8f545 | ||
|
|
a575528b11 | ||
|
|
42a2c4d082 | ||
|
|
0bcf44e9fa | ||
|
|
9ac2774ece | ||
|
|
975c9fe6bc | ||
|
|
417410f382 | ||
|
|
8fdfbe4e31 | ||
|
|
80f977546c | ||
|
|
c5fe281e32 | ||
|
|
49a2ddaf08 | ||
|
|
e9cba94bb4 | ||
|
|
fc83cfcea5 | ||
|
|
e3aa9e8f35 | ||
|
|
37c52abc11 | ||
|
|
c8320c8764 | ||
|
|
b5d51e61b6 | ||
|
|
aa5464151d | ||
|
|
386cecf4c2 | ||
|
|
dffdb15c17 | ||
|
|
2f3691eb71 | ||
|
|
f456d86555 | ||
|
|
f534b4e7a5 | ||
|
|
de247cd78b | ||
|
|
22ad74eb8d | ||
|
|
baf69999fc | ||
|
|
d5057da9bb | ||
|
|
24904a5999 | ||
|
|
881a2b45c5 | ||
|
|
41fc83ad03 | ||
|
|
9928276dc3 | ||
|
|
6607f93f5e | ||
|
|
dcc0cfe06e | ||
|
|
00d5c5c4bf | ||
|
|
f8152dde19 | ||
|
|
0586e04c21 | ||
|
|
3de18a7fab | ||
|
|
dc0bf24cc5 | ||
|
|
8ce4c3070c | ||
|
|
13c3acb976 | ||
|
|
c1150ff584 | ||
|
|
4f11d70f7e | ||
|
|
2bf9a2b317 | ||
|
|
b1e0ad0c4f | ||
|
|
5624f92f02 | ||
|
|
1335032954 | ||
|
|
0b13c66e07 | ||
|
|
ef25b54926 | ||
|
|
064dbfeefa | ||
|
|
044c69e7a5 | ||
|
|
32a46e7471 | ||
|
|
b52d59822d | ||
|
|
529995ecde | ||
|
|
0726328c92 | ||
|
|
090e83c286 | ||
|
|
c3802626b9 | ||
|
|
9570c2477f | ||
|
|
2b1a898b2a | ||
|
|
f2a42aa66e | ||
|
|
30a03f1fd1 | ||
|
|
ca25448f59 | ||
|
|
8f922710b0 | ||
|
|
9509c6ab9d | ||
|
|
ccba176979 | ||
|
|
1b8f383897 | ||
|
|
e5cd9e86d2 | ||
|
|
a7e86a4f26 | ||
|
|
8f0c73b32c | ||
|
|
c7d7b48a91 | ||
|
|
583eb90f07 | ||
|
|
c3a9249c0c | ||
|
|
81b70e779c | ||
|
|
085713a818 | ||
|
|
5af7c851dc | ||
|
|
691312d467 | ||
|
|
650c256c13 | ||
|
|
9b00c4380b | ||
|
|
4851457e93 | ||
|
|
1c54878fab | ||
|
|
c139b84454 | ||
|
|
15c38b4ca6 | ||
|
|
271c949a71 | ||
|
|
09b5401434 | ||
|
|
dad76547f0 | ||
|
|
c14a110c81 | ||
|
|
d1e16546cc | ||
|
|
f91bc3d0c9 | ||
|
|
5168808b6c | ||
|
|
501cca7b5e | ||
|
|
f19d40d858 | ||
|
|
5a721ce01d | ||
|
|
66421fb4d8 | ||
|
|
3658ee8c88 | ||
|
|
afaab4bb02 | ||
|
|
c1e004bdff | ||
|
|
874e5a3ef5 | ||
|
|
51529f370c | ||
|
|
5ddf98866c | ||
|
|
fbb6830876 | ||
|
|
ee1bb281da | ||
|
|
da2f7e88fe | ||
|
|
3fb28e353f | ||
|
|
c8e7f44f0a | ||
|
|
3d9049aeeb | ||
|
|
7b8726af24 | ||
|
|
0443b05360 | ||
|
|
e422dbdef2 | ||
|
|
ec5fc0b1c8 | ||
|
|
c52e3f20ba | ||
|
|
e367dceceb | ||
|
|
19b8666808 | ||
|
|
a2df0e9fca | ||
|
|
73b094550e | ||
|
|
d05ae109e1 | ||
|
|
fdb25791d5 | ||
|
|
5a88492498 | ||
|
|
f19a12b829 | ||
|
|
3ed0ea73f4 | ||
|
|
b98fd24a72 | ||
|
|
eb4e9a0f91 | ||
|
|
ec7c136b0a | ||
|
|
ee7e43cc1a | ||
|
|
ea9f5f3c5c | ||
|
|
bd44798412 | ||
|
|
2af0cc0f80 | ||
|
|
5c0fa14d2d | ||
|
|
7cc50d3203 | ||
|
|
9c7da13177 | ||
|
|
45e0645f0b | ||
|
|
cb884cc74a | ||
|
|
d3a6475580 | ||
|
|
4e7061b2db | ||
|
|
0250879f65 | ||
|
|
5cee23ae68 | ||
|
|
d518558b3d | ||
|
|
5c085c843f | ||
|
|
936b434ac4 | ||
|
|
43059c9fd9 | ||
|
|
19f72d426d | ||
|
|
14ecaf3023 | ||
|
|
80c93a9b6d | ||
|
|
06a1b4dc57 | ||
|
|
4e779eedf1 | ||
|
|
afb341f5fd | ||
|
|
e34b0fa115 | ||
|
|
6fa0345f25 | ||
|
|
dd43ae6639 | ||
|
|
840385e0a7 | ||
|
|
9daaf51a1f | ||
|
|
9b2511e54e | ||
|
|
b6674e6540 | ||
|
|
a109cb6d44 | ||
|
|
f730d6b9de | ||
|
|
0947f2792d | ||
|
|
dbf19acde4 | ||
|
|
1aaa833153 | ||
|
|
c73d995680 | ||
|
|
3fe5028724 | ||
|
|
44dd24f910 | ||
|
|
c20a9c4e63 | ||
|
|
edffdf34b7 | ||
|
|
340c24c5b4 | ||
|
|
11f20f3f08 | ||
|
|
199b330aa5 | ||
|
|
5143db1024 | ||
|
|
2f0bd3de15 | ||
|
|
4d6c541967 | ||
|
|
5228a5c978 | ||
|
|
c6118bd17d | ||
|
|
d2c9e84af4 | ||
|
|
fe0a0ff055 | ||
|
|
40e287245d | ||
|
|
c79646a537 | ||
|
|
e293e1c2fb | ||
|
|
f2ab65bd03 | ||
|
|
aa686516d3 | ||
|
|
11c80a0251 | ||
|
|
c5e9e5812b | ||
|
|
98b126fa0b | ||
|
|
55553f9e69 | ||
|
|
563013c745 | ||
|
|
fefb9778a7 | ||
|
|
be1831082c | ||
|
|
9e15ee2e8a | ||
|
|
ceff7d7271 | ||
|
|
df9b5cd6f0 | ||
|
|
bc57801525 | ||
|
|
1b403373d3 | ||
|
|
987fb74ca6 | ||
|
|
65a209bc7b | ||
|
|
16e6d9e90f | ||
|
|
7ce6bee763 | ||
|
|
6d7ca3eb55 | ||
|
|
8e9f205e9a | ||
|
|
5fdb6c4368 | ||
|
|
71ebfd402c | ||
|
|
6e4ca83531 | ||
|
|
05793d6a3c | ||
|
|
3dc374b7db | ||
|
|
3ac8a4f617 | ||
|
|
21b4b5b063 | ||
|
|
9ffd921ca4 | ||
|
|
14e6ebbb95 | ||
|
|
277b685a39 | ||
|
|
67e7715ed9 | ||
|
|
bb87900209 | ||
|
|
96ebe7286b | ||
|
|
0b3a5dde09 | ||
|
|
17a30360b4 | ||
|
|
b386f51916 | ||
|
|
dd4f40c7f4 | ||
|
|
d402fc085a | ||
|
|
a12b9cd60f | ||
|
|
bf1032d550 | ||
|
|
dea05e1e36 | ||
|
|
a9f0117c82 | ||
|
|
83f1fe9ecd | ||
|
|
7344274037 | ||
|
|
e36bfa9a3b | ||
|
|
950aa245b8 | ||
|
|
ac47b2e370 | ||
|
|
6662fc809b | ||
|
|
12b3171d5e | ||
|
|
579d4751bd | ||
|
|
d4c607323d | ||
|
|
3ad30738a7 | ||
|
|
119273ae7e | ||
|
|
95bc39a685 | ||
|
|
b054104851 | ||
|
|
e0e0cf849a | ||
|
|
c95b3d7088 | ||
|
|
19c2bdb008 | ||
|
|
3c815f3888 | ||
|
|
cfcd9b29fd | ||
|
|
4fca7d98b2 | ||
|
|
dea950bcb6 | ||
|
|
4c43755fb6 | ||
|
|
374942a9e9 | ||
|
|
8add418428 | ||
|
|
9d73cc4574 | ||
|
|
5edb4bb1bf | ||
|
|
0e811868d3 | ||
|
|
9efcfa25e8 | ||
|
|
48036cf581 | ||
|
|
79fd9b4049 | ||
|
|
46b2181a4e | ||
|
|
d04f25a8bd | ||
|
|
9f341c350c | ||
|
|
f22f97f680 | ||
|
|
fe75745d44 | ||
|
|
bbc9f1337e | ||
|
|
eb1fa9213a | ||
|
|
a7033a6527 | ||
|
|
7e6c2d69c8 | ||
|
|
1a21b81804 | ||
|
|
2bbd520613 | ||
|
|
8285e4ebd1 | ||
|
|
859849894e | ||
|
|
e74dd48ae0 | ||
|
|
a14eb71210 | ||
|
|
0b6a9718ff | ||
|
|
6ac0d8a029 | ||
|
|
2ee013bcab | ||
|
|
1ebb3f5714 | ||
|
|
11c5134961 | ||
|
|
e328b7268f | ||
|
|
d297e99e5a | ||
|
|
48c7a4c82e | ||
|
|
eb3b52f863 | ||
|
|
4e58cca127 | ||
|
|
182a98768f | ||
|
|
f483447235 | ||
|
|
c59050608b | ||
|
|
3b9844f92c | ||
|
|
ee301a22f6 | ||
|
|
b7d16f66aa | ||
|
|
57aad5b802 | ||
|
|
9e311433ba | ||
|
|
04b310927a | ||
|
|
2fed3ad014 | ||
|
|
0ec94e0af6 | ||
|
|
9470be0900 | ||
|
|
479a0c6271 | ||
|
|
053f9c397f | ||
|
|
2c82469756 | ||
|
|
fdfc7009d0 | ||
|
|
59fcfe137d | ||
|
|
9b434b32bc | ||
|
|
fc27cd8628 | ||
|
|
a62f03c396 | ||
|
|
a270439814 | ||
|
|
a97af4a078 | ||
|
|
d7127cc22f | ||
|
|
802ab4edd8 | ||
|
|
ae7f28fb31 | ||
|
|
f63e3e6e4c | ||
|
|
b9bb497ebc | ||
|
|
4368b9e7f8 | ||
|
|
2e9cb5d2cf | ||
|
|
9ec8a93e05 | ||
|
|
3ed8778656 | ||
|
|
bf5e3cf870 | ||
|
|
c23215893d | ||
|
|
1c96f7ca71 | ||
|
|
0d5661835b | ||
|
|
fe1a3c0bc9 | ||
|
|
82bffb87f1 | ||
|
|
741c6732f1 | ||
|
|
9d8caf7888 | ||
|
|
e63d354413 | ||
|
|
831c515477 | ||
|
|
06ba5d6804 | ||
|
|
0137cd106e | ||
|
|
8b3b63d714 | ||
|
|
bf79916f29 | ||
|
|
6bf462f79d | ||
|
|
106cdee495 | ||
|
|
dfb7301733 | ||
|
|
da707b2cbc | ||
|
|
873ba9dde9 | ||
|
|
15c452f39d | ||
|
|
be7111815b | ||
|
|
17db1a952b | ||
|
|
455143d0f0 | ||
|
|
f0892852cb | ||
|
|
ca48556d0c | ||
|
|
f961aa3174 | ||
|
|
64c8eca7df | ||
|
|
b3332c1742 | ||
|
|
b35f697a75 | ||
|
|
3bc32a1d48 | ||
|
|
d66f851554 | ||
|
|
d733f107e1 | ||
|
|
805e2e1c83 | ||
|
|
03dc17d9d7 | ||
|
|
a4909f823e | ||
|
|
e91b259595 | ||
|
|
14284046e4 | ||
|
|
59a9a5e6ba | ||
|
|
f3b0a9e0c0 | ||
|
|
92b572a364 | ||
|
|
014be9b530 | ||
|
|
fa675e0082 | ||
|
|
113cbb9709 | ||
|
|
b72bdc8112 | ||
|
|
0842fa8354 | ||
|
|
4e4f3f4095 | ||
|
|
d014febeb9 | ||
|
|
a3264df643 | ||
|
|
f0208e3e37 | ||
|
|
f84e1b9cbc | ||
|
|
16b2086031 | ||
|
|
0e24ba565d | ||
|
|
49718b02a5 | ||
|
|
63031ed364 | ||
|
|
9fd325e25b | ||
|
|
93af43419c | ||
|
|
c8f0cdb74a | ||
|
|
19368fe5cc | ||
|
|
6a05e0eb6c | ||
|
|
40d643f11c | ||
|
|
72009cd21b | ||
|
|
cc9a50f40b | ||
|
|
e3135e8875 | ||
|
|
59eb297151 | ||
|
|
32b0c1c89e | ||
|
|
3328a8190d | ||
|
|
7aa6acdca6 | ||
|
|
7926ff1264 | ||
|
|
67b926dfb4 | ||
|
|
327f9e7a4b | ||
|
|
8be220d089 | ||
|
|
2dad40f49f | ||
|
|
99b724028f | ||
|
|
909fbcb0d4 | ||
|
|
351fc3e4d3 | ||
|
|
252b3d31a3 | ||
|
|
bfdfaab38c | ||
|
|
21a5963f84 | ||
|
|
9452249dce | ||
|
|
49a9df058f | ||
|
|
f99b7e5d17 | ||
|
|
ac03c57a94 | ||
|
|
2e4cf648c5 | ||
|
|
f000baa328 | ||
|
|
113f89604a | ||
|
|
5019a004ce | ||
|
|
a577f3844a | ||
|
|
88c7f0f690 | ||
|
|
a18792499a | ||
|
|
0b5fc8bb3c | ||
|
|
1f77410fda | ||
|
|
45fb57f29c | ||
|
|
3380b394eb | ||
|
|
1286cc5044 | ||
|
|
1ce1af791c | ||
|
|
2587e329ee | ||
|
|
37d4816051 | ||
|
|
d9dff882b8 | ||
|
|
26cc2c5278 | ||
|
|
69aff1bdc4 | ||
|
|
567994f2b1 | ||
|
|
e316c7b8aa | ||
|
|
c07a059a8b | ||
|
|
7b4bbffc41 | ||
|
|
bdc011ef34 | ||
|
|
44ea0d7c61 | ||
|
|
aa950e5ee4 | ||
|
|
247906e50e | ||
|
|
81b2493a44 | ||
|
|
97b0edb222 | ||
|
|
f0a9e4b9fe | ||
|
|
f35bbcaec5 | ||
|
|
2822061dc9 | ||
|
|
be481c8d17 | ||
|
|
605a972122 | ||
|
|
66d98d9fe7 | ||
|
|
6445ed37c9 | ||
|
|
ca745aeee8 | ||
|
|
f806b4927b | ||
|
|
2942eb5d7f | ||
|
|
2a5d6650ee | ||
|
|
43e971f57a | ||
|
|
785779613b | ||
|
|
481193f0ca | ||
|
|
2cb3cccd14 | ||
|
|
7c16766994 | ||
|
|
448d18deca | ||
|
|
97022b0733 | ||
|
|
c2a3e2d4cd | ||
|
|
b2dfcf17c8 | ||
|
|
d061f09281 | ||
|
|
daa64efd40 | ||
|
|
a37deabe27 | ||
|
|
6009ef0def | ||
|
|
edc644b0d0 | ||
|
|
1297af8baf | ||
|
|
b8b1b6675b | ||
|
|
7d3b7abc44 | ||
|
|
9a572f298e | ||
|
|
b53ca9e678 | ||
|
|
9aceec161a | ||
|
|
98b186ed55 | ||
|
|
f23ee1b5a8 | ||
|
|
c6d779f1fc | ||
|
|
8908b27b08 | ||
|
|
8947c9b116 | ||
|
|
9464caac6e | ||
|
|
98ce91c575 | ||
|
|
07f8feda3d | ||
|
|
a4e0496ff5 | ||
|
|
cf162c02c8 | ||
|
|
831aae94df | ||
|
|
3fd9f28778 | ||
|
|
a656e8e2a8 | ||
|
|
2f02152703 | ||
|
|
9d08f8ce67 | ||
|
|
ec6d508793 | ||
|
|
772e35ea75 | ||
|
|
1d28f886c8 | ||
|
|
d3dc8aeb9a | ||
|
|
a07d762934 | ||
|
|
85ac9e127d | ||
|
|
011c2823ff | ||
|
|
f28a94f03f | ||
|
|
5ecfc80cb9 | ||
|
|
e5e36ba050 | ||
|
|
0ad9116d6a | ||
|
|
0516032443 | ||
|
|
95d211c90f | ||
|
|
12d6a75ef7 | ||
|
|
06153dc373 | ||
|
|
02afa91fc3 | ||
|
|
c8b212789f | ||
|
|
95256d3fcf | ||
|
|
8a6d174c99 | ||
|
|
d36cf7f662 | ||
|
|
1b02a542c8 | ||
|
|
45430bb010 | ||
|
|
be2a139ade | ||
|
|
70d77b24f6 | ||
|
|
50c25d6d7b | ||
|
|
5bcdc0bc64 | ||
|
|
eff0f95b58 | ||
|
|
50b53d31bd | ||
|
|
b5a56852f3 | ||
|
|
b7486e34ad | ||
|
|
3edc5f1425 | ||
|
|
65b4b73cb5 | ||
|
|
186c08e8c3 | ||
|
|
7721aa0def | ||
|
|
4987c60e03 | ||
|
|
cd845f7fdd | ||
|
|
9e84d9e782 | ||
|
|
23c7fcc97f | ||
|
|
e4024efbc7 | ||
|
|
c4d53108af | ||
|
|
be8fe3564d | ||
|
|
1f95775057 | ||
|
|
f2a4dd875e | ||
|
|
67dd2300c8 | ||
|
|
b5391b06b4 | ||
|
|
54f2c71c13 | ||
|
|
6697900126 | ||
|
|
9ff3400b44 | ||
|
|
3ff0726ebf | ||
|
|
c96c939dfe | ||
|
|
719cf280c9 | ||
|
|
4ec6e2df04 | ||
|
|
031a9190c3 | ||
|
|
5204dcf327 | ||
|
|
cad623ef84 | ||
|
|
a59f58f8b6 | ||
|
|
d89c613f5d | ||
|
|
fa265ddb2f | ||
|
|
ec3dd04935 | ||
|
|
0c83e81410 | ||
|
|
7808a843cc | ||
|
|
615d7706af | ||
|
|
f05ca4d06a | ||
|
|
cb4145e2b6 | ||
|
|
6917c9aa7b | ||
|
|
c1d2451656 | ||
|
|
c41ec1fabd | ||
|
|
273c91882e | ||
|
|
ad6b5e5830 | ||
|
|
d441eb9d7a | ||
|
|
139d805c9f | ||
|
|
783347fc8e | ||
|
|
6d722d081d | ||
|
|
33a8c6ca0e | ||
|
|
ae043400f5 | ||
|
|
e41f96b31f | ||
|
|
7220f15158 | ||
|
|
b8d7eaa767 | ||
|
|
a612b463a8 | ||
|
|
493e7e81b5 | ||
|
|
b6cf0dbefd | ||
|
|
5d5c08f9e7 | ||
|
|
bfdfac0f81 | ||
|
|
9c72b7e3e7 | ||
|
|
46519e5c64 | ||
|
|
0ff961e203 | ||
|
|
cbc17c6832 | ||
|
|
93e5b15cba | ||
|
|
081e65d076 | ||
|
|
4ab2cfb713 | ||
|
|
a73335c0af | ||
|
|
0f3e257773 | ||
|
|
57d734d84f | ||
|
|
07f2e9c999 | ||
|
|
401883cae3 | ||
|
|
7bc92e1e3c | ||
|
|
de5f8b0653 | ||
|
|
cfa73ed53b | ||
|
|
67370bb1c7 | ||
|
|
f60593255a | ||
|
|
c6f9b97615 | ||
|
|
6161a394c2 | ||
|
|
b35cd42015 | ||
|
|
5e323993db | ||
|
|
f1623e419e | ||
|
|
a3047fb1bb | ||
|
|
b4d02f486e | ||
|
|
9e24893b9b | ||
|
|
47dec6ecef | ||
|
|
059fea672c | ||
|
|
389e804426 | ||
|
|
087a638c18 | ||
|
|
97757c74ca | ||
|
|
08f3ad583b | ||
|
|
16f01d31d3 | ||
|
|
e0f6c66351 | ||
|
|
3733b28772 | ||
|
|
24f8912134 | ||
|
|
cdc8847f9b | ||
|
|
25bd4b9eb5 | ||
|
|
d476191252 | ||
|
|
bf35d6a07c | ||
|
|
5378d38a05 | ||
|
|
85984f1173 | ||
|
|
92bb40349f | ||
|
|
fcee9bf738 | ||
|
|
cc2f3408ad | ||
|
|
89fb218041 | ||
|
|
4d0c3781e5 | ||
|
|
e2e319ac7f | ||
|
|
63508cad3f | ||
|
|
0b6eb6eed1 | ||
|
|
a41cfdeba5 | ||
|
|
7a6763ca33 | ||
|
|
2a6e19e4f9 | ||
|
|
9f9526b722 | ||
|
|
267684b7c3 | ||
|
|
b74dd3d576 | ||
|
|
278ae48842 | ||
|
|
189ca12627 | ||
|
|
5108f57ba8 | ||
|
|
6bace666e4 | ||
|
|
4c35616d30 | ||
|
|
cadbc733b8 | ||
|
|
ee6088957d | ||
|
|
58118c89f7 | ||
|
|
108112c9a0 | ||
|
|
4f586719e7 | ||
|
|
31e4985480 | ||
|
|
672b8bd262 | ||
|
|
c64c185407 | ||
|
|
19fd6aa4e3 | ||
|
|
55746d05f3 | ||
|
|
ad8d6382d4 | ||
|
|
5114a6c09c | ||
|
|
f405c109e2 |
@@ -1,194 +0,0 @@
|
||||
# Copyright 2020 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
# We want to use LTS ubuntu from our mirror because dockerhub has a
|
||||
# rate limit.
|
||||
# FROM mirror.gcr.io/library/ubuntu:18.04
|
||||
# However, now the above image is not working, we're using our own cache
|
||||
FROM gcr.io/cloud-devrel-kokoro-resources/ubuntu:20.04
|
||||
|
||||
ENV DEBIAN_FRONTEND noninteractive
|
||||
|
||||
# Ensure local Python is preferred over distribution Python.
|
||||
ENV PATH /usr/local/bin:$PATH
|
||||
|
||||
# http://bugs.python.org/issue19846
|
||||
# At the moment, setting "LANG=C" on a Linux system fundamentally breaks
|
||||
# Python 3.
|
||||
ENV LANG C.UTF-8
|
||||
|
||||
# Install dependencies.
|
||||
RUN apt-get update \
|
||||
&& apt-get install -y --no-install-recommends \
|
||||
apt-transport-https \
|
||||
build-essential \
|
||||
ca-certificates \
|
||||
curl \
|
||||
dirmngr \
|
||||
git \
|
||||
gcc \
|
||||
gpg-agent \
|
||||
graphviz \
|
||||
libbz2-dev \
|
||||
libdb5.3-dev \
|
||||
libexpat1-dev \
|
||||
libffi-dev \
|
||||
liblzma-dev \
|
||||
libmagickwand-dev \
|
||||
libmemcached-dev \
|
||||
libpython3-dev \
|
||||
libreadline-dev \
|
||||
libsnappy-dev \
|
||||
libssl-dev \
|
||||
libsqlite3-dev \
|
||||
portaudio19-dev \
|
||||
pkg-config \
|
||||
redis-server \
|
||||
software-properties-common \
|
||||
ssh \
|
||||
sudo \
|
||||
systemd \
|
||||
tcl \
|
||||
tcl-dev \
|
||||
tk \
|
||||
tk-dev \
|
||||
uuid-dev \
|
||||
wget \
|
||||
zlib1g-dev \
|
||||
&& apt-get clean autoclean \
|
||||
&& apt-get autoremove -y \
|
||||
&& rm -rf /var/lib/apt/lists/* \
|
||||
&& rm -f /var/cache/apt/archives/*.deb
|
||||
|
||||
# Install docker
|
||||
RUN curl -fsSL https://download.docker.com/linux/ubuntu/gpg | sudo apt-key add -
|
||||
|
||||
RUN add-apt-repository \
|
||||
"deb [arch=amd64] https://download.docker.com/linux/ubuntu \
|
||||
$(lsb_release -cs) \
|
||||
stable"
|
||||
|
||||
RUN apt-get update \
|
||||
&& apt-get install -y --no-install-recommends \
|
||||
docker-ce \
|
||||
&& apt-get clean autoclean \
|
||||
&& apt-get autoremove -y \
|
||||
&& rm -rf /var/lib/apt/lists/* \
|
||||
&& rm -f /var/cache/apt/archives/*.deb
|
||||
|
||||
# Install Bazel for compiling Tink in Cloud SQL Client Side Encryption Samples
|
||||
# TODO: Delete this section once google/tink#483 is resolved
|
||||
RUN apt install -y curl gpgconf gpg \
|
||||
&& curl -fsSL https://bazel.build/bazel-release.pub.gpg | gpg --dearmor > bazel.gpg \
|
||||
&& mv bazel.gpg /etc/apt/trusted.gpg.d/ \
|
||||
&& echo "deb [arch=amd64] https://storage.googleapis.com/bazel-apt stable jdk1.8" | sudo tee /etc/apt/sources.list.d/bazel.list \
|
||||
&& apt update && apt install -y bazel \
|
||||
&& apt-get clean autoclean \
|
||||
&& apt-get autoremove -y \
|
||||
&& rm -rf /var/lib/apt/lists/* \
|
||||
&& rm -f /var/cache/apt/archives/*.deb
|
||||
|
||||
# Install Microsoft ODBC 17 Driver and unixodbc for testing SQL Server samples
|
||||
RUN curl https://packages.microsoft.com/keys/microsoft.asc | apt-key add - \
|
||||
&& curl https://packages.microsoft.com/config/ubuntu/20.04/prod.list > /etc/apt/sources.list.d/mssql-release.list \
|
||||
&& apt-get update \
|
||||
&& ACCEPT_EULA=Y apt-get install -y --no-install-recommends \
|
||||
msodbcsql17 \
|
||||
unixodbc-dev \
|
||||
&& apt-get clean autoclean \
|
||||
&& apt-get autoremove -y \
|
||||
&& rm -rf /var/lib/apt/lists/* \
|
||||
&& rm -f /var/cache/apt/archives/*.deb
|
||||
|
||||
COPY fetch_gpg_keys.sh /tmp
|
||||
# Install the desired versions of Python.
|
||||
RUN set -ex \
|
||||
&& export GNUPGHOME="$(mktemp -d)" \
|
||||
&& echo "disable-ipv6" >> "${GNUPGHOME}/dirmngr.conf" \
|
||||
&& /tmp/fetch_gpg_keys.sh \
|
||||
&& for PYTHON_VERSION in 2.7.18 3.6.13 3.7.10 3.8.8 3.9.2; do \
|
||||
wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz" \
|
||||
&& wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz.asc "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz.asc" \
|
||||
&& gpg --batch --verify python-${PYTHON_VERSION}.tar.xz.asc python-${PYTHON_VERSION}.tar.xz \
|
||||
&& rm -r python-${PYTHON_VERSION}.tar.xz.asc \
|
||||
&& mkdir -p /usr/src/python-${PYTHON_VERSION} \
|
||||
&& tar -xJC /usr/src/python-${PYTHON_VERSION} --strip-components=1 -f python-${PYTHON_VERSION}.tar.xz \
|
||||
&& rm python-${PYTHON_VERSION}.tar.xz \
|
||||
&& cd /usr/src/python-${PYTHON_VERSION} \
|
||||
&& ./configure \
|
||||
--enable-shared \
|
||||
# This works only on Python 2.7 and throws a warning on every other
|
||||
# version, but seems otherwise harmless.
|
||||
--enable-unicode=ucs4 \
|
||||
--with-system-ffi \
|
||||
--without-ensurepip \
|
||||
&& make -j$(nproc) \
|
||||
&& make install \
|
||||
&& ldconfig \
|
||||
; done \
|
||||
&& rm -rf "${GNUPGHOME}" \
|
||||
&& rm -rf /usr/src/python* \
|
||||
&& rm -rf ~/.cache/
|
||||
|
||||
|
||||
# Install pip on Python 3.6 only.
|
||||
# If the environment variable is called "PIP_VERSION", pip explodes with
|
||||
# "ValueError: invalid truth value '<VERSION>'"
|
||||
ENV PYTHON_PIP_VERSION 20.2.4
|
||||
RUN wget --no-check-certificate -O /tmp/get-pip.py 'https://bootstrap.pypa.io/get-pip.py' \
|
||||
&& python3.6 /tmp/get-pip.py "pip==$PYTHON_PIP_VERSION" \
|
||||
# we use "--force-reinstall" for the case where the version of pip we're trying to install is the same as the version bundled with Python
|
||||
# ("Requirement already up-to-date: pip==8.1.2 in /usr/local/lib/python3.6/site-packages")
|
||||
# https://github.com/docker-library/python/pull/143#issuecomment-241032683
|
||||
&& pip3 install --no-cache-dir --upgrade --force-reinstall "pip==$PYTHON_PIP_VERSION" \
|
||||
# then we use "pip list" to ensure we don't have more than one pip version installed
|
||||
# https://github.com/docker-library/python/pull/100
|
||||
&& [ "$(pip list |tac|tac| awk -F '[ ()]+' '$1 == "pip" { print $2; exit }')" = "$PYTHON_PIP_VERSION" ]
|
||||
|
||||
# Ensure Pip for python3
|
||||
RUN python3 /tmp/get-pip.py
|
||||
RUN rm /tmp/get-pip.py
|
||||
|
||||
# Install "virtualenv", since the vast majority of users of this image
|
||||
# will want it.
|
||||
RUN pip install --no-cache-dir virtualenv
|
||||
|
||||
# Setup Cloud SDK
|
||||
ENV CLOUD_SDK_VERSION 339.0.0
|
||||
# Use system python for cloud sdk.
|
||||
ENV CLOUDSDK_PYTHON python3.6
|
||||
RUN wget https://dl.google.com/dl/cloudsdk/channels/rapid/downloads/google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
|
||||
RUN tar xzf google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
|
||||
RUN /google-cloud-sdk/install.sh
|
||||
ENV PATH /google-cloud-sdk/bin:$PATH
|
||||
|
||||
# Enable redis-server on boot.
|
||||
RUN sudo systemctl enable redis-server.service
|
||||
|
||||
# Create a user and allow sudo
|
||||
|
||||
# kbuilder uid on the default Kokoro image
|
||||
ARG UID=1000
|
||||
ARG USERNAME=kbuilder
|
||||
|
||||
# Add a new user to the container image.
|
||||
# This is needed for ssh and sudo access.
|
||||
|
||||
# Add a new user with the caller's uid and the username.
|
||||
RUN useradd -d /h -u ${UID} ${USERNAME}
|
||||
|
||||
# Allow nopasswd sudo
|
||||
RUN echo "${USERNAME} ALL=(ALL) NOPASSWD:ALL" >> /etc/sudoers
|
||||
|
||||
CMD ["python3.6"]
|
||||
@@ -1 +1,2 @@
|
||||
ratemate
|
||||
google-cloud-aiplatform
|
||||
@@ -1,11 +1,14 @@
|
||||
from typing import List
|
||||
from ratemate import RateLimit
|
||||
from resource_cleanup_manager import (
|
||||
ResourceCleanupManager,
|
||||
DatasetResourceCleanupManager,
|
||||
EndpointResourceCleanupManager,
|
||||
ModelResourceCleanupManager,
|
||||
EndpointResourceCleanupManager,
|
||||
ResourceCleanupManager,
|
||||
)
|
||||
|
||||
rate_limit = RateLimit(max_count=25, per=60, greedy=False)
|
||||
|
||||
|
||||
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
|
||||
for manager in managers:
|
||||
@@ -15,14 +18,18 @@ def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: boo
|
||||
resources = manager.list()
|
||||
print(f"Found {len(resources)} {type_name}'s")
|
||||
for resource in resources:
|
||||
if not manager.is_deletable(resource):
|
||||
continue
|
||||
try:
|
||||
if not manager.is_deletable(resource):
|
||||
continue
|
||||
|
||||
if is_dry_run:
|
||||
resource_name = manager.resource_name(resource)
|
||||
print(f"Will delete '{type_name}': {resource_name}")
|
||||
else:
|
||||
manager.delete(resource)
|
||||
if is_dry_run:
|
||||
resource_name = manager.resource_name(resource)
|
||||
print(f"Will delete '{type_name}': {resource_name}")
|
||||
else:
|
||||
rate_limit.wait() # wait before deleting
|
||||
manager.delete(resource)
|
||||
except Exception as exception:
|
||||
print(exception)
|
||||
|
||||
print("")
|
||||
|
||||
@@ -36,7 +43,7 @@ if is_dry_run:
|
||||
managers = [
|
||||
DatasetResourceCleanupManager(),
|
||||
EndpointResourceCleanupManager(),
|
||||
ModelResourceCleanupManager(),
|
||||
ModelResourceCleanupManager(), # ModelResourceCleanupManager must follow EndpointResourceCleanupManager due to deployed models blocking model deletion.
|
||||
]
|
||||
|
||||
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
|
||||
|
||||
@@ -1,8 +1,9 @@
|
||||
import abc
|
||||
from typing import Any, Type
|
||||
|
||||
from google.cloud import aiplatform
|
||||
from typing import Any
|
||||
from proto.datetime_helpers import DatetimeWithNanoseconds
|
||||
from google.cloud.aiplatform import base
|
||||
from proto.datetime_helpers import DatetimeWithNanoseconds
|
||||
|
||||
# If a resource was updated within this number of seconds, do not delete.
|
||||
RESOURCE_UPDATE_BUFFER_IN_SECONDS = 60 * 60 * 8
|
||||
@@ -40,7 +41,7 @@ class ResourceCleanupManager(abc.ABC):
|
||||
# Check that it wasn't created too recently, to prevent race conditions
|
||||
if time_difference <= RESOURCE_UPDATE_BUFFER_IN_SECONDS:
|
||||
print(
|
||||
f"Skipping '{resource}' due update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
|
||||
f"Skipping '{resource}' due to update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
|
||||
)
|
||||
return False
|
||||
|
||||
@@ -50,7 +51,7 @@ class ResourceCleanupManager(abc.ABC):
|
||||
class VertexAIResourceCleanupManager(ResourceCleanupManager):
|
||||
@property
|
||||
@abc.abstractmethod
|
||||
def vertex_ai_resource(self) -> base.VertexAiResourceNounWithFutureManager:
|
||||
def vertex_ai_resource(self) -> Type[base.VertexAiResourceNounWithFutureManager]:
|
||||
pass
|
||||
|
||||
@property
|
||||
@@ -60,7 +61,9 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
|
||||
def list(self) -> Any:
|
||||
return self.vertex_ai_resource.list()
|
||||
|
||||
def resource_name(self, resource: Any) -> str:
|
||||
def resource_name(
|
||||
self, resource: Type[base.VertexAiResourceNounWithFutureManager]
|
||||
) -> str:
|
||||
return resource.display_name
|
||||
|
||||
def delete(self, resource):
|
||||
@@ -74,12 +77,33 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
|
||||
|
||||
class DatasetResourceCleanupManager(VertexAIResourceCleanupManager):
|
||||
vertex_ai_resource = aiplatform.datasets._Dataset
|
||||
dataset_types = [
|
||||
aiplatform.ImageDataset,
|
||||
aiplatform.TabularDataset,
|
||||
aiplatform.TextDataset,
|
||||
aiplatform.TimeSeriesDataset,
|
||||
aiplatform.VideoDataset,
|
||||
]
|
||||
|
||||
def list(self) -> Any:
|
||||
return [
|
||||
dataset
|
||||
for dataset_type in self.dataset_types
|
||||
for dataset in dataset_type.list()
|
||||
]
|
||||
|
||||
|
||||
class EndpointResourceCleanupManager(VertexAIResourceCleanupManager):
|
||||
vertex_ai_resource = aiplatform.Endpoint
|
||||
|
||||
def delete(self, resource):
|
||||
# TODO: Remove this once https://github.com/googleapis/python-aiplatform/issues/1441 is fixed
|
||||
resource._sync_gca_resource()
|
||||
for deployed_model_id in [
|
||||
models.id for models in resource._gca_resource.deployed_models
|
||||
]:
|
||||
resource._undeploy(deployed_model_id=deployed_model_id)
|
||||
|
||||
resource.delete(force=True)
|
||||
|
||||
|
||||
|
||||
@@ -0,0 +1,130 @@
|
||||
#!/usr/bin/env python
|
||||
# Copyright 2021 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
|
||||
|
||||
import argparse
|
||||
import pathlib
|
||||
|
||||
import execute_changed_notebooks_helper
|
||||
|
||||
|
||||
def str2bool(v):
|
||||
if isinstance(v, bool):
|
||||
return v
|
||||
if v.lower() in ("yes", "true", "t", "y", "1"):
|
||||
return True
|
||||
elif v.lower() in ("no", "false", "f", "n", "0"):
|
||||
return False
|
||||
else:
|
||||
raise argparse.ArgumentTypeError("Boolean value expected.")
|
||||
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run changed notebooks.")
|
||||
parser.add_argument(
|
||||
"--test_paths_file",
|
||||
type=pathlib.Path,
|
||||
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--base_branch",
|
||||
help="The base git branch to diff against to find changed files.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--container_uri",
|
||||
type=str,
|
||||
help="The container uri to run each notebook in.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_project_id",
|
||||
type=str,
|
||||
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_region",
|
||||
type=str,
|
||||
help="The GCP region. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_service_account",
|
||||
type=str,
|
||||
help="A service account. This is used to inject a variable value into the notebook before running. This is not the account that will run the notebook.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_vpc_network",
|
||||
type=str,
|
||||
help="The full VPC network name. See https://cloud.google.com/compute/docs/networks-and-firewalls#networks. Format is projects/{project}/global/networks/{network}, where {project} is a project number, as in '12345', and {network} is network name. See <https://cloud.google.com/compute/docs/reference/rest/v1/networks/insert> for details. This is used to inject a variable value into the notebook before running.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--staging_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for staging temporary files.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--artifacts_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for storing executed notebooks.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--timeout",
|
||||
type=int,
|
||||
help="Timeout in seconds",
|
||||
default=86400,
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--private_pool_id",
|
||||
type=str,
|
||||
help="The private pool id.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--should_parallelize",
|
||||
type=str2bool,
|
||||
nargs="?",
|
||||
const=True,
|
||||
default=True,
|
||||
help="Should run notebooks in parallel.",
|
||||
)
|
||||
|
||||
args = parser.parse_args()
|
||||
|
||||
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
|
||||
test_paths_file=args.test_paths_file,
|
||||
base_branch=args.base_branch,
|
||||
)
|
||||
|
||||
execute_changed_notebooks_helper.process_and_execute_notebooks(
|
||||
notebooks=notebooks,
|
||||
container_uri=args.container_uri,
|
||||
staging_bucket=args.staging_bucket,
|
||||
artifacts_bucket=args.artifacts_bucket,
|
||||
should_parallelize=args.should_parallelize,
|
||||
timeout=args.timeout,
|
||||
variable_project_id=args.variable_project_id,
|
||||
variable_region=args.variable_region,
|
||||
variable_service_account=args.variable_service_account,
|
||||
variable_vpc_network=args.variable_vpc_network,
|
||||
private_pool_id=args.private_pool_id,
|
||||
)
|
||||
@@ -13,34 +13,28 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
import argparse
|
||||
import concurrent
|
||||
import dataclasses
|
||||
import datetime
|
||||
import functools
|
||||
import git
|
||||
import operator
|
||||
import os
|
||||
import pathlib
|
||||
import nbformat
|
||||
import re
|
||||
import subprocess
|
||||
from typing import List, Optional
|
||||
from tabulate import tabulate
|
||||
import operator
|
||||
|
||||
import execute_notebook_helper
|
||||
import execute_notebook_remote
|
||||
from utils import util, NotebookProcessors
|
||||
import nbformat
|
||||
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
|
||||
from ratemate import RateLimit
|
||||
from tabulate import tabulate
|
||||
from utils import NotebookProcessors, util
|
||||
|
||||
|
||||
def str2bool(v):
|
||||
if isinstance(v, bool):
|
||||
return v
|
||||
if v.lower() in ("yes", "true", "t", "y", "1"):
|
||||
return True
|
||||
elif v.lower() in ("no", "false", "f", "n", "0"):
|
||||
return False
|
||||
else:
|
||||
raise argparse.ArgumentTypeError("Boolean value expected.")
|
||||
# A buffer so that workers finish before the orchestrating job
|
||||
WORKER_TIMEOUT_BUFFER_IN_SECONDS: int = 60 * 60
|
||||
|
||||
|
||||
def format_timedelta(delta: datetime.timedelta) -> str:
|
||||
@@ -74,11 +68,20 @@ class NotebookExecutionResult:
|
||||
build_id: str
|
||||
error_message: Optional[str]
|
||||
|
||||
@property
|
||||
def output_uri_web(self) -> Optional[str]:
|
||||
if self.output_uri.startswith("gs://"):
|
||||
return f"https://storage.googleapis.com/{self.output_uri[5:]}"
|
||||
else:
|
||||
return None
|
||||
|
||||
|
||||
def _process_notebook(
|
||||
notebook_path: str,
|
||||
variable_project_id: str,
|
||||
variable_region: str,
|
||||
variable_service_account: str,
|
||||
variable_vpc_network: Optional[str],
|
||||
):
|
||||
# Read notebook
|
||||
with open(notebook_path) as f:
|
||||
@@ -90,6 +93,8 @@ def _process_notebook(
|
||||
replacement_map={
|
||||
"PROJECT_ID": variable_project_id,
|
||||
"REGION": variable_region,
|
||||
"SERVICE_ACCOUNT": variable_service_account,
|
||||
"VPC_NETWORK": variable_vpc_network,
|
||||
},
|
||||
)
|
||||
|
||||
@@ -115,17 +120,33 @@ def _create_tag(filepath: str) -> str:
|
||||
return tag
|
||||
|
||||
|
||||
def execute_notebook(
|
||||
rate_limit = RateLimit(max_count=50, per=60, greedy=True)
|
||||
|
||||
|
||||
def process_and_execute_notebook(
|
||||
container_uri: str,
|
||||
staging_bucket: str,
|
||||
artifacts_bucket: str,
|
||||
variable_project_id: str,
|
||||
variable_region: str,
|
||||
variable_service_account: str,
|
||||
variable_vpc_network: Optional[str],
|
||||
private_pool_id: Optional[str],
|
||||
deadline: datetime.datetime,
|
||||
notebook: str,
|
||||
should_get_tail_logs: bool = False,
|
||||
) -> NotebookExecutionResult:
|
||||
rate_limit.wait() # wait before creating the task
|
||||
|
||||
print(f"Running notebook: {notebook}")
|
||||
|
||||
# Handle empty strings
|
||||
if not variable_vpc_network:
|
||||
variable_vpc_network = None
|
||||
|
||||
if not private_pool_id:
|
||||
private_pool_id = None
|
||||
|
||||
# Create paths
|
||||
notebook_output_uri = "/".join([artifacts_bucket, pathlib.Path(notebook).name])
|
||||
|
||||
@@ -151,17 +172,27 @@ def execute_notebook(
|
||||
notebook_path=notebook,
|
||||
variable_project_id=variable_project_id,
|
||||
variable_region=variable_region,
|
||||
variable_service_account=variable_service_account,
|
||||
variable_vpc_network=variable_vpc_network,
|
||||
)
|
||||
|
||||
# Upload the pre-processed code to a GCS bucket
|
||||
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
|
||||
|
||||
# Calculate timeout in seconds
|
||||
timeout_in_seconds = max(
|
||||
int((deadline - datetime.datetime.now()).total_seconds()), 1
|
||||
)
|
||||
|
||||
operation = execute_notebook_remote.execute_notebook_remote(
|
||||
code_archive_uri=code_archive_uri,
|
||||
notebook_uri=notebook,
|
||||
notebook_output_uri=notebook_output_uri,
|
||||
container_uri=container_uri,
|
||||
tag=tag,
|
||||
private_pool_id=private_pool_id,
|
||||
private_pool_region=variable_region,
|
||||
timeout_in_seconds=timeout_in_seconds,
|
||||
)
|
||||
|
||||
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
|
||||
@@ -202,15 +233,77 @@ def execute_notebook(
|
||||
return result
|
||||
|
||||
|
||||
def run_changed_notebooks(
|
||||
def get_changed_notebooks(
|
||||
test_paths_file: str,
|
||||
base_branch: Optional[str] = None,
|
||||
) -> List[str]:
|
||||
"""
|
||||
Get the notebooks that exist under the folders defined in the test_paths_file.
|
||||
It only returns notebooks that have differences from the Git base_branch.
|
||||
"""
|
||||
|
||||
test_paths = []
|
||||
with open(test_paths_file) as file:
|
||||
lines = [line.strip() for line in file.readlines()]
|
||||
lines = [line for line in lines if len(line) > 0]
|
||||
test_paths = [line for line in lines]
|
||||
|
||||
if len(test_paths) == 0:
|
||||
raise RuntimeError("No test folders found.")
|
||||
|
||||
print(f"Checking folders: {test_paths}")
|
||||
|
||||
# Find notebooks
|
||||
notebooks = []
|
||||
|
||||
# Instantiate GitPython objects
|
||||
repo = git.Repo(os.getcwd())
|
||||
index = repo.index
|
||||
|
||||
if base_branch:
|
||||
# Get the point at which this branch branches off from main
|
||||
branching_commits = repo.merge_base("HEAD", f"origin/{base_branch}")
|
||||
|
||||
if len(branching_commits) > 0:
|
||||
branching_commit = branching_commits[0]
|
||||
print(f"Looking for notebooks that changed from branch: {branching_commit}")
|
||||
|
||||
notebooks = [
|
||||
diff.b_path
|
||||
for diff in index.diff(branching_commit, paths=test_paths)
|
||||
if diff.b_path is not None
|
||||
]
|
||||
else:
|
||||
notebooks = []
|
||||
else:
|
||||
print(f"Looking for all notebooks.")
|
||||
notebooks_str = subprocess.check_output(["git", "ls-files"] + test_paths)
|
||||
notebooks = notebooks_str.decode("utf-8").split("\n")
|
||||
|
||||
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
|
||||
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
|
||||
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
|
||||
|
||||
if len(notebooks) > 0:
|
||||
print(f"Found {len(notebooks)} notebooks:")
|
||||
for notebook in notebooks:
|
||||
print(f"\t{notebook}")
|
||||
|
||||
return notebooks
|
||||
|
||||
|
||||
def process_and_execute_notebooks(
|
||||
notebooks: List[str],
|
||||
container_uri: str,
|
||||
staging_bucket: str,
|
||||
artifacts_bucket: str,
|
||||
should_parallelize: bool,
|
||||
timeout: int,
|
||||
variable_project_id: str,
|
||||
variable_region: str,
|
||||
should_parallelize: bool,
|
||||
base_branch: Optional[str] = None,
|
||||
variable_service_account: str,
|
||||
variable_vpc_network: Optional[str] = None,
|
||||
private_pool_id: Optional[str] = None,
|
||||
):
|
||||
"""
|
||||
Run the notebooks that exist under the folders defined in the test_paths_file.
|
||||
@@ -237,171 +330,128 @@ def run_changed_notebooks(
|
||||
Required. The value for REGION to inject into notebooks.
|
||||
should_parallelize (bool):
|
||||
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
|
||||
timeout (str):
|
||||
Required. Timeout string according to https://cloud.google.com/build/docs/build-config-file-schema#timeout.
|
||||
"""
|
||||
|
||||
test_paths = []
|
||||
with open(test_paths_file) as file:
|
||||
lines = [line.strip() for line in file.readlines()]
|
||||
lines = [line for line in lines if len(line) > 0]
|
||||
test_paths = [line for line in lines]
|
||||
# Calculate deadline
|
||||
deadline = datetime.datetime.now() + datetime.timedelta(
|
||||
seconds=max(timeout - WORKER_TIMEOUT_BUFFER_IN_SECONDS, 0)
|
||||
)
|
||||
|
||||
if len(test_paths) == 0:
|
||||
raise RuntimeError("No test folders found.")
|
||||
if len(notebooks) > 1:
|
||||
notebook_execution_results: List[NotebookExecutionResult] = []
|
||||
|
||||
print(f"Checking folders: {test_paths}")
|
||||
|
||||
# Find notebooks
|
||||
notebooks = []
|
||||
if base_branch:
|
||||
print(f"Looking for notebooks that changed from branch: {base_branch}")
|
||||
notebooks = subprocess.check_output(
|
||||
["git", "diff", "--name-only", f"origin/{base_branch}..."] + test_paths
|
||||
)
|
||||
else:
|
||||
print(f"Looking for all notebooks.")
|
||||
notebooks = subprocess.check_output(["git", "ls-files"] + test_paths)
|
||||
|
||||
notebooks = notebooks.decode("utf-8").split("\n")
|
||||
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
|
||||
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
|
||||
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
|
||||
|
||||
notebook_execution_results: List[NotebookExecutionResult] = []
|
||||
|
||||
if len(notebooks) > 0:
|
||||
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
|
||||
|
||||
if should_parallelize and len(notebooks) > 1:
|
||||
print(
|
||||
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
|
||||
)
|
||||
with concurrent.futures.ThreadPoolExecutor(max_workers=None) as executor:
|
||||
with concurrent.futures.ThreadPoolExecutor(max_workers=100) as executor:
|
||||
print(f"Max workers: {executor._max_workers}")
|
||||
|
||||
notebook_execution_results = list(
|
||||
executor.map(
|
||||
functools.partial(
|
||||
execute_notebook,
|
||||
process_and_execute_notebook,
|
||||
container_uri,
|
||||
staging_bucket,
|
||||
artifacts_bucket,
|
||||
variable_project_id,
|
||||
variable_region,
|
||||
variable_service_account,
|
||||
variable_vpc_network,
|
||||
private_pool_id,
|
||||
deadline,
|
||||
),
|
||||
notebooks,
|
||||
)
|
||||
)
|
||||
else:
|
||||
notebook_execution_results = [
|
||||
execute_notebook(
|
||||
process_and_execute_notebook(
|
||||
container_uri=container_uri,
|
||||
staging_bucket=staging_bucket,
|
||||
artifacts_bucket=artifacts_bucket,
|
||||
variable_project_id=variable_project_id,
|
||||
variable_region=variable_region,
|
||||
variable_service_account=variable_service_account,
|
||||
variable_vpc_network=variable_vpc_network,
|
||||
private_pool_id=private_pool_id,
|
||||
deadline=deadline,
|
||||
notebook=notebook,
|
||||
)
|
||||
for notebook in notebooks
|
||||
]
|
||||
|
||||
print("\n=== RESULTS ===\n")
|
||||
|
||||
results_sorted = sorted(
|
||||
notebook_execution_results,
|
||||
key=lambda result: result.is_pass,
|
||||
reverse=True,
|
||||
)
|
||||
|
||||
# Print results
|
||||
print(
|
||||
tabulate(
|
||||
[
|
||||
[
|
||||
result.name,
|
||||
"PASSED" if result.is_pass else "FAILED",
|
||||
format_timedelta(result.duration),
|
||||
result.log_url,
|
||||
result.output_uri,
|
||||
result.output_uri_web,
|
||||
]
|
||||
for result in results_sorted
|
||||
],
|
||||
headers=[
|
||||
"build_tag",
|
||||
"status",
|
||||
"duration",
|
||||
"log_url",
|
||||
"output_uri",
|
||||
"output_uri_web",
|
||||
],
|
||||
)
|
||||
)
|
||||
|
||||
print("\n=== END RESULTS===\n")
|
||||
|
||||
total_notebook_duration = functools.reduce(
|
||||
operator.add,
|
||||
[datetime.timedelta(seconds=0)]
|
||||
+ [result.duration for result in results_sorted],
|
||||
)
|
||||
|
||||
print(
|
||||
f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}"
|
||||
)
|
||||
|
||||
# Raise error if any notebooks failed
|
||||
if not all([result.is_pass for result in results_sorted]):
|
||||
raise RuntimeError("Notebook failures detected. See logs for details")
|
||||
|
||||
elif len(notebooks) == 1:
|
||||
notebook = notebooks[0]
|
||||
|
||||
# Pre-process notebook by substituting variable names
|
||||
_process_notebook(
|
||||
notebook_path=notebook,
|
||||
variable_project_id=variable_project_id,
|
||||
variable_region=variable_region,
|
||||
variable_service_account=variable_service_account,
|
||||
variable_vpc_network=variable_vpc_network,
|
||||
)
|
||||
|
||||
execute_notebook_helper.execute_notebook(
|
||||
notebook_source=notebook,
|
||||
output_file_or_uri="/".join(
|
||||
[artifacts_bucket, pathlib.Path(notebook).name]
|
||||
),
|
||||
should_log_output=True,
|
||||
)
|
||||
else:
|
||||
print("No notebooks modified in this pull request.")
|
||||
|
||||
print("\n=== RESULTS ===\n")
|
||||
|
||||
results_sorted = sorted(
|
||||
notebook_execution_results,
|
||||
key=lambda result: result.is_pass,
|
||||
reverse=True,
|
||||
)
|
||||
|
||||
# Print results
|
||||
print(
|
||||
tabulate(
|
||||
[
|
||||
[
|
||||
result.name,
|
||||
"PASSED" if result.is_pass else "FAILED",
|
||||
format_timedelta(result.duration),
|
||||
result.log_url,
|
||||
]
|
||||
for result in results_sorted
|
||||
],
|
||||
headers=["build_tag", "status", "duration", "log_url"],
|
||||
)
|
||||
)
|
||||
|
||||
print("\n=== END RESULTS===\n")
|
||||
|
||||
total_notebook_duration = functools.reduce(
|
||||
operator.add,
|
||||
[datetime.timedelta(seconds=0)]
|
||||
+ [result.duration for result in results_sorted],
|
||||
)
|
||||
|
||||
print(f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}")
|
||||
|
||||
# Raise error if any notebooks failed
|
||||
if not all([result.is_pass for result in results_sorted]):
|
||||
raise RuntimeError("Notebook failures detected. See logs for details")
|
||||
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run changed notebooks.")
|
||||
parser.add_argument(
|
||||
"--test_paths_file",
|
||||
type=pathlib.Path,
|
||||
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--base_branch",
|
||||
help="The base git branch to diff against to find changed files.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--container_uri",
|
||||
type=str,
|
||||
help="The container uri to run each notebook in.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_project_id",
|
||||
type=str,
|
||||
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_region",
|
||||
type=str,
|
||||
help="The GCP region. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--staging_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for staging temporary files.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--artifacts_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for storing executed notebooks.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--should_parallelize",
|
||||
type=str2bool,
|
||||
nargs="?",
|
||||
const=True,
|
||||
default=True,
|
||||
help="Should run notebooks in parallel.",
|
||||
)
|
||||
|
||||
args = parser.parse_args()
|
||||
run_changed_notebooks(
|
||||
test_paths_file=args.test_paths_file,
|
||||
container_uri=args.container_uri,
|
||||
staging_bucket=args.staging_bucket,
|
||||
artifacts_bucket=args.artifacts_bucket,
|
||||
variable_project_id=args.variable_project_id,
|
||||
variable_region=args.variable_region,
|
||||
should_parallelize=args.should_parallelize,
|
||||
base_branch=args.base_branch,
|
||||
)
|
||||
@@ -13,10 +13,13 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
import argparse
|
||||
import ExecuteNotebook
|
||||
"""A CLI to download (optional) and run a single notebook locally"""
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run changed notebooks.")
|
||||
import argparse
|
||||
|
||||
import execute_notebook_helper
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
|
||||
parser.add_argument(
|
||||
"--notebook_source",
|
||||
type=str,
|
||||
@@ -31,7 +34,7 @@ parser.add_argument(
|
||||
)
|
||||
|
||||
args = parser.parse_args()
|
||||
ExecuteNotebook.execute_notebook(
|
||||
execute_notebook_helper.execute_notebook(
|
||||
notebook_source=args.notebook_source,
|
||||
output_file_or_uri=args.output_file_or_uri,
|
||||
should_log_output=True,
|
||||
|
||||
@@ -13,23 +13,29 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
import sys
|
||||
import os
|
||||
import errno
|
||||
import papermill as pm
|
||||
import shutil
|
||||
"""Methods to run a notebook locally"""
|
||||
|
||||
from utils import util
|
||||
import errno
|
||||
import os
|
||||
import shutil
|
||||
import sys
|
||||
|
||||
import papermill as pm
|
||||
from google.cloud.aiplatform import utils
|
||||
from utils import util
|
||||
|
||||
# This script is used to execute a notebook and write out the output notebook.
|
||||
|
||||
# This is used to force papermill to use this kernel to run the notebook instead of any defined inside the notebook itself
|
||||
DEFAULT_KERNEL_NAME = "python3"
|
||||
|
||||
|
||||
def execute_notebook(
|
||||
notebook_source: str,
|
||||
output_file_or_uri: str,
|
||||
should_log_output: bool,
|
||||
):
|
||||
"""Execute a single notebook using Papermill"""
|
||||
file_name = os.path.basename(os.path.normpath(notebook_source))
|
||||
|
||||
# Download notebook if it's a GCS URI
|
||||
@@ -47,6 +53,17 @@ def execute_notebook(
|
||||
|
||||
execution_exception = None
|
||||
|
||||
print("\n=== DOWNLOAD EXECUTED NOTEBOOK ===\n")
|
||||
print(f"Please debug the executed notebook by downloading the executed notebook:")
|
||||
|
||||
print("Option 1. Using gsutil. Run the following command in your terminal.")
|
||||
print(f'\tgsutil cp "{output_file_or_uri}" .')
|
||||
|
||||
print("Option 2. Using this link.")
|
||||
print(f"\thttps://storage.googleapis.com/{output_file_or_uri[5:]}")
|
||||
|
||||
print("\n======\n")
|
||||
|
||||
# Execute notebook
|
||||
try:
|
||||
# Execute notebook
|
||||
@@ -55,6 +72,7 @@ def execute_notebook(
|
||||
output_path=notebook_source,
|
||||
progress_bar=should_log_output,
|
||||
request_save_on_cell_execute=should_log_output,
|
||||
kernel_name=DEFAULT_KERNEL_NAME,
|
||||
log_output=should_log_output,
|
||||
stdout_file=sys.stdout if should_log_output else None,
|
||||
stderr_file=sys.stderr if should_log_output else None,
|
||||
@@ -68,10 +86,6 @@ def execute_notebook(
|
||||
util.upload_file(notebook_source, remote_file_path=output_file_or_uri)
|
||||
|
||||
print("\n=== EXECUTION FINISHED ===\n")
|
||||
print(
|
||||
f"Please debug the executed notebook by downloading: {output_file_or_uri}"
|
||||
)
|
||||
print("\n======\n")
|
||||
else:
|
||||
# Create directories if they don't exist
|
||||
if not os.path.exists(os.path.dirname(output_file_or_uri)):
|
||||
@@ -1,18 +1,34 @@
|
||||
#!/usr/bin/env python
|
||||
# Copyright 2021 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Methods to run a notebook on Google Cloud Build"""
|
||||
|
||||
from re import sub
|
||||
from typing import Optional
|
||||
|
||||
import google.auth
|
||||
import yaml
|
||||
from google.api_core import client_options, operation
|
||||
from google.cloud.aiplatform import utils
|
||||
from google.cloud.devtools import cloudbuild_v1
|
||||
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
|
||||
from google.protobuf import duration_pb2
|
||||
from yaml.loader import FullLoader
|
||||
|
||||
import google.auth
|
||||
from google.cloud.devtools import cloudbuild_v1
|
||||
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
|
||||
|
||||
from typing import Optional
|
||||
import yaml
|
||||
|
||||
from google.cloud.aiplatform import utils
|
||||
from google.api_core import operation
|
||||
|
||||
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
|
||||
TIMEOUT_IN_SECONDS = 86400
|
||||
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
|
||||
|
||||
|
||||
def execute_notebook_remote(
|
||||
@@ -20,20 +36,14 @@ def execute_notebook_remote(
|
||||
notebook_uri: str,
|
||||
notebook_output_uri: str,
|
||||
container_uri: str,
|
||||
private_pool_id: Optional[str],
|
||||
private_pool_region: Optional[str],
|
||||
tag: Optional[str],
|
||||
timeout_in_seconds: Optional[int] = None,
|
||||
) -> operation.Operation:
|
||||
"""Create and execute a simple Google Cloud Build configuration,
|
||||
print the in-progress status and print the completed status."""
|
||||
"""Create and execute a single notebook on Google Cloud Build"""
|
||||
# Load build steps from YAML
|
||||
|
||||
# Authorize the client with Google defaults
|
||||
credentials, project_id = google.auth.default()
|
||||
client = cloudbuild_v1.services.cloud_build.CloudBuildClient()
|
||||
|
||||
build = cloudbuild_v1.Build()
|
||||
|
||||
# The following build steps will output "hello world"
|
||||
# For more information on build configuration, see
|
||||
# https://cloud.google.com/build/docs/configuring-builds/create-basic-configuration
|
||||
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
|
||||
|
||||
substitutions = {
|
||||
@@ -42,6 +52,24 @@ def execute_notebook_remote(
|
||||
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
|
||||
}
|
||||
|
||||
build = cloudbuild_v1.Build()
|
||||
|
||||
options: Optional[client_options.ClientOptions] = None
|
||||
if private_pool_id and private_pool_region:
|
||||
# substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
|
||||
build.options = cloudbuild_config.get("options")
|
||||
build.options.pool = {"name": private_pool_id}
|
||||
|
||||
# Switch to the regional endpoint of the pool
|
||||
options = client_options.ClientOptions(
|
||||
api_endpoint=f"{private_pool_region}-{SERVICE_BASE_PATH}"
|
||||
)
|
||||
|
||||
# Authorize the client with Google defaults
|
||||
credentials, project_id = google.auth.default()
|
||||
|
||||
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
|
||||
|
||||
(
|
||||
source_archived_file_gcs_bucket,
|
||||
source_archived_file_gcs_object,
|
||||
@@ -56,8 +84,8 @@ def execute_notebook_remote(
|
||||
|
||||
build.steps = cloudbuild_config["steps"]
|
||||
build.substitutions = substitutions
|
||||
build.timeout = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
|
||||
build.queue_ttl = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
|
||||
build.timeout = duration_pb2.Duration(seconds=timeout_in_seconds)
|
||||
build.queue_ttl = duration_pb2.Duration(seconds=timeout_in_seconds)
|
||||
|
||||
if tag:
|
||||
build.tags = [tag]
|
||||
|
||||
@@ -4,25 +4,35 @@ steps:
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'gcloud config list'
|
||||
- 'gcloud config list --quiet'
|
||||
# Check the Python version
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'python3 .cloud-build/CheckPythonVersion.py'
|
||||
- python3 .cloud-build/CheckPythonVersion.py -q
|
||||
# Create a virtual environment
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- python3 -m venv workspace/env
|
||||
# Install Python dependencies
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
|
||||
- . workspace/env/bin/activate &&
|
||||
python3 -m pip -q install -U pip &&
|
||||
python3 -m pip -q install -U -r .cloud-build/requirements.txt
|
||||
# Install Python dependencies and run testing script
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"'
|
||||
- |
|
||||
. workspace/env/bin/activate &&
|
||||
python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"
|
||||
env:
|
||||
- 'IS_TESTING=1'
|
||||
timeout: 86400s
|
||||
|
||||
@@ -4,35 +4,42 @@ steps:
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'gcloud config list'
|
||||
# # Clone the Git repo
|
||||
# - name: ${_PYTHON_IMAGE}
|
||||
# entrypoint: git
|
||||
# args: ['clone', "${_GIT_REPO}", "--branch", "${_GIT_BRANCH_NAME}", "."]
|
||||
- gcloud config list --quiet
|
||||
# Check the Python version
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'python3 .cloud-build/CheckPythonVersion.py'
|
||||
# Fetch base branch if required
|
||||
- python3 .cloud-build/CheckPythonVersion.py -q
|
||||
# Fetch full repo for diff purposes
|
||||
- name: gcr.io/cloud-builders/git
|
||||
args: [fetch, --unshallow, --quiet]
|
||||
# Create a virtual environment
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'if [ -n "${_BASE_BRANCH}" ]; then git fetch origin "${_BASE_BRANCH}":refs/remotes/origin/"${_BASE_BRANCH}"; else echo "Skipping fetch."; fi'
|
||||
- python3 -m venv workspace/env
|
||||
# Install Python dependencies
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
|
||||
- . workspace/env/bin/activate &&
|
||||
python3 -m pip -q install -U pip &&
|
||||
python3 -m pip -q install -U -r .cloud-build/requirements.txt
|
||||
# Install Python dependencies and run testing script
|
||||
# TODO: Only pass in private_pool_id if it is set
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
|
||||
- |
|
||||
. workspace/env/bin/activate &&
|
||||
python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} --variable_service_account ${_GCP_SERVICE_ACCOUNT} --variable_vpc_network "${_GPC_VPC_NETWORK_NAME}" `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`
|
||||
env:
|
||||
- 'IS_TESTING=1'
|
||||
timeout: 86400s
|
||||
options:
|
||||
pool:
|
||||
name: ${_PRIVATE_POOL_NAME}
|
||||
|
||||
@@ -1,12 +1,13 @@
|
||||
ipython==7.31.0
|
||||
jupyter==1.0.0
|
||||
nbconvert==6.3.0
|
||||
papermill==2.3.3
|
||||
numpy==1.21.4
|
||||
pandas==1.3.5
|
||||
matplotlib==3.5.1
|
||||
ipython
|
||||
numpy
|
||||
jupyter
|
||||
nbconvert
|
||||
papermill
|
||||
pandas
|
||||
matplotlib
|
||||
tabulate
|
||||
google-cloud-aiplatform
|
||||
google-cloud-storage
|
||||
google-cloud-build
|
||||
gcloud
|
||||
ratemate
|
||||
GitPython
|
||||
@@ -0,0 +1,5 @@
|
||||
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
|
||||
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
|
||||
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
|
||||
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
|
||||
notebooks/official/matching_engine/sdk_matching_engine_for_indexing.ipynb
|
||||
@@ -0,0 +1 @@
|
||||
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
|
||||
@@ -13,8 +13,10 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
from nbconvert.preprocessors import Preprocessor
|
||||
from typing import Dict
|
||||
|
||||
from nbconvert.preprocessors import Preprocessor
|
||||
|
||||
from . import UpdateNotebookVariables as update_notebook_variables
|
||||
|
||||
|
||||
@@ -60,4 +62,4 @@ class UpdateVariablesPreprocessor(Preprocessor):
|
||||
|
||||
executable_cells.append(cell)
|
||||
notebook.cells = executable_cells
|
||||
return notebook, resources
|
||||
return notebook, resources
|
||||
|
||||
@@ -35,8 +35,8 @@ Variables in conditionals can also be replaced:
|
||||
|
||||
def get_updated_value(content: str, variable_name: str, variable_value: str) -> str:
|
||||
return re.sub(
|
||||
rf"({variable_name}.*?=.*?[\",\'])\[.+?\]([\",\'].*?)",
|
||||
rf"\1{variable_value}\2",
|
||||
rf"({variable_name}.*? = .*?[\",\'])\[.+?\]([\",\'].*?)",
|
||||
rf"\g<1>{variable_value}\g<2>",
|
||||
content,
|
||||
flags=re.M,
|
||||
)
|
||||
@@ -78,4 +78,27 @@ def test_region():
|
||||
variable_name="REGION",
|
||||
variable_value="us-central1",
|
||||
)
|
||||
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
|
||||
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
|
||||
|
||||
|
||||
def test_region_equal_equals_ignore():
|
||||
# Tests that == is ignored
|
||||
new_content = get_updated_value(
|
||||
content='REGION == "[your-region]" # @param {type:"string"}',
|
||||
variable_name="REGION",
|
||||
variable_value="us-central1",
|
||||
)
|
||||
assert new_content == 'REGION == "[your-region]" # @param {type:"string"}'
|
||||
|
||||
|
||||
def test_service_account():
|
||||
# Tests that == is ignored
|
||||
new_content = get_updated_value(
|
||||
content='SERVICE_ACCOUNT = "[your-service-account]" # @param {type:"string"}',
|
||||
variable_name="SERVICE_ACCOUNT",
|
||||
variable_value="12345-compute@developer.gserviceaccount.com",
|
||||
)
|
||||
assert (
|
||||
new_content
|
||||
== 'SERVICE_ACCOUNT = "12345-compute@developer.gserviceaccount.com" # @param {type:"string"}'
|
||||
)
|
||||
|
||||
@@ -1,17 +1,17 @@
|
||||
from datetime import datetime
|
||||
from typing import Optional
|
||||
from google.cloud import storage
|
||||
from google.cloud.aiplatform import utils
|
||||
from google.auth import credentials as auth_credentials
|
||||
import os
|
||||
|
||||
import subprocess
|
||||
import tarfile
|
||||
import uuid
|
||||
from datetime import datetime
|
||||
from typing import Optional
|
||||
|
||||
from google.auth import credentials as auth_credentials
|
||||
from google.cloud import storage
|
||||
from google.cloud.aiplatform import utils
|
||||
|
||||
|
||||
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
|
||||
"""Copies a remote GCS file to a local path."""
|
||||
"""Copies a remote GCS file to a local path"""
|
||||
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
|
||||
|
||||
subprocess.check_output(
|
||||
@@ -25,7 +25,7 @@ def upload_file(
|
||||
local_file_path: str,
|
||||
remote_file_path: str,
|
||||
) -> str:
|
||||
"""Copies a local file to a GCS path."""
|
||||
"""Copies a local file to a GCS path"""
|
||||
subprocess.check_output(
|
||||
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
|
||||
)
|
||||
@@ -57,4 +57,4 @@ def archive_code_and_upload(staging_bucket: str):
|
||||
|
||||
print(f"Uploaded source code archive to {source_archived_file_gcs}")
|
||||
|
||||
return source_archived_file_gcs
|
||||
return source_archived_file_gcs
|
||||
|
||||
@@ -1,18 +1,28 @@
|
||||
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
|
||||
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.
|
||||
|
||||
<br>
|
||||
--- YOUR PR SUMMARY GOES HERE ---
|
||||
<br><br><br>
|
||||
|
||||
**REQUIRED:** Fill out the below checklists or remove if irrelevant
|
||||
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
|
||||
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
|
||||
- [ ] Follow the style and grammar rules outlined in the above notebook template.
|
||||
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
|
||||
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
|
||||
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
|
||||
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
|
||||
|
||||
<br>
|
||||
|
||||
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
|
||||
2. If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
|
||||
|
||||
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
|
||||
<br>
|
||||
|
||||
3. If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
|
||||
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
|
||||
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
|
||||
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
|
||||
|
||||
@@ -7,9 +7,11 @@ jobs:
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Set up Python
|
||||
uses: actions/setup-python@v2
|
||||
uses: actions/setup-python@v4
|
||||
with:
|
||||
python-version: '3.x'
|
||||
- name: Fetch pull request branch
|
||||
uses: actions/checkout@v2
|
||||
uses: actions/checkout@v3
|
||||
with:
|
||||
fetch-depth: 0
|
||||
- name: Fetch base main branch
|
||||
|
||||
@@ -2,8 +2,9 @@ git+https://github.com/tensorflow/docs
|
||||
ipython
|
||||
jupyter
|
||||
nbconvert
|
||||
black==21.10b0
|
||||
pyupgrade==2.29.1
|
||||
black==22.6.0
|
||||
pyupgrade==2.34.0
|
||||
isort==5.10.1
|
||||
flake8==4.0.1
|
||||
nbqa==1.2.2
|
||||
nbqa==1.4.0
|
||||
|
||||
|
||||
@@ -68,7 +68,7 @@ if [ ${#notebooks[@]} -gt 0 ]; then
|
||||
|
||||
if [ "$is_test" = true ]; then
|
||||
echo "Running nbfmt..."
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs --test "$notebook"
|
||||
python3 -m tensorflow_docs.tools.nbfmt --test "$notebook"
|
||||
NBFMT_RTN=$?
|
||||
# echo "Running black..."
|
||||
# python3 -m nbqa black "$notebook" --check
|
||||
@@ -84,19 +84,19 @@ if [ ${#notebooks[@]} -gt 0 ]; then
|
||||
FLAKE8_RTN=$?
|
||||
else
|
||||
echo "Running black..."
|
||||
python3 -m nbqa black "$notebook" --nbqa-mutate
|
||||
python3 -m nbqa black "$notebook"
|
||||
BLACK_RTN=$?
|
||||
echo "Running pyupgrade..."
|
||||
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
|
||||
python3 -m nbqa pyupgrade "$notebook"
|
||||
PYUPGRADE_RTN=$?
|
||||
echo "Running isort..."
|
||||
python3 -m nbqa isort "$notebook" --nbqa-mutate
|
||||
python3 -m nbqa isort "$notebook"
|
||||
ISORT_RTN=$?
|
||||
echo "Running nbfmt..."
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
|
||||
python3 -m tensorflow_docs.tools.nbfmt "$notebook"
|
||||
NBFMT_RTN=$?
|
||||
echo "Running flake8..."
|
||||
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291 --nbqa-mutate
|
||||
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
|
||||
FLAKE8_RTN=$?
|
||||
fi
|
||||
|
||||
|
||||
@@ -48,8 +48,8 @@ then you will need to manually address them before submitting your PR.
|
||||
nbqa black "$notebook"
|
||||
nbqa pyupgrade "$notebook"
|
||||
nbqa isort "$notebook"
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
|
||||
nbqa flake8 "$notebook" --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
|
||||
```
|
||||
|
||||
## Code Reviews
|
||||
|
||||
@@ -6,7 +6,19 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
|
||||
|
||||
## Overview
|
||||
|
||||
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [Community Content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
|
||||
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
|
||||
|
||||
## Repository structure
|
||||
|
||||
```bash
|
||||
├── community-content - Sample code and tutorials contributed by the community
|
||||
├── notebooks
|
||||
│ ├── community - Notebooks contributed by the community
|
||||
│ ├── official - Notebooks demonstrating use of each Vertex AI service
|
||||
│ │ ├── automl
|
||||
│ │ ├── custom
|
||||
│ │ ├── ...
|
||||
```
|
||||
|
||||
## Contributing
|
||||
|
||||
@@ -19,3 +31,7 @@ Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-sa
|
||||
## Disclaimer
|
||||
|
||||
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
|
||||
|
||||
## Feedback
|
||||
|
||||
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
|
||||
|
||||
@@ -1,4 +1,7 @@
|
||||
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
|
||||
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
|
||||
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
|
||||
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
|
||||
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
|
||||
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
|
||||
/pluto_on_workbench @wkharold
|
||||
/cpr-examples @samthrasher
|
||||
|
||||
@@ -0,0 +1,824 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "pc5-mbsX9PZC"
|
||||
},
|
||||
"source": [
|
||||
"# AlphaFold On Vertex AI Workbench\n",
|
||||
"\n",
|
||||
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
|
||||
"\n",
|
||||
"##  [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
|
||||
"\n",
|
||||
"**Differences to AlphaFold v2.1.0**\n",
|
||||
"\n",
|
||||
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
|
||||
"\n",
|
||||
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
|
||||
"\n",
|
||||
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
|
||||
"\n",
|
||||
"**Citing this work**\n",
|
||||
"\n",
|
||||
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
|
||||
"\n",
|
||||
"**Licenses**\n",
|
||||
"\n",
|
||||
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"**More information**\n",
|
||||
"\n",
|
||||
"You can find more information about how AlphaFold works in the following papers:\n",
|
||||
"\n",
|
||||
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
|
||||
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
|
||||
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
|
||||
"\n",
|
||||
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "b7a02613eb1a"
|
||||
},
|
||||
"source": [
|
||||
"## Download AlphaFold Data"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "woIxeCPygt7K"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import os\n",
|
||||
"import subprocess\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"import alphafold.common\n",
|
||||
"import tqdm.notebook\n",
|
||||
"from IPython.utils import io\n",
|
||||
"\n",
|
||||
"TQDM_BAR_FORMAT = (\n",
|
||||
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"SOURCE_URL = (\n",
|
||||
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
|
||||
")\n",
|
||||
"PARAMS_DIR = \"alphafold/data/params\"\n",
|
||||
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
|
||||
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
|
||||
"\n",
|
||||
"try:\n",
|
||||
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
|
||||
" with io.capture_output() as captured:\n",
|
||||
"\n",
|
||||
" # Download and store stereo_chemical_props.txt\n",
|
||||
" !mkdir -p ~/content/alphafold/alphafold/common\n",
|
||||
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
|
||||
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
|
||||
" pbar.update(18)\n",
|
||||
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
|
||||
"\n",
|
||||
" # Download alphafold_params_colab_2021-10-27.tar\n",
|
||||
" !mkdir --parents \"{PARAMS_DIR}\"\n",
|
||||
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
|
||||
" pbar.update(27)\n",
|
||||
"\n",
|
||||
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
|
||||
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
|
||||
" # !rm \"{PARAMS_PATH}\"\n",
|
||||
" pbar.update(55)\n",
|
||||
"\n",
|
||||
"except subprocess.CalledProcessError:\n",
|
||||
" print(captured)\n",
|
||||
" raise"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "d8926b7d5529"
|
||||
},
|
||||
"source": [
|
||||
"## Configure GPU Acceleration"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "VzJ5iMjTtoZw"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Confirm accelerator configuration\n",
|
||||
"import jax\n",
|
||||
"\n",
|
||||
"if jax.local_devices()[0].platform == \"tpu\":\n",
|
||||
" raise RuntimeError(\n",
|
||||
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
|
||||
" )\n",
|
||||
"elif jax.local_devices()[0].platform == \"cpu\":\n",
|
||||
" print(\n",
|
||||
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
|
||||
" )\n",
|
||||
"else:\n",
|
||||
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
|
||||
"\n",
|
||||
"# Make sure all necessary environment variables are set.\n",
|
||||
"import os\n",
|
||||
"\n",
|
||||
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
|
||||
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "W4JpOs6oA-QS"
|
||||
},
|
||||
"source": [
|
||||
"## Making a prediction\n",
|
||||
"\n",
|
||||
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
|
||||
"\n",
|
||||
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
|
||||
"\n",
|
||||
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
|
||||
"\n",
|
||||
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "b310d44229d0"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Input sequences (type: str)\n",
|
||||
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
|
||||
"sequence_2 = \"\"\n",
|
||||
"sequence_3 = \"\"\n",
|
||||
"sequence_4 = \"\"\n",
|
||||
"sequence_5 = \"\"\n",
|
||||
"sequence_6 = \"\"\n",
|
||||
"sequence_7 = \"\"\n",
|
||||
"sequence_8 = \"\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "rowN0bVYLe9n"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from alphafold.notebooks import notebook_utils\n",
|
||||
"\n",
|
||||
"input_sequences = (\n",
|
||||
" sequence_1,\n",
|
||||
" sequence_2,\n",
|
||||
" sequence_3,\n",
|
||||
" sequence_4,\n",
|
||||
" sequence_5,\n",
|
||||
" sequence_6,\n",
|
||||
" sequence_7,\n",
|
||||
" sequence_8,\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# If folding a complex target and all the input sequences are\n",
|
||||
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
|
||||
"# otherwise or if the origin is unknown.\n",
|
||||
"\n",
|
||||
"is_prokaryote = False # @param {type:\"boolean\"}\n",
|
||||
"\n",
|
||||
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
|
||||
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
|
||||
"MAX_MULTIMER_LENGTH = 2500\n",
|
||||
"\n",
|
||||
"# Validate the input.\n",
|
||||
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
|
||||
" input_sequences=input_sequences,\n",
|
||||
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
|
||||
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
|
||||
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "db551d4877ea"
|
||||
},
|
||||
"source": [
|
||||
"## Search against genetic databases\n",
|
||||
"\n",
|
||||
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "2tTeTTsLKPjB"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import collections\n",
|
||||
"import copy\n",
|
||||
"import random\n",
|
||||
"from concurrent import futures\n",
|
||||
"from urllib import request\n",
|
||||
"\n",
|
||||
"import matplotlib.pyplot as plt\n",
|
||||
"import numpy as np\n",
|
||||
"import py3Dmol\n",
|
||||
"from alphafold.common import protein\n",
|
||||
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
|
||||
" pipeline_multimer)\n",
|
||||
"from alphafold.data.tools import jackhmmer\n",
|
||||
"from alphafold.model import config, data, model\n",
|
||||
"from alphafold.relax import relax, utils\n",
|
||||
"from IPython import display\n",
|
||||
"from ipywidgets import GridspecLayout, Output\n",
|
||||
"\n",
|
||||
"# Color bands for visualizing plddt\n",
|
||||
"PLDDT_BANDS = [\n",
|
||||
" (0, 50, \"#FF7D45\"),\n",
|
||||
" (50, 70, \"#FFDB13\"),\n",
|
||||
" (70, 90, \"#65CBF3\"),\n",
|
||||
" (90, 100, \"#0053D6\"),\n",
|
||||
"]\n",
|
||||
"\n",
|
||||
"# --- Find the closest source ---\n",
|
||||
"test_url_pattern = (\n",
|
||||
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
|
||||
")\n",
|
||||
"ex = futures.ThreadPoolExecutor(3)\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def fetch(source):\n",
|
||||
" request.urlretrieve(test_url_pattern.format(source))\n",
|
||||
" return source\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
|
||||
"source = None\n",
|
||||
"for f in futures.as_completed(fs):\n",
|
||||
" source = f.result()\n",
|
||||
" ex.shutdown()\n",
|
||||
" break\n",
|
||||
"\n",
|
||||
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
|
||||
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
|
||||
"# The z_value is the number of sequences in a database.\n",
|
||||
"MSA_DATABASES = [\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"uniref90\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 59,\n",
|
||||
" \"z_value\": 135_301_051,\n",
|
||||
" },\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"smallbfd\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 17,\n",
|
||||
" \"z_value\": 65_984_053,\n",
|
||||
" },\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"mgnify\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 71,\n",
|
||||
" \"z_value\": 304_820_129,\n",
|
||||
" },\n",
|
||||
"]\n",
|
||||
"\n",
|
||||
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
|
||||
" MSA_DATABASES.extend(\n",
|
||||
" [\n",
|
||||
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"uniprot\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 98,\n",
|
||||
" \"z_value\": 219_174_961 + 565_254,\n",
|
||||
" },\n",
|
||||
" ]\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
|
||||
"\n",
|
||||
"MAX_HITS = {\n",
|
||||
" \"uniref90\": 10_000,\n",
|
||||
" \"smallbfd\": 5_000,\n",
|
||||
" \"mgnify\": 501,\n",
|
||||
" \"uniprot\": 50_000,\n",
|
||||
"}\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def get_msa(fasta_path):\n",
|
||||
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
|
||||
"\n",
|
||||
" # Run the search against chunks of genetic databases.\n",
|
||||
" raw_msa_results = collections.defaultdict(list)\n",
|
||||
" with tqdm.notebook.tqdm(\n",
|
||||
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
|
||||
" ) as pbar:\n",
|
||||
"\n",
|
||||
" def jackhmmer_chunk_callback(i):\n",
|
||||
" pbar.update(n=1)\n",
|
||||
"\n",
|
||||
" for db_config in MSA_DATABASES:\n",
|
||||
" db_name = db_config[\"db_name\"]\n",
|
||||
" pbar.set_description(f\"Searching {db_name}\")\n",
|
||||
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
|
||||
" binary_path=JACKHMMER_BINARY_PATH,\n",
|
||||
" database_path=db_config[\"db_path\"],\n",
|
||||
" get_tblout=True,\n",
|
||||
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
|
||||
" streaming_callback=jackhmmer_chunk_callback,\n",
|
||||
" z_value=db_config[\"z_value\"],\n",
|
||||
" )\n",
|
||||
" # Group the results by database name.\n",
|
||||
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
|
||||
"\n",
|
||||
" return raw_msa_results\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"features_for_chain = {}\n",
|
||||
"raw_msa_results_for_sequence = {}\n",
|
||||
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
|
||||
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
|
||||
"\n",
|
||||
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
|
||||
" with open(fasta_path, \"wt\") as f:\n",
|
||||
" f.write(f\">query\\n{sequence}\")\n",
|
||||
"\n",
|
||||
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
|
||||
" if sequence not in raw_msa_results_for_sequence:\n",
|
||||
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
|
||||
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
|
||||
" else:\n",
|
||||
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
|
||||
"\n",
|
||||
" # Extract the MSAs from the Stockholm files.\n",
|
||||
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
|
||||
" single_chain_msas = []\n",
|
||||
" uniprot_msa = None\n",
|
||||
" for db_name, db_results in raw_msa_results.items():\n",
|
||||
" merged_msa = notebook_utils.merge_chunked_msa(\n",
|
||||
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
|
||||
" )\n",
|
||||
" if merged_msa.sequences and db_name != \"uniprot\":\n",
|
||||
" single_chain_msas.append(merged_msa)\n",
|
||||
" msa_size = len(set(merged_msa.sequences))\n",
|
||||
" print(\n",
|
||||
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
|
||||
" )\n",
|
||||
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
|
||||
" uniprot_msa = merged_msa\n",
|
||||
"\n",
|
||||
" notebook_utils.show_msa_info(\n",
|
||||
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Turn the raw data into model features.\n",
|
||||
" feature_dict = {}\n",
|
||||
" feature_dict.update(\n",
|
||||
" pipeline.make_sequence_features(\n",
|
||||
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
|
||||
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
|
||||
" feature_dict.update(\n",
|
||||
" notebook_utils.empty_placeholder_template_features(\n",
|
||||
" num_templates=0, num_res=len(sequence)\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Construct the all_seq features only for heteromers, not homomers.\n",
|
||||
" if (\n",
|
||||
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
|
||||
" and len(set(sequences)) > 1\n",
|
||||
" ):\n",
|
||||
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
|
||||
" \"msa_uniprot_accession_identifiers\",\n",
|
||||
" \"msa_species_identifiers\",\n",
|
||||
" )\n",
|
||||
" all_seq_features = {\n",
|
||||
" f\"{k}_all_seq\": v\n",
|
||||
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
|
||||
" if k in valid_feats\n",
|
||||
" }\n",
|
||||
" feature_dict.update(all_seq_features)\n",
|
||||
"\n",
|
||||
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Do further feature post-processing depending on the model type.\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
|
||||
"\n",
|
||||
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" all_chain_features = {}\n",
|
||||
" for chain_id, chain_features in features_for_chain.items():\n",
|
||||
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
|
||||
" chain_features, chain_id\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
|
||||
"\n",
|
||||
" np_example = feature_processing.pair_and_merge(\n",
|
||||
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Pad MSA to avoid zero-sized extra_msa.\n",
|
||||
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9640643486bd"
|
||||
},
|
||||
"source": [
|
||||
"## Run AlphaFold\n",
|
||||
"\n",
|
||||
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "XUo6foMQxwS2"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"run_relax = True\n",
|
||||
"\n",
|
||||
"# --- Run the model ---\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
|
||||
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
|
||||
"\n",
|
||||
"output_dir = \"prediction\"\n",
|
||||
"os.makedirs(output_dir, exist_ok=True)\n",
|
||||
"\n",
|
||||
"plddts = {}\n",
|
||||
"ranking_confidences = {}\n",
|
||||
"pae_outputs = {}\n",
|
||||
"unrelaxed_proteins = {}\n",
|
||||
"\n",
|
||||
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
|
||||
" for model_name in model_names:\n",
|
||||
" pbar.set_description(f\"Running {model_name}\")\n",
|
||||
"\n",
|
||||
" cfg = config.model_config(model_name)\n",
|
||||
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" cfg.data.eval.num_ensemble = 1\n",
|
||||
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" cfg.model.num_ensemble_eval = 1\n",
|
||||
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
|
||||
" model_runner = model.RunModel(cfg, params)\n",
|
||||
" processed_feature_dict = model_runner.process_features(\n",
|
||||
" np_example, random_seed=0\n",
|
||||
" )\n",
|
||||
" prediction = model_runner.predict(\n",
|
||||
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" mean_plddt = prediction[\"plddt\"].mean()\n",
|
||||
"\n",
|
||||
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" if \"predicted_aligned_error\" in prediction:\n",
|
||||
" pae_outputs[model_name] = (\n",
|
||||
" prediction[\"predicted_aligned_error\"],\n",
|
||||
" prediction[\"max_predicted_aligned_error\"],\n",
|
||||
" )\n",
|
||||
" else:\n",
|
||||
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
|
||||
" # should never get selected.\n",
|
||||
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
|
||||
" plddts[model_name] = prediction[\"plddt\"]\n",
|
||||
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" # Multimer models are sorted by pTM+ipTM.\n",
|
||||
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
|
||||
" plddts[model_name] = prediction[\"plddt\"]\n",
|
||||
" pae_outputs[model_name] = (\n",
|
||||
" prediction[\"predicted_aligned_error\"],\n",
|
||||
" prediction[\"max_predicted_aligned_error\"],\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Set the b-factors to the per-residue plddt.\n",
|
||||
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
|
||||
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
|
||||
" unrelaxed_protein = protein.from_prediction(\n",
|
||||
" processed_feature_dict,\n",
|
||||
" prediction,\n",
|
||||
" b_factors=b_factors,\n",
|
||||
" remove_leading_feature_dimension=(\n",
|
||||
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
|
||||
" ),\n",
|
||||
" )\n",
|
||||
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
|
||||
"\n",
|
||||
" # Delete unused outputs to save memory.\n",
|
||||
" del model_runner\n",
|
||||
" del params\n",
|
||||
" del prediction\n",
|
||||
" pbar.update(n=1)\n",
|
||||
"\n",
|
||||
" # --- AMBER relax the best model ---\n",
|
||||
"\n",
|
||||
" # Find the best model according to the mean pLDDT.\n",
|
||||
" best_model_name = max(\n",
|
||||
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" if run_relax:\n",
|
||||
" pbar.set_description(\"AMBER relaxation\")\n",
|
||||
" amber_relaxer = relax.AmberRelaxation(\n",
|
||||
" max_iterations=0,\n",
|
||||
" tolerance=2.39,\n",
|
||||
" stiffness=10.0,\n",
|
||||
" exclude_residues=[],\n",
|
||||
" max_outer_iterations=3,\n",
|
||||
" )\n",
|
||||
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
|
||||
" prot=unrelaxed_proteins[best_model_name]\n",
|
||||
" )\n",
|
||||
" else:\n",
|
||||
" print(\"Warning: Running without the relaxation stage.\")\n",
|
||||
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
|
||||
" pbar.update(n=1) # Finished AMBER relax.\n",
|
||||
"\n",
|
||||
"# Construct multiclass b-factors to indicate confidence bands\n",
|
||||
"# 0=very low, 1=low, 2=confident, 3=very high\n",
|
||||
"banded_b_factors = []\n",
|
||||
"for plddt in plddts[best_model_name]:\n",
|
||||
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
|
||||
" if plddt >= min_val and plddt <= max_val:\n",
|
||||
" banded_b_factors.append(idx)\n",
|
||||
" break\n",
|
||||
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
|
||||
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Write out the prediction\n",
|
||||
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
|
||||
"with open(pred_output_path, \"w\") as f:\n",
|
||||
" f.write(relaxed_pdb)\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# --- Visualise the prediction & confidence ---\n",
|
||||
"show_sidechains = True\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def plot_plddt_legend():\n",
|
||||
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
|
||||
" thresh = [\n",
|
||||
" \"Very low (pLDDT < 50)\",\n",
|
||||
" \"Low (70 > pLDDT > 50)\",\n",
|
||||
" \"Confident (90 > pLDDT > 70)\",\n",
|
||||
" \"Very high (pLDDT > 90)\",\n",
|
||||
" ]\n",
|
||||
"\n",
|
||||
" colors = [x[2] for x in PLDDT_BANDS]\n",
|
||||
"\n",
|
||||
" plt.figure(figsize=(2, 2))\n",
|
||||
" for c in colors:\n",
|
||||
" plt.bar(0, 0, color=c)\n",
|
||||
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
|
||||
" plt.xticks([])\n",
|
||||
" plt.yticks([])\n",
|
||||
" ax = plt.gca()\n",
|
||||
" ax.spines[\"right\"].set_visible(False)\n",
|
||||
" ax.spines[\"top\"].set_visible(False)\n",
|
||||
" ax.spines[\"left\"].set_visible(False)\n",
|
||||
" ax.spines[\"bottom\"].set_visible(False)\n",
|
||||
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
|
||||
" return plt\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Show the structure coloured by chain if the multimer model has been used.\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" multichain_view = py3Dmol.view(width=800, height=600)\n",
|
||||
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
|
||||
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
|
||||
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
|
||||
" multichain_view.zoomTo()\n",
|
||||
" multichain_view.show()\n",
|
||||
"\n",
|
||||
"# Color the structure by per-residue pLDDT\n",
|
||||
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
|
||||
"view = py3Dmol.view(width=800, height=600)\n",
|
||||
"view.addModelsAsFrames(to_visualize_pdb)\n",
|
||||
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
|
||||
"if show_sidechains:\n",
|
||||
" style[\"stick\"] = {}\n",
|
||||
"view.setStyle({\"model\": -1}, style)\n",
|
||||
"view.zoomTo()\n",
|
||||
"\n",
|
||||
"grid = GridspecLayout(1, 2)\n",
|
||||
"out = Output()\n",
|
||||
"with out:\n",
|
||||
" view.show()\n",
|
||||
"grid[0, 0] = out\n",
|
||||
"\n",
|
||||
"out = Output()\n",
|
||||
"with out:\n",
|
||||
" plot_plddt_legend().show()\n",
|
||||
"grid[0, 1] = out\n",
|
||||
"\n",
|
||||
"display.display(grid)\n",
|
||||
"\n",
|
||||
"# Display pLDDT and predicted aligned error (if output by the model).\n",
|
||||
"if pae_outputs:\n",
|
||||
" num_plots = 2\n",
|
||||
"else:\n",
|
||||
" num_plots = 1\n",
|
||||
"\n",
|
||||
"plt.figure(figsize=[8 * num_plots, 6])\n",
|
||||
"plt.subplot(1, num_plots, 1)\n",
|
||||
"plt.plot(plddts[best_model_name])\n",
|
||||
"plt.title(\"Predicted LDDT\")\n",
|
||||
"plt.xlabel(\"Residue\")\n",
|
||||
"plt.ylabel(\"pLDDT\")\n",
|
||||
"\n",
|
||||
"if num_plots == 2:\n",
|
||||
" plt.subplot(1, 2, 2)\n",
|
||||
" pae, max_pae = list(pae_outputs.values())[0]\n",
|
||||
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
|
||||
" plt.colorbar(fraction=0.046, pad=0.04)\n",
|
||||
"\n",
|
||||
" # Display lines at chain boundaries.\n",
|
||||
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
|
||||
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
|
||||
" chain_ids = best_unrelaxed_prot.chain_index\n",
|
||||
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
|
||||
" if chain_boundary.size:\n",
|
||||
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
|
||||
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
|
||||
"\n",
|
||||
" plt.title(\"Predicted Aligned Error\")\n",
|
||||
" plt.xlabel(\"Scored residue\")\n",
|
||||
" plt.ylabel(\"Aligned residue\")\n",
|
||||
"\n",
|
||||
"# Save the predicted aligned error (if it exists).\n",
|
||||
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
|
||||
"if pae_outputs:\n",
|
||||
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
|
||||
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
|
||||
" with open(pae_output_path, \"w\") as f:\n",
|
||||
" f.write(pae_data)\n",
|
||||
"\n",
|
||||
"!zip -q -r {output_dir}.zip {output_dir}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "lUQAn5LYC5n4"
|
||||
},
|
||||
"source": [
|
||||
"### Interpreting the prediction\n",
|
||||
"\n",
|
||||
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
|
||||
"\n",
|
||||
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "jeb2z8DIA4om"
|
||||
},
|
||||
"source": [
|
||||
"## FAQ & Troubleshooting\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"* How do I get a predicted protein structure for my protein?\n",
|
||||
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
|
||||
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
|
||||
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
|
||||
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
|
||||
"* How long will this take?\n",
|
||||
" * The search against genetic databases can take minutes to hours.\n",
|
||||
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
|
||||
"* My notebook no longer seems to be doing anything, what should I do?\n",
|
||||
" * Some steps may take minutes to hours to complete.\n",
|
||||
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
|
||||
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
|
||||
"* How does this compare to the open-source version of AlphaFold?\n",
|
||||
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
|
||||
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
|
||||
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
|
||||
"* Does this tool install anything on my computer?\n",
|
||||
" * No, everything happens in the VM instance within your Google Cloud project.\n",
|
||||
"* How should I share feedback and bug reports?\n",
|
||||
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## Related work\n",
|
||||
"\n",
|
||||
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
|
||||
"\n",
|
||||
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "YfPhvYgKC81B"
|
||||
},
|
||||
"source": [
|
||||
"# License and Disclaimer\n",
|
||||
"\n",
|
||||
"This is not an officially-supported Google product.\n",
|
||||
"\n",
|
||||
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
|
||||
"\n",
|
||||
"Copyright 2021 DeepMind Technologies Limited.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## AlphaFold Code License\n",
|
||||
"\n",
|
||||
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
|
||||
"\n",
|
||||
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
|
||||
"\n",
|
||||
"## Model Parameters License\n",
|
||||
"\n",
|
||||
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## Third-party software\n",
|
||||
"\n",
|
||||
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## Mirrored Databases\n",
|
||||
"\n",
|
||||
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
|
||||
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
|
||||
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
|
||||
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
|
||||
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
|
||||
]
|
||||
}
|
||||
],
|
||||
"metadata": {
|
||||
"accelerator": "GPU",
|
||||
"colab": {
|
||||
"collapsed_sections": [],
|
||||
"name": "AlphaFold.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
"kernelspec": {
|
||||
"display_name": "Python 3",
|
||||
"name": "python3"
|
||||
}
|
||||
},
|
||||
"nbformat": 4,
|
||||
"nbformat_minor": 0
|
||||
}
|
||||
@@ -0,0 +1,82 @@
|
||||
# Copyright 2022 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
ARG CUDA_MAJOR=11
|
||||
ARG CUDA_MINOR=0
|
||||
|
||||
FROM gcr.io/deeplearning-platform-release/base-cu110
|
||||
|
||||
ARG CUDA_MAJOR
|
||||
ARG CUDA_MINOR
|
||||
|
||||
SHELL ["/bin/bash", "-c"]
|
||||
|
||||
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
|
||||
build-essential \
|
||||
cmake \
|
||||
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
|
||||
git \
|
||||
hmmer \
|
||||
kalign \
|
||||
tzdata \
|
||||
wget \
|
||||
&& rm -rf /var/lib/apt/lists/*
|
||||
|
||||
# Compile HHsuite from source.
|
||||
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
|
||||
&& mkdir /tmp/hh-suite/build \
|
||||
&& pushd /tmp/hh-suite/build \
|
||||
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
|
||||
&& make -j 4 && make install \
|
||||
&& ln -s /opt/hhsuite/bin/* /usr/bin \
|
||||
&& popd \
|
||||
&& rm -rf /tmp/hh-suite
|
||||
|
||||
ENV PATH="/opt/conda/bin:$PATH"
|
||||
RUN conda update -qy conda \
|
||||
&& conda install -y -c conda-forge \
|
||||
openmm=7.5.1 \
|
||||
cudatoolkit==${CUDA_VERSION} \
|
||||
pdbfixer \
|
||||
pip \
|
||||
python=3.7
|
||||
|
||||
COPY . /app/alphafold
|
||||
|
||||
# Install pip packages.
|
||||
RUN pip3 install --upgrade pip \
|
||||
&& pip3 install -r /app/alphafold/requirements.txt \
|
||||
&& pip3 install py3Dmol tqdm \
|
||||
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
|
||||
https://storage.googleapis.com/jax-releases/jax_releases.html
|
||||
|
||||
# Install alphafold.
|
||||
WORKDIR /app/alphafold
|
||||
RUN python setup.py install
|
||||
|
||||
# Apply OpenMM patch.
|
||||
WORKDIR /opt/conda/lib/python3.7/site-packages
|
||||
RUN patch -p0 < /app/alphafold/docker/openmm.patch
|
||||
|
||||
# Creating a tmp location for jackhmmr; not mounting through to host though.
|
||||
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
|
||||
|
||||
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
|
||||
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
|
||||
# details.
|
||||
# ENTRYPOINT does not support easily running multiple commands, so instead we
|
||||
# write a shell script to wrap them up.
|
||||
WORKDIR /home/jupyter
|
||||
RUN echo '#!/bin/bash\nldconfig\n\'
|
||||
|
||||
@@ -0,0 +1,20 @@
|
||||
#!/usr/bin/env bash
|
||||
set -e
|
||||
|
||||
# Prod (Publicly viewable)
|
||||
PROJECT=cloud-devrel-public-resources
|
||||
REPOSITORY=alphafold
|
||||
LOCAL_IMAGE=alphafold-on-gcp
|
||||
REMOTE_IMAGE=${LOCAL_IMAGE?}
|
||||
TAG=latest
|
||||
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
|
||||
|
||||
git clone https://github.com/deepmind/alphafold.git
|
||||
|
||||
cp Dockerfile alphafold/docker/Dockerfile
|
||||
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
|
||||
|
||||
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
|
||||
|
||||
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
|
||||
sudo docker push ${REGISTRY?}
|
||||
|
After Width: | Height: | Size: 3.1 KiB |
@@ -0,0 +1,5 @@
|
||||
testdata/*
|
||||
build.py
|
||||
test.py
|
||||
state_dict.pth
|
||||
config.json
|
||||
@@ -0,0 +1,5 @@
|
||||
cpr_model_server.py
|
||||
entrypoint.py
|
||||
state_dict.pth
|
||||
config.json
|
||||
**/__pycache__
|
||||
@@ -0,0 +1,93 @@
|
||||
# CPR Example: PyTorch Image Models (timm)
|
||||
|
||||
## About CPR
|
||||
|
||||
CPR ([custom prediction routines](https://github.com/googleapis/python-aiplatform/blob/custom-prediction-routine/google/cloud/aiplatform/prediction/README.md)) is a framework designed by Google Cloud developers to make it easier to combine machine learning models with custom preprocessing and postprocessing logic in a real-time serving application.
|
||||
|
||||
## Using this example
|
||||
|
||||
This code is a self-contained example of a custom model server project built using CPR.
|
||||
|
||||
As is, you can use it to serve the ViT-Small image classification model from Ross Wightman's [`timm`](https://github.com/rwightman/pytorch-image-models) library of image model implementations in PyTorch. Both CPU and GPU are supported.
|
||||
|
||||
You can also consider using the code here as a template for your own CPR project if you want to use a different model from `timm`, a different PyTorch model, or an entirely different framework.
|
||||
|
||||
### Requirements
|
||||
|
||||
In order to use this example, you'll need Docker and Python 3 installed on your system.
|
||||
|
||||
To get started, first create a virtual environment in an empty directory:
|
||||
```sh
|
||||
mkdir cpr-example
|
||||
python3 -m venv cpr-example
|
||||
cd cpr-example && source bin/activate
|
||||
```
|
||||
|
||||
Then, clone the [vertex-ai-samples repo](https://github.com/GoogleCloudPlatform/vertex-ai-samples) in that directory:
|
||||
```sh
|
||||
git clone https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
|
||||
cd vertex-ai-samples/community-content/cpr-examples/timm_serving
|
||||
```
|
||||
|
||||
Finally, install the Python modules required to build and run the model server:
|
||||
```sh
|
||||
pip install -r requirements.txt
|
||||
```
|
||||
|
||||
### Predictor
|
||||
|
||||
The `TimmPredictor` class in `timm_serving/predictor.py` implements most of the important logic for the server.
|
||||
|
||||
- `load(artifacts_dir)`: The predictor's `load` method is called when the server starts up in order to set up the predictor, usually by loading model weights and any artifacts needed for preprocessing and postprocessing. In this example, we initialize the saved model from the `state_dict.pth` file located inside the `artifacts_dir` folder and create the preprocessing transform from the model config.
|
||||
|
||||
- `preprocess`, `predict`, `postprocess`: These methods are applied in sequence to the deserialized JSON data from each request.
|
||||
- `preprocess` decodes images from base64 and apply cropping, scaling and normalizing transforms.
|
||||
- `predict` runs the ViT-Small model on the preprocessed images and returns class scores.
|
||||
- `postprocess` finds the top five classes and packs the class names, probabilities, and indices in a serializable result.
|
||||
|
||||
### Building the container
|
||||
|
||||
To build the model server locally, run the build command:
|
||||
```sh
|
||||
python build.py build
|
||||
```
|
||||
|
||||
You can edit configuration values such as the model server's base image, the name and tag assigned to the image, and the path where model weights are stored locally.
|
||||
|
||||
When you run the build command, model weights are downloaded and the model server container is built.
|
||||
|
||||
### Running local tests
|
||||
|
||||
`test.py` contains a suite of unit tests for the predictor as well as end-to-end tests for the model server.
|
||||
|
||||
To run the tests:
|
||||
```sh
|
||||
python test.py
|
||||
```
|
||||
|
||||
All of the test images are public domain.
|
||||
- [Cat](https://commons.wikimedia.org/wiki/File:Stray_cat_on_wall.jpg)
|
||||
- [Airplane](https://commons.wikimedia.org/wiki/File:Airplanes_jets.jpg)
|
||||
- The infamous [mandrill](https://commons.wikimedia.org/wiki/File:Wikipedia-sipi-image-db-mandrill-4.2.03.png)
|
||||
|
||||
### Deploying to Vertex AI
|
||||
|
||||
Before uploading or deploying the container, you'll need to modify `config.py` to set appropriate values for:
|
||||
- `project_id`: Your GCP project id.
|
||||
- `region`: Region where the model will be uploaded and deployed.
|
||||
- `repository`: [Artifact Registry repository](https://cloud.google.com/artifact-registry/docs/repositories/create-repos) in your project where the container image will be uploaded.
|
||||
- `artifacts_gcs_dir`: Folder in a [Google Cloud Storage bucket](https://cloud.google.com/storage/docs/creating-buckets) where the model weights will be uploaded.
|
||||
|
||||
Once this is done, first upload the model:
|
||||
```sh
|
||||
python build.py upload
|
||||
```
|
||||
|
||||
Then deploy it:
|
||||
```sh
|
||||
python build.py deploy
|
||||
```
|
||||
|
||||
If you run the deploy command again, it will create a new endpoint. If you want to undeploy the model, you can do so using the Vertex AI dashboard on the Google Cloud console, or use `gcloud ai endpoints undeploy` from the command line.
|
||||
|
||||
After deploying successfully, you can run `python build.py probe` to send a sample request to the deployed model.
|
||||
@@ -0,0 +1,117 @@
|
||||
# Copyright 2022 Google LLC
|
||||
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
|
||||
# https://www.apache.org/licenses/LICENSE-2.0
|
||||
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Build the model server container."""
|
||||
import json
|
||||
import logging
|
||||
import os
|
||||
import pathlib
|
||||
from typing import Sequence
|
||||
|
||||
from absl import app
|
||||
from absl import logging
|
||||
from config import CPRConfig
|
||||
from google.cloud import aiplatform
|
||||
from google.cloud.aiplatform import prediction as cpr
|
||||
import smart_open
|
||||
import timm
|
||||
from timm_serving import predictor
|
||||
import torch
|
||||
|
||||
|
||||
def build_container(config: CPRConfig, tag: str) -> cpr.LocalModel:
|
||||
"""Build the model server container.
|
||||
|
||||
Args:
|
||||
tag: Output image tag.
|
||||
|
||||
Returns:
|
||||
LocalModel exposing the built model server.
|
||||
"""
|
||||
return cpr.LocalModel.build_cpr_model(
|
||||
src_dir=os.path.join(os.getcwd()),
|
||||
output_image_uri=tag,
|
||||
base_image=config.base_image,
|
||||
predictor=predictor.TimmPredictor,
|
||||
requirements_path=os.path.join(os.getcwd(), "requirements.txt"),
|
||||
)
|
||||
|
||||
|
||||
def save_model_artifact(destination: str) -> None:
|
||||
"""Save a copy of the model state dict."""
|
||||
model = timm.create_model(predictor.TimmPredictor.TIMM_MODEL_NAME, pretrained=True)
|
||||
dest_file = os.path.join(destination, predictor.TimmPredictor.WEIGHTS_FILE)
|
||||
with smart_open.open(dest_file, "wb") as f:
|
||||
torch.save(model, f)
|
||||
logging.info("Saved model to %s", dest_file)
|
||||
logging.info("%s parameters", sum(p.numel() for p in model.parameters()))
|
||||
|
||||
|
||||
def upload_model(config: CPRConfig) -> aiplatform.Model:
|
||||
"""Tag and upload the model server."""
|
||||
ar_tag = (
|
||||
f"{config.region}-docker.pkg.dev/{config.project_id}"
|
||||
f"/{config.repository}/{config.image}"
|
||||
)
|
||||
local_model = build_container(config, tag=ar_tag)
|
||||
aiplatform.init(project=config.project_id, location=config.region)
|
||||
local_model.push_image()
|
||||
aip_model = aiplatform.Model.upload(
|
||||
local_model=local_model,
|
||||
display_name=predictor.TimmPredictor.TIMM_MODEL_NAME,
|
||||
artifact_uri=config.artifact_gcs_dir,
|
||||
)
|
||||
config.model_name = aip_model.resource_name
|
||||
config.save()
|
||||
return aip_model
|
||||
|
||||
|
||||
def deploy_model(config: CPRConfig) -> aiplatform.Endpoint:
|
||||
"""Deploy the model server to a Vertex Prediction endpoint."""
|
||||
aiplatform.init(project=config.project_id, location=config.region)
|
||||
aip_model = aiplatform.Model(model_name=config.model_name)
|
||||
endpoint = aip_model.deploy(machine_type=config.machine_type)
|
||||
config.endpoint_name = endpoint.resource_name
|
||||
config.save()
|
||||
return endpoint
|
||||
|
||||
|
||||
def probe_prediction(config: CPRConfig, request_path: str) -> None:
|
||||
"""Send a sample prediction request to the Vertex Prediction endpoint."""
|
||||
aiplatform.init(project=config.project_id, location=config.region)
|
||||
aip_endpoint = aiplatform.Endpoint(endpoint_name=config.endpoint_name)
|
||||
with open(request_path) as f:
|
||||
logging.info(aip_endpoint.predict(**json.load(f)))
|
||||
|
||||
|
||||
def main(argv: Sequence[str]):
|
||||
config = CPRConfig()
|
||||
if pathlib.Path(config.config_file).exists():
|
||||
config.load()
|
||||
|
||||
actions = set(argv[1:])
|
||||
if "build" in actions:
|
||||
build_container(config, config.image)
|
||||
save_model_artifact(config.artifact_local_dir)
|
||||
if "upload" in actions:
|
||||
save_model_artifact(config.artifact_gcs_dir)
|
||||
upload_model(config)
|
||||
if "deploy" in actions:
|
||||
deploy_model(config)
|
||||
if "probe" in actions:
|
||||
probe_prediction(config, request_path="sample_request.json")
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
app.run(main)
|
||||
@@ -0,0 +1,76 @@
|
||||
# Copyright 2022 Google LLC
|
||||
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
|
||||
# https://www.apache.org/licenses/LICENSE-2.0
|
||||
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
import dataclasses
|
||||
import json
|
||||
|
||||
|
||||
@dataclasses.dataclass
|
||||
class CPRConfig(object):
|
||||
"""Configure the build process by editing the default values here.
|
||||
|
||||
config_file: File path used to save values in this config. (Some
|
||||
values, such as the model name, are generated at build time and
|
||||
depended on by future steps, so saving it allows this script to
|
||||
deploy the model without re-uploading it, for example.)
|
||||
|
||||
base_image: Base Docker image on top of which the model server will
|
||||
be built. By default, a Debian-based Python 3 image without GPU
|
||||
support will be used.
|
||||
|
||||
image: Name and tag assigned to the built model server image.
|
||||
|
||||
artifact_local_dir: Local directory where a copy of the pretrained model weights
|
||||
will be saved.
|
||||
|
||||
region: Google Cloud Region where the model will be uploaded during the
|
||||
build process.
|
||||
|
||||
project_id: Google Cloud project ID.
|
||||
|
||||
repository: Name of the Artifact Registry repository where the container
|
||||
will be uploaded.
|
||||
|
||||
artifact_gcs_dir: Location on GCS where a copy of the pretrained model
|
||||
weights will be uploaded.
|
||||
|
||||
model_name: Full resource path of the uploaded model. This is a write-only
|
||||
field, the value is generated by Vertex AI when the model is uploaded.
|
||||
|
||||
endpoint_name: Full resource path of the created endpoint. This is a
|
||||
write-only field, the value is generated by Vertex AI when the model is
|
||||
deployed to an endpoint.
|
||||
|
||||
machine_type: Machine type to use when deploying the model.
|
||||
"""
|
||||
|
||||
config_file: str = "config.json"
|
||||
base_image: str = "python:3.10-bullseye"
|
||||
image: str = "timm_predictor:latest"
|
||||
artifact_local_dir: str = ""
|
||||
region: str = "us-central1"
|
||||
project_id: str = "samthrasher-experimental"
|
||||
repository: str = "cpr-images"
|
||||
artifact_gcs_dir: str = "gs://samthrasher-cpr-example/timm-vit224/"
|
||||
model_name: str = ""
|
||||
endpoint_name: str = ""
|
||||
machine_type: str = "n1-standard-2"
|
||||
|
||||
def save(self):
|
||||
with open(self.config_file, "w") as f:
|
||||
json.dump(dataclasses.asdict(self), f, indent=2)
|
||||
|
||||
def load(self):
|
||||
with open(self.config_file) as f:
|
||||
self.__init__(**json.load(f))
|
||||
@@ -0,0 +1,8 @@
|
||||
absl-py==1.1.0
|
||||
fastapi==0.75.2
|
||||
uvicorn==0.18.2
|
||||
timm==0.5.4
|
||||
smart_open==6.0.0
|
||||
|
||||
google-cloud-storage>=1.26.0,<2.0.0dev
|
||||
google-cloud-aiplatform[prediction] @ git+https://github.com/googleapis/python-aiplatform.git@custom-prediction-routine
|
||||
@@ -0,0 +1,249 @@
|
||||
"""Test the timm_serving predictor."""
|
||||
import base64
|
||||
import json
|
||||
import logging
|
||||
import os
|
||||
import pickle
|
||||
from typing import List, Dict
|
||||
|
||||
from absl import flags
|
||||
from absl import logging
|
||||
from absl.testing import absltest
|
||||
from config import CPRConfig
|
||||
import fastapi
|
||||
from google.cloud import aiplatform
|
||||
from google.cloud.aiplatform import prediction as cpr
|
||||
import PIL
|
||||
from timm_serving import predictor
|
||||
import torch
|
||||
|
||||
VIT_SMALL_PARAMS = 22878952
|
||||
|
||||
|
||||
def b64_encode_file(path: str) -> str:
|
||||
"""Encode a file's contents as base64.
|
||||
|
||||
Args:
|
||||
path: Path to the file.
|
||||
|
||||
Returns:
|
||||
Base64-encoded contents of the file.
|
||||
"""
|
||||
with open(path, "rb") as f:
|
||||
return str(base64.b64encode(f.read()), encoding="utf-8")
|
||||
|
||||
|
||||
def make_instance_dict(
|
||||
image_paths: List[str], base64_encodings: List[str]
|
||||
) -> Dict[str, List[str]]:
|
||||
"""Generate a dictionary similar to a parsed prediction server request.
|
||||
|
||||
Args:
|
||||
image_paths: Paths to image files to include.
|
||||
base64_encodings: Pre-encoded base64 strings.
|
||||
|
||||
Returns:
|
||||
Dictionary of instances in the format accepted by the preprocessor.
|
||||
"""
|
||||
instances = [s for s in base64_encodings]
|
||||
for path in image_paths:
|
||||
instances.append(b64_encode_file(path))
|
||||
return {"instances": instances}
|
||||
|
||||
|
||||
def count_parameters(model: torch.nn.Module):
|
||||
"""Count the parameters in a Pytorch model.
|
||||
|
||||
Args:
|
||||
model: Pytorch model (nn.Module).
|
||||
|
||||
Returns:
|
||||
Number of parameters in the model.
|
||||
|
||||
"""
|
||||
return sum(p.numel() for p in model.parameters())
|
||||
|
||||
|
||||
class PredictorUnitTests(absltest.TestCase):
|
||||
"""Unit tests for timm_serving.predictor."""
|
||||
|
||||
def setUp(self):
|
||||
super().setUp()
|
||||
self.config = CPRConfig()
|
||||
self.config.load()
|
||||
self.predictor = predictor.TimmPredictor()
|
||||
|
||||
def test_load_from_saved_state_dict_ok(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
self.assertEqual(count_parameters(self.predictor._model), VIT_SMALL_PARAMS)
|
||||
|
||||
def test_load_bad_path(self):
|
||||
with self.assertRaises(FileNotFoundError):
|
||||
self.predictor.load("testdata/")
|
||||
with self.assertRaisesRegex(ValueError, "not a directory"):
|
||||
self.predictor.load("blah")
|
||||
|
||||
def test_load_bad_data(self):
|
||||
with self.assertRaises(pickle.UnpicklingError):
|
||||
self.predictor.load("testdata/bad_model_1")
|
||||
with self.assertRaisesRegex(RuntimeError, "Invalid magic number"):
|
||||
self.predictor.load("testdata/bad_model_2")
|
||||
|
||||
def test_preprocess_ok(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = make_instance_dict(
|
||||
base64_encodings=[],
|
||||
image_paths=[
|
||||
"testdata/airplane.jpg",
|
||||
"testdata/mandrill.tiff",
|
||||
"testdata/mandrill.tiff",
|
||||
"testdata/cat_alpha.png",
|
||||
],
|
||||
)
|
||||
result = self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(result.size(), torch.Size([4, 3, 224, 224]))
|
||||
self.assertEqual(result.dtype, torch.float32)
|
||||
|
||||
def test_preprocess_no_instances(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess({})
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, 'must contain "instances"')
|
||||
|
||||
def test_preprocess_wrong_shape_instances(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = {"instances": [[b64_encode_file("testdata/mandrill.tiff")]]}
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, "not 'list'")
|
||||
|
||||
def test_preprocess_bad_base64(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = make_instance_dict(base64_encodings=["!@#$"], image_paths=[])
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, "[Bb]ase64")
|
||||
|
||||
def test_preprocess_not_image_data(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = make_instance_dict(
|
||||
base64_encodings=[], image_paths=["testdata/bad.jpg"]
|
||||
)
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, "image file")
|
||||
|
||||
def test_predict_ok(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
inputs = torch.zeros(size=[2, 3, 224, 224], dtype=torch.float32)
|
||||
if torch.cuda.device_count() > 0:
|
||||
inputs = inputs.cuda()
|
||||
result = self.predictor.predict(inputs)
|
||||
self.assertEqual(result.size(), torch.Size([2, 1000]))
|
||||
self.assertEqual(result.dtype, torch.float32)
|
||||
|
||||
def test_postprocess_ok(self):
|
||||
class_probs = torch.zeros(size=[2, 1000])
|
||||
class_probs[0, 0] = 1
|
||||
class_probs[1, 123] = 1
|
||||
result = self.predictor.postprocess(class_probs)
|
||||
predictions = result["predictions"]
|
||||
self.assertLen(predictions[0]["class_names"], 5)
|
||||
self.assertLen(predictions[0]["indices"], 5)
|
||||
self.assertLen(predictions[0]["probabilities"], 5)
|
||||
self.assertLen(predictions[1]["class_names"], 5)
|
||||
self.assertLen(predictions[1]["indices"], 5)
|
||||
self.assertLen(predictions[1]["probabilities"], 5)
|
||||
self.assertContainsSubsequence(predictions[0]["class_names"][0], "tench")
|
||||
self.assertContainsSubsequence(
|
||||
predictions[1]["class_names"][0], "spiny lobster"
|
||||
)
|
||||
|
||||
|
||||
class ServerEndToEndTests(absltest.TestCase):
|
||||
"""End-to-end tests for the model server, using LocalEndpoint."""
|
||||
|
||||
def setUp(self):
|
||||
super().setUp()
|
||||
self.config = CPRConfig()
|
||||
self.config.load()
|
||||
self.local_model = cpr.LocalModel(
|
||||
serving_container_spec=aiplatform.gapic.ModelContainerSpec(
|
||||
image_uri=self.config.image
|
||||
)
|
||||
)
|
||||
|
||||
self.local_endpoint = self.local_model.deploy_to_local_endpoint(
|
||||
artifact_uri=self.config.artifact_local_dir or os.getcwd()
|
||||
)
|
||||
self.local_endpoint.serve()
|
||||
|
||||
def tearDown(self):
|
||||
self.local_endpoint.stop()
|
||||
super().tearDown()
|
||||
|
||||
def test_e2e_healthcheck_ok(self):
|
||||
health_check_response = self.local_endpoint.run_health_check()
|
||||
self.assertEqual(health_check_response.status_code, 200)
|
||||
self.assertEqual(health_check_response.content, b"{}")
|
||||
|
||||
def test_e2e_predict_ok(self):
|
||||
predict_request = json.dumps(
|
||||
make_instance_dict(
|
||||
base64_encodings=[],
|
||||
image_paths=[
|
||||
"testdata/mandrill.tiff",
|
||||
],
|
||||
)
|
||||
)
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 200)
|
||||
predictions = response.json()["predictions"]
|
||||
self.assertContainsSubsequence(predictions[0]["class_names"][0], "baboon")
|
||||
|
||||
def test_e2e_predict_bad_json_returns_400(self):
|
||||
predict_request = "blah"
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
def test_e2e_predict_no_instances_returns_400(self):
|
||||
predict_request = json.dumps({})
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
def test_e2e_predict_bad_base64_returns_400(self):
|
||||
predict_request = json.dumps(
|
||||
make_instance_dict(base64_encodings=["blah"], image_paths=[])
|
||||
)
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
def test_e2e_predict_bad_image_returns_400(self):
|
||||
predict_request = json.dumps(
|
||||
make_instance_dict(base64_encodings=[], image_paths=["testdata/bad.jpg"])
|
||||
)
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
absltest.main()
|
||||
|
After Width: | Height: | Size: 30 KiB |
@@ -0,0 +1 @@
|
||||
some non-image data
|
||||
@@ -0,0 +1 @@
|
||||
some non-image data
|
||||
|
After Width: | Height: | Size: 348 KiB |
@@ -0,0 +1,178 @@
|
||||
# Copyright 2022 Google LLC
|
||||
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
|
||||
# https://www.apache.org/licenses/LICENSE-2.0
|
||||
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Adapts a pretrained TIMM image classification model to the CPR framework.
|
||||
|
||||
Documentation for the TIMM (Torch IMage Models) library is here:
|
||||
https://rwightman.github.io/pytorch-image-models/
|
||||
|
||||
Its source can also be found here:
|
||||
https://github.com/rwightman/pytorch-image-models
|
||||
"""
|
||||
|
||||
import base64
|
||||
import binascii
|
||||
import io
|
||||
import os
|
||||
from typing import Dict, List, Union
|
||||
|
||||
from fastapi import HTTPException
|
||||
from google.cloud.aiplatform import prediction as cpr
|
||||
from pathlib import Path
|
||||
import PIL
|
||||
import smart_open
|
||||
import timm
|
||||
import torch
|
||||
import torch.nn.functional as F
|
||||
|
||||
with open(Path(__file__).parent.absolute().joinpath("imagenet.txt")) as f:
|
||||
IMAGENET_CLASSES = f.read().splitlines()
|
||||
|
||||
|
||||
class TimmPredictor(cpr.predictor.Predictor):
|
||||
"""Predictor class for image models based on TIMM."""
|
||||
|
||||
TIMM_MODEL_NAME = os.getenv("TIMM_MODEL_NAME", default="vit_small_patch32_224")
|
||||
WEIGHTS_FILE = "state_dict.pth"
|
||||
NUM_TOP_CLASSES_TO_RETURN = 5
|
||||
|
||||
def __init__(self):
|
||||
self._cuda = torch.cuda.device_count() > 0
|
||||
|
||||
def load(self, artifacts_uri: str = ""):
|
||||
"""Initializes the model and preprocessing transforms.
|
||||
|
||||
Args:
|
||||
artifacts_uri: Directory where state dict is stored. Can be a
|
||||
GCS URI or local path.
|
||||
"""
|
||||
if artifacts_uri:
|
||||
artifact_path = os.path.join(artifacts_uri)
|
||||
if not (os.path.isdir(artifact_path) or artifact_path.startswith("gs://")):
|
||||
raise ValueError("Provided artifact_uri is not a directory.")
|
||||
else:
|
||||
artifact_path = os.getcwd()
|
||||
|
||||
artifact_path = os.path.join(artifact_path, self.WEIGHTS_FILE)
|
||||
with smart_open.open(artifact_path, "rb") as f:
|
||||
self._model = torch.load(f)
|
||||
|
||||
if self._cuda:
|
||||
self._model.cuda()
|
||||
|
||||
config = timm.data.resolve_data_config(model=self.TIMM_MODEL_NAME, args=[])
|
||||
self._transform = timm.data.create_transform(
|
||||
is_training=False, use_prefetcher=False, **config
|
||||
)
|
||||
|
||||
def preprocess(self, request_dict: Dict[str, List[str]]) -> torch.Tensor:
|
||||
"""Performs preprocessing.
|
||||
|
||||
By default, the server expects a request body consisting of a valid JSON
|
||||
object. This will be parsed by the handler before it's evaluated by the
|
||||
preprocess method.
|
||||
|
||||
Args:
|
||||
request_dict: Parsed request body. We expect that the input consists of
|
||||
a list of base64-encoded image files under the "instances" key. (Any
|
||||
image format that PIL.image.open can handle is okay.)
|
||||
|
||||
Returns:
|
||||
torch.Tensor containing the preprocessed images as a batch. If GPU is
|
||||
available, the result tensor will be stored on GPU.
|
||||
"""
|
||||
|
||||
if "instances" not in request_dict:
|
||||
raise HTTPException(
|
||||
status_code=400,
|
||||
detail='Request must contain "instances" as a top-level key.',
|
||||
)
|
||||
|
||||
tensors = []
|
||||
|
||||
for (i, image) in enumerate(request_dict["instances"]):
|
||||
# We use Base64 encoding to handle image data.
|
||||
# This is probably the best we can do while still using JSON input.
|
||||
# Overriding the input format requires building a custom Handler.
|
||||
try:
|
||||
image_bytes = base64.b64decode(image, validate=True)
|
||||
except (binascii.Error, TypeError) as e:
|
||||
raise HTTPException(
|
||||
status_code=400,
|
||||
detail=f"Base64 decoding of the input image at index {i} failed:"
|
||||
f" {str(e)}",
|
||||
)
|
||||
|
||||
try:
|
||||
pil_image = PIL.Image.open(io.BytesIO(image_bytes)).convert("RGB")
|
||||
except PIL.UnidentifiedImageError:
|
||||
raise HTTPException(
|
||||
status_code=400,
|
||||
detail=f"The input image at index {i} could not be identified as an"
|
||||
" image file.",
|
||||
)
|
||||
|
||||
tensors.append(self._transform(pil_image))
|
||||
|
||||
with torch.inference_mode():
|
||||
result = torch.stack(tensors)
|
||||
if self._cuda:
|
||||
result = result.cuda()
|
||||
return result
|
||||
|
||||
def predict(self, instances: torch.Tensor) -> torch.Tensor:
|
||||
"""Performs prediction.
|
||||
|
||||
Args:
|
||||
instances: torch.Tensor with type torch.float32 and shape
|
||||
[?, 3, 224, 224], containing the pre-processed input images.
|
||||
|
||||
Returns:
|
||||
Vector of scores with type torch.float32 and shape [?, 1000],
|
||||
representing the model's estimate of the likelihood that the
|
||||
input belongs to the Imagenet class with that index.
|
||||
"""
|
||||
with torch.inference_mode():
|
||||
class_scores = self._model(instances)
|
||||
return class_scores
|
||||
|
||||
def postprocess(
|
||||
self, class_scores: torch.Tensor
|
||||
) -> Dict[str, List[Dict[str, Union[str, int, float]]]]:
|
||||
"""Translate the model output into a classification result.
|
||||
|
||||
Args:
|
||||
class_scores: torch.Tensor with type torch.float32 and shape
|
||||
[?, 1000], containing the scores assigned to each class by
|
||||
the model.
|
||||
|
||||
Returns:
|
||||
Dictionary containing the list of classification results. Each
|
||||
classification result contains the probabilities, class names, and
|
||||
class indices of the classes with the top class scores as reported by
|
||||
the model.
|
||||
"""
|
||||
class_probs = F.softmax(class_scores, dim=1)
|
||||
top_k = class_probs.topk(self.NUM_TOP_CLASSES_TO_RETURN)
|
||||
top_k_values = top_k.values.numpy().tolist()
|
||||
top_k_indices = top_k.indices.numpy().tolist()
|
||||
predictions = [
|
||||
dict(
|
||||
probabilities=values,
|
||||
indices=indices,
|
||||
class_names=[IMAGENET_CLASSES[int(class_num)] for class_num in indices],
|
||||
)
|
||||
for (values, indices) in zip(top_k_values, top_k_indices)
|
||||
]
|
||||
return {"predictions": predictions}
|
||||
@@ -0,0 +1,52 @@
|
||||
# Overview
|
||||
*Pluto* is a programming environment for Julia, designed to be interactive and helpful. It provides a familiar notebook interface but it is not a Jupyter notebook. The biggest difference is that Pluto notebooks are reactive, changing a variable or function in one cell causes the cells that depend on that variable or function to be reevaluated. Pluto also provides useful interaction mechanisms that allow users to dynamically interact with the notebooks computation state.
|
||||
|
||||
The JuliaCon 2020 presentation: [Interactive notebooks ~ Pluto.jl]() provides a good introduction to Pluto. The source is at [fonsp/Pluto.jl]()
|
||||
|
||||
# Install Pluto
|
||||
|
||||
## Create a Vertex AI JupyterLab Instance
|
||||
|
||||
1. From the [GCP console](https://console.cloud.google.com) "hamburger menu"
|
||||
|
||||
select Vertex AI > Workbench
|
||||
2. Click NEW NOTEBOOK
|
||||
|
||||
* Choose Python 3 if you won't be using a GPU
|
||||
* Choose Python 3 (CUDA Toolkit xx.y) if you do want use a GPU
|
||||
3. Give the notebook an appropriate name
|
||||
4. Edit Notebook properties if you have special requirements otherwise accept the defaults and click CREATE
|
||||
5. When the notebook instance is ready click OPEN JUPYTERLAB
|
||||
|
||||
## Configure JupyterLab
|
||||
|
||||
1. Open a terminal by clicking the Terminal icon.
|
||||
1. Install the plutoserver
|
||||
pip3 install git+https://github.com/fonsp/pluto-on-jupyterlab.git
|
||||
1. In a browser go to [julialang.org/downloads](https://julialang.org/downloads/)
|
||||
1. In the Current stable release right click on the `Generic Linux on x86 / 64-bit (glibc)` link
|
||||
Select copy link address
|
||||
1. Back in the terminal switch to root via
|
||||
sudo -i
|
||||
1. Download the release to /opt and install julia in /usr/local/bin
|
||||
```bash
|
||||
cd /opt
|
||||
wget <paste the release link address>
|
||||
tar xf <name of the downloaded tar file>
|
||||
ln -s /opt/<julia-x.y.z>/bin/julia /usr/local/bin
|
||||
^d
|
||||
```
|
||||
1. Add the Pluto package to Julia
|
||||
```bash
|
||||
julia
|
||||
julia> ]add Pluto
|
||||
julia> bksp
|
||||
julia> using Pluto
|
||||
julia> ^d
|
||||
```
|
||||
1. From the JupyterLab menu bar select File > Shut Down
|
||||
|
||||
# Start Pluto
|
||||
1. Click OPEN JUPYTERLAB in the Workbench
|
||||
1. In the Notebook section of the Launcher click Pluto.jl
|
||||
1. The welcome to Pluto.jl screen should appear
|
||||
@@ -1,474 +0,0 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a6b56b1c7b76"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
"# You may obtain a copy of the License at\n",
|
||||
"#\n",
|
||||
"# https://www.apache.org/licenses/LICENSE-2.0\n",
|
||||
"#\n",
|
||||
"# Unless required by applicable law or agreed to in writing, software\n",
|
||||
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
|
||||
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
|
||||
"# See the License for the specific language governing permissions and\n",
|
||||
"# limitations under the License."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "c414a395a19b"
|
||||
},
|
||||
"source": [
|
||||
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on CPU using Vertex Training with Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "b98238e32cf7"
|
||||
},
|
||||
"source": [
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "03d216c7f7b1"
|
||||
},
|
||||
"source": [
|
||||
"## Setup"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c5ac73516218"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
|
||||
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
|
||||
"REGION = \"YOUR REGION\"\n",
|
||||
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0b5ae674177e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "19a9b3bdd553"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "57bf6f8b4361"
|
||||
},
|
||||
"source": [
|
||||
"## Local Training"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "e5d8a3443da0"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! ls trainer"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "07f79309472d"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! cat trainer/requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "e16cd8bb7483"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install -r trainer/requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0b8a210718c4"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! cat trainer/task.py"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c0c6e7dfb3c6"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"%run trainer/task.py --epochs 5 --no-cuda --local-mode"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "31dfdeede587"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! ls ./tmp"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "48d56ec621cc"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! rm -rf ./tmp"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "8f3ea1210749"
|
||||
},
|
||||
"source": [
|
||||
"## Vertex Training using Vertex SDK and Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "93002a20a2a6"
|
||||
},
|
||||
"source": [
|
||||
"### Build Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "4130ce43fd08"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"hostname = \"gcr.io\"\n",
|
||||
"image_name = content_name\n",
|
||||
"tag = \"latest\"\n",
|
||||
"\n",
|
||||
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "2f1fc5b05240"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! cd trainer && docker build -t $custom_container_image_uri -f Dockerfile ."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "b4f274f499ac"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! docker run --rm $custom_container_image_uri --epochs 5 --no-cuda --local-mode"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "ee1a0a06d0b4"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! docker push $custom_container_image_uri"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "cb763be12fc9"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gcloud container images list --repository $hostname/$PROJECT_ID"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "10c8cc6b3334"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "1a12348169fa"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install -r requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "42e981cefe41"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud import aiplatform\n",
|
||||
"\n",
|
||||
"aiplatform.init(\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" staging_bucket=BUCKET_NAME,\n",
|
||||
" location=REGION,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "73c92c9298e9"
|
||||
},
|
||||
"source": [
|
||||
"### Create a Vertex Tensorboard Instance"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "bde509558cd5"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = content_name + \"-cpu\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "6d7908c0083c"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"tensorboard = aiplatform.Tensorboard.create(\n",
|
||||
" display_name=content_name,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "a1f0a4f54037"
|
||||
},
|
||||
"source": [
|
||||
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
|
||||
"\n",
|
||||
"```\n",
|
||||
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
|
||||
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
|
||||
"```"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "a4cac84e04ac"
|
||||
},
|
||||
"source": [
|
||||
"### Run a Vertex SDK CustomContainerTrainingJob"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "f92e8fdd44ee"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"display_name = content_name\n",
|
||||
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
|
||||
"\n",
|
||||
"replica_count = 4\n",
|
||||
"machine_type = \"n1-standard-4\"\n",
|
||||
"\n",
|
||||
"args = [\n",
|
||||
" \"--backend\",\n",
|
||||
" \"gloo\",\n",
|
||||
" \"--no-cuda\",\n",
|
||||
" \"--batch-size\",\n",
|
||||
" \"128\",\n",
|
||||
" \"--epochs\",\n",
|
||||
" \"25\",\n",
|
||||
"]"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "ae4c57df7e07"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
|
||||
" display_name=display_name,\n",
|
||||
" container_uri=custom_container_image_uri,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "35cf3ecdf0df"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job.run(\n",
|
||||
" args=args,\n",
|
||||
" base_output_dir=gcs_output_uri_prefix,\n",
|
||||
" replica_count=replica_count,\n",
|
||||
" machine_type=machine_type,\n",
|
||||
" tensorboard=tensorboard.resource_name,\n",
|
||||
" service_account=SERVICE_ACCOUNT,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "49d10dded73b"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
|
||||
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "78398f52807b"
|
||||
},
|
||||
"source": [
|
||||
"### Training Output Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "fc74422de1d1"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls $gcs_output_uri_prefix"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5e99a6a05b10"
|
||||
},
|
||||
"source": [
|
||||
"## Clean Up Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "b0c1b3f7466b"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil rm -rf $gcs_output_uri_prefix"
|
||||
]
|
||||
}
|
||||
],
|
||||
"metadata": {
|
||||
"colab": {
|
||||
"name": "multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
"kernelspec": {
|
||||
"display_name": "Python 3",
|
||||
"name": "python3"
|
||||
}
|
||||
},
|
||||
"nbformat": 4,
|
||||
"nbformat_minor": 0
|
||||
}
|
||||
@@ -1,347 +0,0 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a6b56b1c7b76"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
"# You may obtain a copy of the License at\n",
|
||||
"#\n",
|
||||
"# https://www.apache.org/licenses/LICENSE-2.0\n",
|
||||
"#\n",
|
||||
"# Unless required by applicable law or agreed to in writing, software\n",
|
||||
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
|
||||
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
|
||||
"# See the License for the specific language governing permissions and\n",
|
||||
"# limitations under the License."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "20a5ea0081d0"
|
||||
},
|
||||
"source": [
|
||||
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "8752d4a255fb"
|
||||
},
|
||||
"source": [
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "03d216c7f7b1"
|
||||
},
|
||||
"source": [
|
||||
"## Setup"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c5ac73516218"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
|
||||
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
|
||||
"REGION = \"YOUR REGION\"\n",
|
||||
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0b5ae674177e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "19a9b3bdd553"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5307fe28b633"
|
||||
},
|
||||
"source": [
|
||||
"## Vertex Training using Vertex SDK and Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "46cb58c7fbf9"
|
||||
},
|
||||
"source": [
|
||||
"### Built Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "97e66e9f9bab"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"hostname = \"gcr.io\"\n",
|
||||
"image_name = content_name\n",
|
||||
"tag = \"latest\"\n",
|
||||
"\n",
|
||||
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "ae9b29c4773f"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "dc1e84d5dec2"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install -r requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "6964be27b98e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud import aiplatform\n",
|
||||
"\n",
|
||||
"aiplatform.init(\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" staging_bucket=BUCKET_NAME,\n",
|
||||
" location=REGION,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "594a91f438f2"
|
||||
},
|
||||
"source": [
|
||||
"### Create a Vertex Tensorboard Instance"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "93134273261e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = content_name + \"-gpu\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c2bd82dbcd9b"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"tensorboard = aiplatform.Tensorboard.create(\n",
|
||||
" display_name=content_name,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "ebc593c6472e"
|
||||
},
|
||||
"source": [
|
||||
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
|
||||
"\n",
|
||||
"```\n",
|
||||
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
|
||||
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
|
||||
"```"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "0769e8e34c2f"
|
||||
},
|
||||
"source": [
|
||||
"### Run a Vertex SDK CustomContainerTrainingJob"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "023f33ece826"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"display_name = content_name\n",
|
||||
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
|
||||
"\n",
|
||||
"replica_count = 1\n",
|
||||
"machine_type = \"n1-standard-4\"\n",
|
||||
"accelerator_count = 4\n",
|
||||
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
|
||||
"\n",
|
||||
"args = [\n",
|
||||
" \"--backend\",\n",
|
||||
" \"nccl\",\n",
|
||||
" \"--batch-size\",\n",
|
||||
" \"128\",\n",
|
||||
" \"--epochs\",\n",
|
||||
" \"25\",\n",
|
||||
"]"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "d4b599e726ef"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
|
||||
" display_name=display_name,\n",
|
||||
" container_uri=custom_container_image_uri,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "81321e3bdf7f"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job.run(\n",
|
||||
" args=args,\n",
|
||||
" base_output_dir=gcs_output_uri_prefix,\n",
|
||||
" replica_count=replica_count,\n",
|
||||
" machine_type=machine_type,\n",
|
||||
" accelerator_count=accelerator_count,\n",
|
||||
" accelerator_type=accelerator_type,\n",
|
||||
" tensorboard=tensorboard.resource_name,\n",
|
||||
" service_account=SERVICE_ACCOUNT,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "5100712c2c4c"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
|
||||
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "f9b77676e5a6"
|
||||
},
|
||||
"source": [
|
||||
"### Training Output Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0e171ce95ace"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls $gcs_output_uri_prefix"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "cf1b74a12b87"
|
||||
},
|
||||
"source": [
|
||||
"## Clean Up Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a0b15089c341"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil rm -rf $gcs_output_uri_prefix"
|
||||
]
|
||||
}
|
||||
],
|
||||
"metadata": {
|
||||
"colab": {
|
||||
"name": "multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
"kernelspec": {
|
||||
"display_name": "Python 3",
|
||||
"name": "python3"
|
||||
}
|
||||
},
|
||||
"nbformat": 4,
|
||||
"nbformat_minor": 0
|
||||
}
|
||||
@@ -1,6 +1,6 @@
|
||||
# PyTorch on Google Cloud: Text Classification
|
||||
|
||||
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
|
||||
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
|
||||
|
||||
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
|
||||
|
||||
@@ -9,6 +9,7 @@ This tutorial on text classification shows how to train a PyTorch based text cla
|
||||
| <h4>Notebook</h4> | <h4>Description</h4> |
|
||||
| :-------- | :------- |
|
||||
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
|
||||
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
|
||||
|
||||
## Folders
|
||||
|
||||
|
||||
@@ -1,6 +1,7 @@
|
||||
|
||||
# Use pytorch GPU base image
|
||||
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
|
||||
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
|
||||
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
|
||||
|
||||
# set working directory
|
||||
WORKDIR /app
|
||||
|
||||
@@ -22,15 +22,18 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
|
||||
|
||||
# BUCKET_NAME: Change to your bucket name.
|
||||
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
|
||||
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
|
||||
|
||||
# validate bucket name
|
||||
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
|
||||
then
|
||||
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
|
||||
exit 1
|
||||
fi
|
||||
|
||||
# JOB_NAME: the name of your job running on AI Platform.
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
|
||||
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
|
||||
|
||||
# This can be a GCS location to a zipped and uploaded package
|
||||
PACKAGE_PATH=./trainer
|
||||
|
||||
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
|
||||
# or use the default '`us-central1`'. The region is where the job will be run.
|
||||
REGION="us-central1"
|
||||
@@ -41,11 +44,8 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
|
||||
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
|
||||
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
|
||||
|
||||
# IMAGE_TAG: an easily identifiable tag for your docker image
|
||||
IMAGE_TAG=latest
|
||||
|
||||
# IMAGE_URI: the complete URI location for Cloud Container Registry
|
||||
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
|
||||
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
|
||||
|
||||
# Build the docker image
|
||||
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
|
||||
@@ -53,11 +53,19 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
|
||||
# Deploy the docker image to Cloud Container Registry
|
||||
docker push ${CUSTOM_TRAIN_IMAGE_URI}
|
||||
|
||||
# worker pool spec
|
||||
worker_pool_spec="\
|
||||
replica-count=1,\
|
||||
machine-type=n1-standard-8,\
|
||||
accelerator-type=NVIDIA_TESLA_V100,\
|
||||
accelerator-count=1,\
|
||||
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
|
||||
|
||||
# Submit Custom Job to Vertex AI
|
||||
gcloud beta ai custom-jobs create \
|
||||
--display-name=${JOB_NAME} \
|
||||
--region ${REGION} \
|
||||
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
|
||||
--worker-pool-spec="${worker_pool_spec}" \
|
||||
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
|
||||
|
||||
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
|
||||
|
||||
|
After Width: | Height: | Size: 45 KiB |
|
After Width: | Height: | Size: 37 KiB |
|
After Width: | Height: | Size: 76 KiB |
|
After Width: | Height: | Size: 74 KiB |
|
After Width: | Height: | Size: 248 KiB |
|
After Width: | Height: | Size: 38 KiB |
|
After Width: | Height: | Size: 123 KiB |
@@ -2,10 +2,13 @@
|
||||
FROM pytorch/torchserve:latest-cpu
|
||||
|
||||
# install dependencies
|
||||
RUN python3 -m pip install --upgrade pip
|
||||
RUN pip3 install transformers
|
||||
|
||||
USER model-server
|
||||
|
||||
# copy model artifacts, custom handler and other dependencies
|
||||
COPY ./custom_text_handler.py /home/model-server/
|
||||
COPY ./custom_handler.py /home/model-server/
|
||||
COPY ./index_to_name.json /home/model-server/
|
||||
COPY ./model/finetuned-bert-classifier/ /home/model-server/
|
||||
|
||||
@@ -21,7 +24,7 @@ EXPOSE 7080
|
||||
EXPOSE 7081
|
||||
|
||||
# create model archive file packaging model artifacts and dependencies
|
||||
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
|
||||
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
|
||||
|
||||
# run Torchserve HTTP serve to respond to prediction requests
|
||||
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
|
||||
|
||||
@@ -0,0 +1,37 @@
|
||||
|
||||
FROM pytorch/torchserve:latest-cpu
|
||||
|
||||
USER root
|
||||
# run and update some basic packages software packages, including security libs
|
||||
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
|
||||
|
||||
# Install gcloud tools for gsutil as well as debugging
|
||||
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
|
||||
|
||||
USER model-server
|
||||
|
||||
# install dependencies
|
||||
RUN python3 -m pip install --upgrade pip
|
||||
RUN pip3 install transformers
|
||||
|
||||
ARG MODEL_NAME=finetuned-bert-classifier
|
||||
ENV MODEL_NAME="${MODEL_NAME}"
|
||||
|
||||
# health and prediction listener ports
|
||||
ARG AIP_HTTP_PORT=7080
|
||||
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
|
||||
|
||||
ARG MODEL_MGMT_PORT=7081
|
||||
|
||||
# expose health and prediction listener ports from the image
|
||||
EXPOSE "${AIP_HTTP_PORT}"
|
||||
EXPOSE "${MODEL_MGMT_PORT}"
|
||||
EXPOSE 8080 8081 8082 7070 7071
|
||||
|
||||
# create torchserve configuration file
|
||||
USER root
|
||||
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
|
||||
USER model-server
|
||||
|
||||
# run Torchserve HTTP serve to respond to prediction requests
|
||||
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
|
||||
@@ -52,7 +52,8 @@ class TransformersClassifierHandler(BaseHandler):
|
||||
with open(mapping_file_path) as f:
|
||||
self.mapping = json.load(f)
|
||||
else:
|
||||
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
|
||||
logger.warning('Missing the index_to_name.json file. Inference output will default.')
|
||||
self.mapping = {"0": "Negative", "1": "Positive"}
|
||||
|
||||
self.initialized = True
|
||||
|
||||
@@ -88,4 +89,3 @@ class TransformersClassifierHandler(BaseHandler):
|
||||
|
||||
def postprocess(self, inference_output):
|
||||
return inference_output
|
||||
|
||||
@@ -19,13 +19,19 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
|
||||
|
||||
# BUCKET_NAME: Change to your bucket name
|
||||
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
|
||||
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
|
||||
|
||||
# validate bucket name
|
||||
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
|
||||
then
|
||||
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
|
||||
exit 1
|
||||
fi
|
||||
|
||||
# The PyTorch image provided by Vertex AI Training.
|
||||
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
|
||||
|
||||
# JOB_NAME: the name of your job running on Vertex AI.
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
|
||||
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
|
||||
|
||||
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
|
||||
@@ -35,19 +41,21 @@ REGION="us-central1"
|
||||
# JOB_DIR: Where to store prepared package and upload output model.
|
||||
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
|
||||
|
||||
# validate bucket name
|
||||
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
|
||||
then
|
||||
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
|
||||
exit 1
|
||||
fi
|
||||
# worker pool spec
|
||||
worker_pool_spec="\
|
||||
replica-count=1,\
|
||||
machine-type=n1-standard-8,\
|
||||
accelerator-type=NVIDIA_TESLA_V100,\
|
||||
accelerator-count=1,\
|
||||
executor-image-uri=${IMAGE_URI},\
|
||||
python-module=trainer.task,\
|
||||
local-package-path=../python_package/"
|
||||
|
||||
# Submit Custom Job to Vertex AI
|
||||
gcloud beta ai custom-jobs create \
|
||||
--display-name=${JOB_NAME} \
|
||||
--region ${REGION} \
|
||||
--python-package-uris=${PACKAGE_PATH} \
|
||||
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
|
||||
--worker-pool-spec="${worker_pool_spec}" \
|
||||
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
|
||||
|
||||
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
|
||||
|
||||
@@ -122,6 +122,9 @@ def run(args):
|
||||
# Train / Test the model
|
||||
trainer = train(args, text_classifier, train_dataset, test_dataset)
|
||||
|
||||
metrics = trainer.evaluate(eval_dataset=test_dataset)
|
||||
trainer.save_metrics("all", metrics)
|
||||
|
||||
# Export the trained model
|
||||
trainer.save_model(os.path.join("/tmp", args.model_name))
|
||||
|
||||
|
||||
@@ -63,20 +63,20 @@
|
||||
"- [Training](#Training)\n",
|
||||
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
|
||||
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
|
||||
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
|
||||
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
|
||||
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
|
||||
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
|
||||
"- [Tuning](#Hyperparameter-Tuning) \n",
|
||||
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
|
||||
"- [Deploying](#Deploying)\n",
|
||||
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
|
||||
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
|
||||
"\n",
|
||||
"### Costs \n",
|
||||
"\n",
|
||||
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
|
||||
"\n",
|
||||
"* [Notebooks](https://cloud.google.com/notebooks)\n",
|
||||
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
|
||||
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
|
||||
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
|
||||
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
|
||||
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
|
||||
"* [Cloud Storage](https://cloud.google.com/storage)\n",
|
||||
"* [Container Registry](https://cloud.google.com/container-registry)\n",
|
||||
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
|
||||
@@ -202,9 +202,9 @@
|
||||
"id": "e0c1dcadc2c8"
|
||||
},
|
||||
"source": [
|
||||
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
|
||||
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
|
||||
"\n",
|
||||
"#### Install Vertex SDK for Python"
|
||||
"#### Install Vertex AI SDK for Python"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -658,8 +658,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"datasets = load_dataset(\"imdb\")\n",
|
||||
"datasets"
|
||||
"dataset = load_dataset(\"imdb\")\n",
|
||||
"dataset"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -668,7 +668,7 @@
|
||||
"id": "RzfPtOMoIrIu"
|
||||
},
|
||||
"source": [
|
||||
"The `datasets` object itself is [`DatasetDict`](https://huggingface.co/docs/datasets/package_reference/main_classes.html#datasetdict), which contains one key for the training, validation and test set."
|
||||
"The `dataset` object itself is [`DatasetDict`](https://huggingface.co/docs/datasets/package_reference/main_classes.html#datasetdict), which contains one key for the training, validation and test set."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -681,12 +681,12 @@
|
||||
"source": [
|
||||
"print(\n",
|
||||
" \"Total # of rows in training dataset {} and size {:5.2f} MB\".format(\n",
|
||||
" datasets[\"train\"].shape[0], datasets[\"train\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" dataset[\"train\"].shape[0], dataset[\"train\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" )\n",
|
||||
")\n",
|
||||
"print(\n",
|
||||
" \"Total # of rows in test dataset {} and size {:5.2f} MB\".format(\n",
|
||||
" datasets[\"test\"].shape[0], datasets[\"test\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" dataset[\"test\"].shape[0], dataset[\"test\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" )\n",
|
||||
")"
|
||||
]
|
||||
@@ -708,7 +708,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"datasets[\"train\"][0]"
|
||||
"dataset[\"train\"][0]"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -728,7 +728,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"label_list = datasets[\"train\"].unique(\"label\")\n",
|
||||
"label_list = dataset[\"train\"].unique(\"label\")\n",
|
||||
"label_list"
|
||||
]
|
||||
},
|
||||
@@ -779,7 +779,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"show_random_elements(datasets[\"train\"])"
|
||||
"show_random_elements(dataset[\"train\"])"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -883,7 +883,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"example = datasets[\"train\"][4]\n",
|
||||
"example = dataset[\"train\"][4]\n",
|
||||
"print(example)"
|
||||
]
|
||||
},
|
||||
@@ -920,7 +920,7 @@
|
||||
"source": [
|
||||
"# Dataset loading repeated here to make this cell idempotent\n",
|
||||
"# Since we are over-writing datasets variable\n",
|
||||
"datasets = load_dataset(\"imdb\")\n",
|
||||
"dataset = load_dataset(\"imdb\")\n",
|
||||
"\n",
|
||||
"# Mapping labels to ids\n",
|
||||
"# NOTE: We can extract this automatically but the `Unique` method of the datasets\n",
|
||||
@@ -948,7 +948,7 @@
|
||||
"\n",
|
||||
"\n",
|
||||
"# apply preprocessing function to input examples\n",
|
||||
"datasets = datasets.map(preprocess_function, batched=True, load_from_cache_file=True)"
|
||||
"dataset = dataset.map(preprocess_function, batched=True, load_from_cache_file=True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1091,8 +1091,8 @@
|
||||
"trainer = Trainer(\n",
|
||||
" model,\n",
|
||||
" args,\n",
|
||||
" train_dataset=datasets[\"train\"],\n",
|
||||
" eval_dataset=datasets[\"test\"],\n",
|
||||
" train_dataset=dataset[\"train\"],\n",
|
||||
" eval_dataset=dataset[\"test\"],\n",
|
||||
" data_collator=default_data_collator,\n",
|
||||
" tokenizer=tokenizer,\n",
|
||||
" compute_metrics=compute_metrics,\n",
|
||||
@@ -1199,7 +1199,7 @@
|
||||
"source": [
|
||||
"### Run predictions locally with sample examples\n",
|
||||
"\n",
|
||||
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
|
||||
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1382,7 +1382,7 @@
|
||||
"id": "f7466d414a0e"
|
||||
},
|
||||
"source": [
|
||||
"### Run Custom Job on Vertex Training with a pre-built container"
|
||||
"### Run Custom Job on Vertex AI Training with a pre-built container"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1395,7 +1395,7 @@
|
||||
"\n",
|
||||
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1569,7 +1569,7 @@
|
||||
"source": [
|
||||
"#### **Run custom training job on Vertex AI**\n",
|
||||
"\n",
|
||||
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
|
||||
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1578,7 +1578,7 @@
|
||||
"id": "5d2957ef04fd"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1598,7 +1598,7 @@
|
||||
"id": "6b0fed34b728"
|
||||
},
|
||||
"source": [
|
||||
"##### **Configure and submit Custom Job to Vertex Training service**"
|
||||
"##### **Configure and submit Custom Job to Vertex AI Training service**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1609,7 +1609,7 @@
|
||||
"source": [
|
||||
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
|
||||
"\n",
|
||||
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
|
||||
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1686,7 +1686,7 @@
|
||||
"\n",
|
||||
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1798,7 +1798,7 @@
|
||||
"id": "c170d386492b"
|
||||
},
|
||||
"source": [
|
||||
"### Run Custom Job on Vertex Training with custom container"
|
||||
"### Run Custom Job on Vertex AI Training with custom container"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1807,7 +1807,7 @@
|
||||
"id": "035227b6e581"
|
||||
},
|
||||
"source": [
|
||||
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
|
||||
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
|
||||
"\n",
|
||||
""
|
||||
]
|
||||
@@ -1834,7 +1834,7 @@
|
||||
"%%writefile ./custom_container/Dockerfile\n",
|
||||
"\n",
|
||||
"# Use pytorch GPU base image\n",
|
||||
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
|
||||
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
|
||||
"\n",
|
||||
"# set working directory\n",
|
||||
"WORKDIR /app\n",
|
||||
@@ -1968,7 +1968,7 @@
|
||||
"id": "a23e5e34bea9"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1988,11 +1988,11 @@
|
||||
"id": "abf1fa4085cb"
|
||||
},
|
||||
"source": [
|
||||
"##### **Configure and submit Custom Job to Vertex Training service**\n",
|
||||
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
|
||||
"\n",
|
||||
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
|
||||
"\n",
|
||||
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
|
||||
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2044,7 +2044,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# submit the custom job to Vertex training service\n",
|
||||
"# submit the custom job to Vertex AI training service\n",
|
||||
"model = job.run(\n",
|
||||
" replica_count=1,\n",
|
||||
" machine_type=\"n1-standard-8\",\n",
|
||||
@@ -2065,7 +2065,7 @@
|
||||
"\n",
|
||||
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2148,11 +2148,11 @@
|
||||
"id": "ba6122f929e3"
|
||||
},
|
||||
"source": [
|
||||
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
|
||||
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
|
||||
"\n",
|
||||
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
|
||||
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2163,7 +2163,7 @@
|
||||
"source": [
|
||||
"### How hyperparameter tuning works in Vertex AI?\n",
|
||||
"\n",
|
||||
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
|
||||
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
|
||||
"\n",
|
||||
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
|
||||
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
|
||||
@@ -2297,7 +2297,7 @@
|
||||
"source": [
|
||||
"### Run Hyperparameter Tuning Job on Vertex AI\n",
|
||||
"\n",
|
||||
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
|
||||
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2326,7 +2326,7 @@
|
||||
"id": "f60fab07d67c"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2346,7 +2346,7 @@
|
||||
"id": "6652aa63ddff"
|
||||
},
|
||||
"source": [
|
||||
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
|
||||
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
|
||||
"\n",
|
||||
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
|
||||
"\n",
|
||||
@@ -2374,7 +2374,7 @@
|
||||
"id": "9d46db3a8b23"
|
||||
},
|
||||
"source": [
|
||||
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
|
||||
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2548,7 +2548,7 @@
|
||||
"\n",
|
||||
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2557,7 +2557,7 @@
|
||||
"id": "ba934b434f03"
|
||||
},
|
||||
"source": [
|
||||
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
|
||||
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2612,7 +2612,7 @@
|
||||
"id": "5dbccb2b7d32"
|
||||
},
|
||||
"source": [
|
||||
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
|
||||
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2701,8 +2701,8 @@
|
||||
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
|
||||
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
|
||||
"\n",
|
||||
"# BUCKET_NAME: Change to your bucket name\n",
|
||||
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
|
||||
"# BUCKET_NAME is a required parameter to run the cell.\n",
|
||||
"BUCKET_NAME=$1\n",
|
||||
"\n",
|
||||
"# APP_NAME: get application name\n",
|
||||
"APP_NAME=$2\n",
|
||||
@@ -2711,7 +2711,7 @@
|
||||
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
|
||||
"\n",
|
||||
"# custom container image URI\n",
|
||||
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
|
||||
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
|
||||
"\n",
|
||||
"# ========================================================\n",
|
||||
"# create hyperparameter tuning configuration file\n",
|
||||
@@ -2772,20 +2772,20 @@
|
||||
"source": [
|
||||
"## Deploying\n",
|
||||
"\n",
|
||||
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
|
||||
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
|
||||
"\n",
|
||||
"### Deploying model on Vertex Predictions with custom container\n",
|
||||
"### Deploying model on Vertex AI Predictions with custom container\n",
|
||||
"\n",
|
||||
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
|
||||
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
|
||||
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
|
||||
"\n",
|
||||
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
|
||||
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
|
||||
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
|
||||
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
|
||||
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
|
||||
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
|
||||
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2815,7 +2815,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"%%writefile predictor/custom_text_handler.py\n",
|
||||
"%%writefile predictor/custom_handler.py\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import json\n",
|
||||
@@ -2870,7 +2870,8 @@
|
||||
" with open(mapping_file_path) as f:\n",
|
||||
" self.mapping = json.load(f)\n",
|
||||
" else:\n",
|
||||
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
|
||||
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
|
||||
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
|
||||
"\n",
|
||||
" self.initialized = True\n",
|
||||
"\n",
|
||||
@@ -3047,10 +3048,13 @@
|
||||
"FROM pytorch/torchserve:latest-cpu\n",
|
||||
"\n",
|
||||
"# install dependencies\n",
|
||||
"RUN python3 -m pip install --upgrade pip\n",
|
||||
"RUN pip3 install transformers\n",
|
||||
"\n",
|
||||
"USER model-server\n",
|
||||
"\n",
|
||||
"# copy model artifacts, custom handler and other dependencies\n",
|
||||
"COPY ./custom_text_handler.py /home/model-server/\n",
|
||||
"COPY ./custom_handler.py /home/model-server/\n",
|
||||
"COPY ./index_to_name.json /home/model-server/\n",
|
||||
"COPY ./model/$APP_NAME/ /home/model-server/\n",
|
||||
"\n",
|
||||
@@ -3070,7 +3074,7 @@
|
||||
" --model-name=$APP_NAME \\\n",
|
||||
" --version=1.0 \\\n",
|
||||
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
|
||||
" --handler=/home/model-server/custom_text_handler.py \\\n",
|
||||
" --handler=/home/model-server/custom_handler.py \\\n",
|
||||
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
|
||||
" --export-path=/home/model-server/model-store\n",
|
||||
"\n",
|
||||
@@ -3129,7 +3133,7 @@
|
||||
"source": [
|
||||
"#### **Run the container locally** ***[Optional]***\n",
|
||||
"\n",
|
||||
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
|
||||
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3267,9 +3271,9 @@
|
||||
"id": "69477b3a00c0"
|
||||
},
|
||||
"source": [
|
||||
"#### **Deploying the serving container to Vertex Predictions**\n",
|
||||
"#### **Deploying the serving container to Vertex AI Predictions**\n",
|
||||
"\n",
|
||||
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
|
||||
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3300,7 +3304,7 @@
|
||||
"id": "a3da91e19af4"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3437,7 +3441,7 @@
|
||||
"id": "bc4673478269"
|
||||
},
|
||||
"source": [
|
||||
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
|
||||
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3487,7 +3491,7 @@
|
||||
"source": [
|
||||
"##### **Formatting input for online prediction**\n",
|
||||
"\n",
|
||||
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
|
||||
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
|
||||
"\n",
|
||||
"```\n",
|
||||
"[\n",
|
||||
@@ -3560,9 +3564,9 @@
|
||||
},
|
||||
"source": [
|
||||
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
|
||||
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
|
||||
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
|
||||
"\n",
|
||||
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
|
||||
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3653,12 +3657,12 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"delete_custom_job = True\n",
|
||||
"delete_hp_tuning_job = True\n",
|
||||
"delete_custom_job = False\n",
|
||||
"delete_hp_tuning_job = False\n",
|
||||
"delete_endpoint = True\n",
|
||||
"delete_model = True\n",
|
||||
"delete_bucket = True\n",
|
||||
"delete_image = True"
|
||||
"delete_model = False\n",
|
||||
"delete_bucket = False\n",
|
||||
"delete_image = False"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3686,7 +3690,7 @@
|
||||
"\n",
|
||||
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
|
||||
"\n",
|
||||
"# Initialize Vertex SDK\n",
|
||||
"# Initialize Vertex AI SDK\n",
|
||||
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
|
||||
]
|
||||
},
|
||||
@@ -3924,7 +3928,7 @@
|
||||
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
|
||||
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
|
||||
"\n",
|
||||
" shell_output=! gsutil du -as $BUCKET_NAME\n",
|
||||
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
|
||||
" print(\n",
|
||||
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
|
||||
" )\n",
|
||||
@@ -3932,7 +3936,7 @@
|
||||
" # uncomment below line to delete contents of the bucket\n",
|
||||
" # ! gsutil rm -r $BUCKET_NAME\n",
|
||||
"\n",
|
||||
" shell_output=! gsutil du -as $BUCKET_NAME\n",
|
||||
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
|
||||
" if float(shell_output[0].split()[0]) > 0:\n",
|
||||
" print(\n",
|
||||
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
|
||||
|
||||
@@ -188,11 +188,14 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
|
||||
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
|
||||
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
|
||||
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade kfp\n",
|
||||
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade tensorflow"
|
||||
"! pip3 install {USER_FLAG} numpy\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade pillow\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade fastapi"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -287,7 +290,7 @@
|
||||
"\n",
|
||||
"# Get your Google Cloud project ID from gcloud\n",
|
||||
"if not os.getenv(\"IS_TESTING\"):\n",
|
||||
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" PROJECT_ID = shell_output[0]\n",
|
||||
" print(\"Project ID: \", PROJECT_ID)"
|
||||
]
|
||||
@@ -518,6 +521,7 @@
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"from google.cloud import aiplatform\n",
|
||||
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
|
||||
"from kfp.v2 import compiler, dsl\n",
|
||||
"from kfp.v2.google.client import AIPlatformClient"
|
||||
@@ -561,13 +565,34 @@
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "H3530hdGGilo"
|
||||
"id": "895ac243c125"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Dataset parameters\n",
|
||||
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
|
||||
"\n",
|
||||
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "62bfb9a820f6"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Download the sample data into your RAW_DATA_PATH\n",
|
||||
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "H3530hdGGilo"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Pipeline parameters\n",
|
||||
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
|
||||
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
|
||||
@@ -635,7 +660,7 @@
|
||||
"source": [
|
||||
"#### Run unit tests on the Generator component\n",
|
||||
"\n",
|
||||
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
|
||||
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -713,12 +738,12 @@
|
||||
"TRAINING_ARTIFACTS_DIR = (\n",
|
||||
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
|
||||
")\n",
|
||||
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
|
||||
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
|
||||
"TRAINING_MACHINE_TYPE = (\n",
|
||||
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
|
||||
")\n",
|
||||
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
|
||||
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
|
||||
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -769,8 +794,12 @@
|
||||
"TRAINED_POLICY_DISPLAY_NAME = (\n",
|
||||
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
|
||||
")\n",
|
||||
"TRAFFIC_SPLIT = {\"0\": 100}\n",
|
||||
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
|
||||
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
|
||||
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
|
||||
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
|
||||
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
|
||||
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -900,16 +929,17 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
|
||||
"from kfp.components import load_component_from_url\n",
|
||||
"\n",
|
||||
"generate_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
|
||||
")\n",
|
||||
"ingest_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
")\n",
|
||||
"train_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"\n",
|
||||
@@ -978,7 +1008,7 @@
|
||||
" bigquery_location=bigquery_location,\n",
|
||||
" bigquery_table_id=bigquery_table_id,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" \n",
|
||||
" # Run the Ingester component.\n",
|
||||
" ingest_task = ingest_op(\n",
|
||||
" project_id=project_id,\n",
|
||||
@@ -988,7 +1018,16 @@
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Run the Trainer component and submit custom job to Vertex AI.\n",
|
||||
" train_task = train_op(\n",
|
||||
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
|
||||
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
|
||||
" component_spec=train_op,\n",
|
||||
" replica_count=TRAINING_REPLICA_COUNT,\n",
|
||||
" machine_type=TRAINING_MACHINE_TYPE,\n",
|
||||
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" train_task = custom_job_training_op(\n",
|
||||
" training_artifacts_dir=training_artifacts_dir,\n",
|
||||
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
|
||||
" num_epochs=num_epochs,\n",
|
||||
@@ -996,28 +1035,10 @@
|
||||
" num_actions=num_actions,\n",
|
||||
" tikhonov_weight=tikhonov_weight,\n",
|
||||
" agent_alpha=agent_alpha,\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" location=REGION,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" worker_pool_specs = [\n",
|
||||
" {\n",
|
||||
" \"containerSpec\": {\n",
|
||||
" \"imageUri\": train_task.container.image,\n",
|
||||
" },\n",
|
||||
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
|
||||
" \"machineSpec\": {\n",
|
||||
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
|
||||
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" },\n",
|
||||
" },\n",
|
||||
" ]\n",
|
||||
" train_task.custom_job_spec = {\n",
|
||||
" \"displayName\": train_task.name,\n",
|
||||
" \"jobSpec\": {\n",
|
||||
" \"workerPoolSpecs\": worker_pool_specs,\n",
|
||||
" },\n",
|
||||
" }\n",
|
||||
"\n",
|
||||
" # Run the Deployer components.\n",
|
||||
" # Upload the trained policy as a model.\n",
|
||||
" model_upload_op = gcc_aip.ModelUploadOp(\n",
|
||||
@@ -1034,11 +1055,14 @@
|
||||
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
|
||||
" # has to occur after both model uploading and endpoint creation complete.)\n",
|
||||
" gcc_aip.ModelDeployOp(\n",
|
||||
" project=project_id,\n",
|
||||
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
|
||||
" model=model_upload_op.outputs[\"model\"],\n",
|
||||
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
|
||||
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" traffic_split=TRAFFIC_SPLIT,\n",
|
||||
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
|
||||
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
|
||||
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
|
||||
" )"
|
||||
]
|
||||
},
|
||||
@@ -1053,12 +1077,11 @@
|
||||
"# Compile the authored pipeline.\n",
|
||||
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
|
||||
"\n",
|
||||
"# Createa Vertex AI client.\n",
|
||||
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
|
||||
"\n",
|
||||
"# Create a pipeline run job.\n",
|
||||
"response = api_client.create_run_from_job_spec(\n",
|
||||
" job_spec_path=PIPELINE_SPEC_PATH,\n",
|
||||
"job = aiplatform.PipelineJob(\n",
|
||||
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
|
||||
" template_path=PIPELINE_SPEC_PATH,\n",
|
||||
" pipeline_root=PIPELINE_ROOT,\n",
|
||||
" parameter_values={\n",
|
||||
" # Pipeline configs\n",
|
||||
" \"project_id\": PROJECT_ID,\n",
|
||||
@@ -1070,7 +1093,9 @@
|
||||
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
|
||||
" },\n",
|
||||
" enable_caching=ENABLE_CACHING,\n",
|
||||
")"
|
||||
")\n",
|
||||
"\n",
|
||||
"job.run()"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1111,7 +1136,11 @@
|
||||
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
|
||||
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
|
||||
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
|
||||
")"
|
||||
")\n",
|
||||
"# TF-Agents RL configs\n",
|
||||
"BATCH_SIZE = 8\n",
|
||||
"RANK_K = 20\n",
|
||||
"NUM_ACTIONS = 20"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1221,7 +1250,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"endpoints = ! gcloud beta ai endpoints list \\\n",
|
||||
"endpoints = ! gcloud ai endpoints list \\\n",
|
||||
" --region=$REGION \\\n",
|
||||
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
|
||||
"print(\"\\n\".join(endpoints), \"\\n\")\n",
|
||||
@@ -1424,13 +1453,11 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from kfp.components import load_component_from_url\n",
|
||||
"\n",
|
||||
"ingest_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
")\n",
|
||||
"train_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"\n",
|
||||
@@ -1481,7 +1508,16 @@
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Run the Trainer component and submit custom job to Vertex AI.\n",
|
||||
" train_task = train_op(\n",
|
||||
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
|
||||
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
|
||||
" component_spec=train_op,\n",
|
||||
" replica_count=TRAINING_REPLICA_COUNT,\n",
|
||||
" machine_type=TRAINING_MACHINE_TYPE,\n",
|
||||
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" train_task = custom_job_training_op(\n",
|
||||
" training_artifacts_dir=training_artifacts_dir,\n",
|
||||
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
|
||||
" num_epochs=num_epochs,\n",
|
||||
@@ -1489,28 +1525,10 @@
|
||||
" num_actions=num_actions,\n",
|
||||
" tikhonov_weight=tikhonov_weight,\n",
|
||||
" agent_alpha=agent_alpha,\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" location=REGION,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" worker_pool_specs = [\n",
|
||||
" {\n",
|
||||
" \"containerSpec\": {\n",
|
||||
" \"imageUri\": train_task.container.image,\n",
|
||||
" },\n",
|
||||
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
|
||||
" \"machineSpec\": {\n",
|
||||
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
|
||||
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" },\n",
|
||||
" },\n",
|
||||
" ]\n",
|
||||
" train_task.custom_job_spec = {\n",
|
||||
" \"displayName\": train_task.name,\n",
|
||||
" \"jobSpec\": {\n",
|
||||
" \"workerPoolSpecs\": worker_pool_specs,\n",
|
||||
" },\n",
|
||||
" }\n",
|
||||
"\n",
|
||||
" # Run the Deployer components.\n",
|
||||
" # Upload the trained policy as a model.\n",
|
||||
" model_upload_op = gcc_aip.ModelUploadOp(\n",
|
||||
@@ -1527,11 +1545,13 @@
|
||||
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
|
||||
" # has to occur after both model uploading and endpoint creation complete.)\n",
|
||||
" gcc_aip.ModelDeployOp(\n",
|
||||
" project=project_id,\n",
|
||||
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
|
||||
" model=model_upload_op.outputs[\"model\"],\n",
|
||||
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
|
||||
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
|
||||
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
|
||||
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
|
||||
" )"
|
||||
]
|
||||
},
|
||||
|
||||
@@ -39,14 +39,15 @@ outputs:
|
||||
- {name: bigquery_table_id, type: String}
|
||||
implementation:
|
||||
container:
|
||||
image: tensorflow/tensorflow:2.5.0
|
||||
image: python:3.7
|
||||
command:
|
||||
- sh
|
||||
- -c
|
||||
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
|
||||
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
|
||||
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
|
||||
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
|
||||
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|
||||
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
|
||||
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|
||||
--user) && "$0" "$@"
|
||||
- sh
|
||||
- -ec
|
||||
- |
|
||||
@@ -296,7 +297,8 @@ implementation:
|
||||
|
||||
def _serialize_str(str_value: str) -> str:
|
||||
if not isinstance(str_value, str):
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
|
||||
str(str_value), str(type(str_value))))
|
||||
return str_value
|
||||
|
||||
import argparse
|
||||
|
||||
@@ -20,7 +20,7 @@ outputs:
|
||||
- {name: tfrecord_file, type: String}
|
||||
implementation:
|
||||
container:
|
||||
image: tensorflow/tensorflow:2.5.0
|
||||
image: python:3.7
|
||||
command:
|
||||
- sh
|
||||
- -c
|
||||
@@ -187,7 +187,8 @@ implementation:
|
||||
|
||||
def _serialize_str(str_value: str) -> str:
|
||||
if not isinstance(str_value, str):
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
|
||||
str(str_value), str(type(str_value))))
|
||||
return str_value
|
||||
|
||||
import argparse
|
||||
|
||||
@@ -1,3 +1,4 @@
|
||||
google-cloud-bigquery==2.20.0
|
||||
tensorflow==2.5.2
|
||||
tensorflow==2.7.2
|
||||
pillow==9.0.1
|
||||
tf-agents==0.8.0
|
||||
|
||||
@@ -1,2 +1,4 @@
|
||||
google-cloud-pubsub==2.5.0
|
||||
pillow==9.0.1
|
||||
tf-agents==0.8.0
|
||||
tensorflow==2.5.2
|
||||
tensorflow==2.7.2
|
||||
|
||||
@@ -0,0 +1,5 @@
|
||||
dataclasses==0.6
|
||||
google-cloud-aiplatform==1.8.1
|
||||
tensorflow==2.7.2
|
||||
pillow==9.0.1
|
||||
tf-agents==0.8.0
|
||||
@@ -27,14 +27,14 @@ outputs:
|
||||
- {name: training_artifacts_dir, type: String}
|
||||
implementation:
|
||||
container:
|
||||
image: tensorflow/tensorflow:2.5.0
|
||||
image: python:3.7
|
||||
command:
|
||||
- sh
|
||||
- -c
|
||||
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
|
||||
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
|
||||
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|
||||
--user) && "$0" "$@"
|
||||
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
|
||||
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
|
||||
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
|
||||
- sh
|
||||
- -ec
|
||||
- |
|
||||
@@ -270,7 +270,8 @@ implementation:
|
||||
|
||||
def _serialize_str(str_value: str) -> str:
|
||||
if not isinstance(str_value, str):
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
|
||||
str(str_value), str(type(str_value))))
|
||||
return str_value
|
||||
|
||||
import argparse
|
||||
|
||||
@@ -22,13 +22,13 @@ from src.training import task
|
||||
|
||||
|
||||
# Paths and configurations
|
||||
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
|
||||
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
|
||||
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
|
||||
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
|
||||
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
|
||||
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
|
||||
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
|
||||
"[your-file-name].json") # FILL IN
|
||||
"result.json") # FILL IN
|
||||
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
|
||||
|
||||
# Hyperparameters
|
||||
|
||||
@@ -1 +1 @@
|
||||
tensorflow==2.5.2
|
||||
tensorflow==2.7.2
|
||||
@@ -1 +1 @@
|
||||
tensorflow==2.5.2
|
||||
tensorflow==2.7.2
|
||||
@@ -8,7 +8,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"# Copyright 2022 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
@@ -113,8 +113,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gcloud beta ai custom-jobs local-run \\\n",
|
||||
" --base-image=$BASE_IMAGE_URI \\\n",
|
||||
"! gcloud ai custom-jobs local-run \\\n",
|
||||
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
|
||||
" --script=$SCRIPT_PATH \\\n",
|
||||
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
|
||||
" -- \\\n",
|
||||
|
||||
@@ -0,0 +1,5 @@
|
||||
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product. These are tested weekly and maintained by Google.
|
||||
|
||||
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that may be created by Google or external contributors. They are not necessary maintained.
|
||||
|
||||
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
|
||||
@@ -3,16 +3,28 @@
|
||||
# @global-owner1 and @global-owner2 will be requested for
|
||||
# review when someone opens a pull request.
|
||||
|
||||
/sdk/sdk_* @aferlitsch
|
||||
/gapic @aferlitsch
|
||||
/ml_ops @aferlitsch
|
||||
/model_monitoring/* @mco
|
||||
/sdk/sdk_* @andrewferlitsch
|
||||
/gapic @andrewferlitsch
|
||||
/gapic/custom/showcase_custom_image_classification_online_explain_example_based_api.ipynb @inardini
|
||||
/ml_ops @andrewferlitsch
|
||||
/model_monitoring/* @mco-gh
|
||||
/structured_data/rapid_prototyping_* @rafael-carvalho
|
||||
|
||||
/managed_notebooks/ @notebooks-team
|
||||
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
|
||||
/managed_notebooks/
|
||||
/bigquery_ml/ @polong
|
||||
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
|
||||
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
|
||||
/sdk/SDK_AutoML_Forecasting_Model_Training_Example.ipynb @thehardikv
|
||||
/sdk/sdk_automl_forecasting_evaluating_a_model.ipynb @thehardikv
|
||||
/matching_engine @yinghsienwu
|
||||
/neo4j @benofben @htappen
|
||||
/explainable_ai/SDK_Custom_Container_XAI.ipynb @brianchunkang
|
||||
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
|
||||
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
|
||||
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
|
||||
/tensorboard @yfang1
|
||||
/feature_store @nayaknishant @morgandu
|
||||
/prediction @googleapis/vertex-prediction-team
|
||||
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
|
||||
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
|
||||
/vertex_endpoints/optimized_tensorflow_runtime @vlasenkoalexey
|
||||
/notebooks/community/ml_ops/stage2/get_started_with_visionapi_and_automl.ipynb @mansari
|
||||
/notebooks/community/neo4j/graph_paysim.ipynb @benofben @laeg
|
||||
/notebooks/community/ml_ops/stage1/get_started_with_visionapi_and_vertex_datasets.ipynb @mansari
|
||||
/notebooks/community/pipelines/google_cloud_pipeline_components_bqml_pipeline_demand_forecasting.ipynb @inardini
|
||||
@@ -171,7 +171,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install {USER_FLAG} --upgrade git+https://github.com/googleapis/python-aiplatform.git@v1.6.0"
|
||||
"! pip install {USER_FLAG} --upgrade google-cloud-aiplatform"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -266,7 +266,7 @@
|
||||
"\n",
|
||||
"# Get your Google Cloud project ID from gcloud\n",
|
||||
"if not os.getenv(\"IS_TESTING\"):\n",
|
||||
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" PROJECT_ID = shell_output[0]\n",
|
||||
" print(\"Project ID: \", PROJECT_ID)"
|
||||
]
|
||||
@@ -292,6 +292,37 @@
|
||||
" PROJECT_ID = \"python-docs-samples-tests\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "d9f118b92c74"
|
||||
},
|
||||
"source": [
|
||||
"#### UUID\n",
|
||||
"\n",
|
||||
"If you are in a live tutorial session, you might be using a shared test account or project. To avoid name collisions between users on resources created, you create a uuid for each instance session, and append it onto the name of resources you create in this tutorial."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "3ee72715c0fd"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import random\n",
|
||||
"import string\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Generate a uuid of a specifed length(default=8)\n",
|
||||
"def generate_uuid(length: int = 8) -> str:\n",
|
||||
" return \"\".join(random.choices(string.ascii_lowercase + string.digits, k=length))\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"UUID = generate_uuid()"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -478,7 +509,6 @@
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore_service as featurestore_service_pb2\n",
|
||||
"from google.cloud.aiplatform_v1.types import io as io_pb2\n",
|
||||
"from google.protobuf.duration_pb2 import Duration\n",
|
||||
"\n",
|
||||
"# Create admin_client for CRUD and data_client for reading feature values.\n",
|
||||
"admin_client = FeaturestoreServiceClient(client_options={\"api_endpoint\": API_ENDPOINT})\n",
|
||||
@@ -542,30 +572,23 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"FEATURESTORE_ID = \"movie_prediction\"\n",
|
||||
"create_lro = admin_client.create_featurestore(\n",
|
||||
" featurestore_service_pb2.CreateFeaturestoreRequest(\n",
|
||||
" parent=BASE_RESOURCE_PATH,\n",
|
||||
" featurestore_id=FEATURESTORE_ID,\n",
|
||||
" featurestore=featurestore_pb2.Featurestore(\n",
|
||||
" online_serving_config=featurestore_pb2.Featurestore.OnlineServingConfig(\n",
|
||||
" fixed_node_count=1\n",
|
||||
"FEATURESTORE_ID = f\"movie_prediction_{UUID}\"\n",
|
||||
"try:\n",
|
||||
" create_lro = admin_client.create_featurestore(\n",
|
||||
" featurestore_service_pb2.CreateFeaturestoreRequest(\n",
|
||||
" parent=BASE_RESOURCE_PATH,\n",
|
||||
" featurestore_id=FEATURESTORE_ID,\n",
|
||||
" featurestore=featurestore_pb2.Featurestore(\n",
|
||||
" online_serving_config=featurestore_pb2.Featurestore.OnlineServingConfig(\n",
|
||||
" fixed_node_count=1\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "57V8eVcB5VFZ"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Wait for LRO to finish and get the LRO result.\n",
|
||||
"print(create_lro.result())"
|
||||
" # Wait for LRO to finish and get the LRO result.\n",
|
||||
" print(create_lro.result())\n",
|
||||
"except Exception as e:\n",
|
||||
" print(e)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -574,7 +597,7 @@
|
||||
"id": "ag8pCQ7rNjVf"
|
||||
},
|
||||
"source": [
|
||||
"You can use [GetFeaturestore](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.GetFeaturestore) or [ListFeaturestores](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.ListFeaturestores) to check if the Featurestore was successfully created. The following example gets the details of the Featurestore.\n"
|
||||
"You can use [GetFeaturestore](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.GetFeaturestore) or [ListFeaturestores](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.ListFeaturestores) to check if the Featurestore was successfully created. The following example gets the details of the Featurestore.\n"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -590,6 +613,41 @@
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "018ab19d934f"
|
||||
},
|
||||
"source": [
|
||||
"Auto scaling is available in v1 since v1.11. Below is the example for the `CreateFeaturestoreRequest` with auto-scaling, use it with `aiplatform_v1.FeaturestoreServiceClient` to create Featurestore:"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "aea39718b5d3"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore as v1_featurestore_pb2\n",
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore_service as v1_featurestore_service_pb2\n",
|
||||
"\n",
|
||||
"create_featurestore_request = v1_featurestore_service_pb2.CreateFeaturestoreRequest(\n",
|
||||
" parent=BASE_RESOURCE_PATH,\n",
|
||||
" featurestore_id=FEATURESTORE_ID,\n",
|
||||
" featurestore=v1_featurestore_pb2.Featurestore(\n",
|
||||
" online_serving_config=v1_featurestore_pb2.Featurestore.OnlineServingConfig(\n",
|
||||
" scaling=v1_featurestore_pb2.Featurestore.OnlineServingConfig.Scaling(\n",
|
||||
" min_node_count=1, max_node_count=5\n",
|
||||
" )\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -607,18 +665,20 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"users_entity_type_lro = admin_client.create_entity_type(\n",
|
||||
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
|
||||
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
|
||||
" entity_type_id=\"users\",\n",
|
||||
" entity_type=entity_type_pb2.EntityType(\n",
|
||||
" description=\"Users entity\",\n",
|
||||
" ),\n",
|
||||
"try:\n",
|
||||
" users_entity_type_lro = admin_client.create_entity_type(\n",
|
||||
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
|
||||
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
|
||||
" entity_type_id=\"users\",\n",
|
||||
" entity_type=entity_type_pb2.EntityType(\n",
|
||||
" description=\"Users entity\",\n",
|
||||
" ),\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Similarly, wait for EntityType creation operation.\n",
|
||||
"print(users_entity_type_lro.result())"
|
||||
" # Similarly, wait for EntityType creation operation.\n",
|
||||
" print(users_entity_type_lro.result())\n",
|
||||
"except Exception as e:\n",
|
||||
" print(e)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -630,16 +690,73 @@
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Create movies entity type without a monitoring configuration.\n",
|
||||
"movies_entity_type_lro = admin_client.create_entity_type(\n",
|
||||
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
|
||||
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
|
||||
" entity_type_id=\"movies\",\n",
|
||||
" entity_type=entity_type_pb2.EntityType(description=\"Movies entity\"),\n",
|
||||
"try:\n",
|
||||
" movies_entity_type_lro = admin_client.create_entity_type(\n",
|
||||
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
|
||||
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
|
||||
" entity_type_id=\"movies\",\n",
|
||||
" entity_type=entity_type_pb2.EntityType(description=\"Movies entity\"),\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Similarly, wait for EntityType creation operation.\n",
|
||||
" print(movies_entity_type_lro.result())\n",
|
||||
"except Exception as e:\n",
|
||||
" print(e)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dPkT7KDuEvWv"
|
||||
},
|
||||
"source": [
|
||||
"Feature [monitoring](https://cloud.google.com/vertex-ai/docs/featurestore/monitoring) is in preview, so you need to use v1 Python. Import feature analysis is only available through SDK for now."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "9kiqrBN6E28r"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud.aiplatform_v1 import \\\n",
|
||||
" FeaturestoreServiceClient as v1_FeaturestoreServiceClient\n",
|
||||
"from google.cloud.aiplatform_v1.types import entity_type as v1_entity_type_pb2\n",
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore_monitoring as v1_featurestore_monitoring_pb2\n",
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore_service as v1_featurestore_service_pb2\n",
|
||||
"\n",
|
||||
"v1_admin_client = v1_FeaturestoreServiceClient(\n",
|
||||
" client_options={\"api_endpoint\": API_ENDPOINT}\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Similarly, wait for EntityType creation operation.\n",
|
||||
"print(movies_entity_type_lro.result())"
|
||||
"# Enable import feature analysis for users entity type.\n",
|
||||
"# All Features belonging to this EntityType will by default inherit the monitoring config.\n",
|
||||
"v1_admin_client.update_entity_type(\n",
|
||||
" v1_featurestore_service_pb2.UpdateEntityTypeRequest(\n",
|
||||
" entity_type=v1_entity_type_pb2.EntityType(\n",
|
||||
" name=admin_client.entity_type_path(\n",
|
||||
" PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"\n",
|
||||
" ),\n",
|
||||
" monitoring_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig(\n",
|
||||
" import_features_analysis=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ImportFeaturesAnalysis(\n",
|
||||
" anomaly_detection_baseline=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ImportFeaturesAnalysis.Baseline.LATEST_STATS,\n",
|
||||
" state=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ImportFeaturesAnalysis.State.ENABLED,\n",
|
||||
" ),\n",
|
||||
" numerical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
|
||||
" value=0.001,\n",
|
||||
" ),\n",
|
||||
" categorical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
|
||||
" value=0.001,\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
" )\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -648,7 +765,9 @@
|
||||
"id": "85b1f59fbf6d"
|
||||
},
|
||||
"source": [
|
||||
"Feature [monitoring](https://cloud.google.com/vertex-ai/docs/featurestore/monitoring) is in preview, so you need to use v1beta1 Python. The easiest way to set this for now is using [console UI](https://console.cloud.google.com/vertex-ai/features). For completeness, below is example to do this using v1beta1 SDK\n"
|
||||
"The easiest way to set up snapshot analysis for now is using [console UI](https://console.cloud.google.com/vertex-ai/features). For completeness, below is example to do this using v1 SDK.\n",
|
||||
"\n",
|
||||
"You can view monitoring statistics on [console UI](https://console.cloud.google.com/vertex-ai/features)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -659,30 +778,36 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud.aiplatform_v1beta1 import \\\n",
|
||||
" FeaturestoreServiceClient as v1beta1_FeaturestoreServiceClient\n",
|
||||
"from google.cloud.aiplatform_v1beta1.types import \\\n",
|
||||
" entity_type as v1beta1_entity_type_pb2\n",
|
||||
"from google.cloud.aiplatform_v1beta1.types import \\\n",
|
||||
" featurestore_monitoring as v1beta1_featurestore_monitoring_pb2\n",
|
||||
"from google.cloud.aiplatform_v1beta1.types import \\\n",
|
||||
" featurestore_service as v1beta1_featurestore_service_pb2\n",
|
||||
"from google.cloud.aiplatform_v1 import \\\n",
|
||||
" FeaturestoreServiceClient as v1_FeaturestoreServiceClient\n",
|
||||
"from google.cloud.aiplatform_v1.types import entity_type as v1_entity_type_pb2\n",
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore_monitoring as v1_featurestore_monitoring_pb2\n",
|
||||
"from google.cloud.aiplatform_v1.types import \\\n",
|
||||
" featurestore_service as v1_featurestore_service_pb2\n",
|
||||
"\n",
|
||||
"v1beta1_admin_client = v1beta1_FeaturestoreServiceClient(\n",
|
||||
"v1_admin_client = v1_FeaturestoreServiceClient(\n",
|
||||
" client_options={\"api_endpoint\": API_ENDPOINT}\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Enable monitoring for users entity type.\n",
|
||||
"# Enable snapshot analysis for users entity type.\n",
|
||||
"# All Features belonging to this EntityType will by default inherit the monitoring config.\n",
|
||||
"v1beta1_admin_client.update_entity_type(\n",
|
||||
" v1beta1_featurestore_service_pb2.UpdateEntityTypeRequest(\n",
|
||||
" entity_type=v1beta1_entity_type_pb2.EntityType(\n",
|
||||
"v1_admin_client.update_entity_type(\n",
|
||||
" v1_featurestore_service_pb2.UpdateEntityTypeRequest(\n",
|
||||
" entity_type=v1_entity_type_pb2.EntityType(\n",
|
||||
" name=admin_client.entity_type_path(\n",
|
||||
" PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"\n",
|
||||
" ),\n",
|
||||
" monitoring_config=v1beta1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig(\n",
|
||||
" snapshot_analysis=v1beta1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.SnapshotAnalysis(\n",
|
||||
" monitoring_interval=Duration(seconds=86400), # 1 day\n",
|
||||
" monitoring_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig(\n",
|
||||
" snapshot_analysis=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.SnapshotAnalysis(\n",
|
||||
" monitoring_interval_days=1, # 1 day\n",
|
||||
" staleness_days=30,\n",
|
||||
" ),\n",
|
||||
" numerical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
|
||||
" value=0.001,\n",
|
||||
" ),\n",
|
||||
" categorical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
|
||||
" value=0.001,\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
" ),\n",
|
||||
@@ -708,32 +833,40 @@
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Create features for the 'users' entity.\n",
|
||||
"admin_client.batch_create_features(\n",
|
||||
" parent=admin_client.entity_type_path(PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"),\n",
|
||||
" requests=[\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.INT64,\n",
|
||||
" description=\"User age\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"age\",\n",
|
||||
"try:\n",
|
||||
" admin_client.batch_create_features(\n",
|
||||
" parent=admin_client.entity_type_path(\n",
|
||||
" PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"\n",
|
||||
" ),\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
|
||||
" description=\"User gender\",\n",
|
||||
" requests=[\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.INT64,\n",
|
||||
" description=\"User age\",\n",
|
||||
" disable_monitoring=False,\n",
|
||||
" ),\n",
|
||||
" feature_id=\"age\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"gender\",\n",
|
||||
" ),\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING_ARRAY,\n",
|
||||
" description=\"An array of genres that this user liked\",\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
|
||||
" description=\"User gender\",\n",
|
||||
" # Default is False. If True, Feature 'gender' monitoring analysis is disabled.\n",
|
||||
" disable_monitoring=True,\n",
|
||||
" ),\n",
|
||||
" feature_id=\"gender\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"liked_genres\",\n",
|
||||
" ),\n",
|
||||
" ],\n",
|
||||
").result()"
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING_ARRAY,\n",
|
||||
" description=\"An array of genres that this user liked\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"liked_genres\",\n",
|
||||
" ),\n",
|
||||
" ],\n",
|
||||
" ).result()\n",
|
||||
"except Exception as e:\n",
|
||||
" print(e)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -745,33 +878,37 @@
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Create features for movies type.\n",
|
||||
"# 'title' Feature enables monitoring.\n",
|
||||
"admin_client.batch_create_features(\n",
|
||||
" parent=admin_client.entity_type_path(PROJECT_ID, REGION, FEATURESTORE_ID, \"movies\"),\n",
|
||||
" requests=[\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
|
||||
" description=\"The title of the movie\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"title\",\n",
|
||||
"try:\n",
|
||||
" admin_client.batch_create_features(\n",
|
||||
" parent=admin_client.entity_type_path(\n",
|
||||
" PROJECT_ID, REGION, FEATURESTORE_ID, \"movies\"\n",
|
||||
" ),\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
|
||||
" description=\"The genres of the movie\",\n",
|
||||
" requests=[\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
|
||||
" description=\"The title of the movie\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"title\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"genres\",\n",
|
||||
" ),\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.DOUBLE,\n",
|
||||
" description=\"The average rating for the movie, range is [1.0-5.0]\",\n",
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
|
||||
" description=\"The genres of the movie\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"genres\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"average_rating\",\n",
|
||||
" ),\n",
|
||||
" ],\n",
|
||||
").result()"
|
||||
" featurestore_service_pb2.CreateFeatureRequest(\n",
|
||||
" feature=feature_pb2.Feature(\n",
|
||||
" value_type=feature_pb2.Feature.ValueType.DOUBLE,\n",
|
||||
" description=\"The average rating for the movie, range is [1.0-5.0]\",\n",
|
||||
" ),\n",
|
||||
" feature_id=\"average_rating\",\n",
|
||||
" ),\n",
|
||||
" ],\n",
|
||||
" ).result()\n",
|
||||
"except Exception as e:\n",
|
||||
" print(e)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -782,8 +919,8 @@
|
||||
"source": [
|
||||
"## Search created features\n",
|
||||
"\n",
|
||||
"While the [ListFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.ListFeatures) method allows you to easily view all features of a single\n",
|
||||
"entity type, the [SearchFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.SearchFeatures) method searches across all featurestores\n",
|
||||
"While the [ListFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.ListFeatures) method allows you to easily view all features of a single\n",
|
||||
"entity type, the [SearchFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.SearchFeatures) method searches across all featurestores\n",
|
||||
"and entity types in a given location (such as `us-central1`). This can help you discover features that were created by someone else.\n",
|
||||
"\n",
|
||||
"You can query based on feature properties including feature ID, entity type ID,\n",
|
||||
@@ -985,6 +1122,8 @@
|
||||
" ],\n",
|
||||
" feature_time_field=\"update_time\",\n",
|
||||
" worker_count=1,\n",
|
||||
" # Default is False. If True, the import feature analysis won't happen for this specific operation.\n",
|
||||
" disable_ingestion_analysis=False,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
@@ -1095,7 +1234,7 @@
|
||||
},
|
||||
"source": [
|
||||
"The\n",
|
||||
"[Online Serving APIs](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#featurestoreonlineservingservice)\n",
|
||||
"[Online Serving APIs](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#featurestoreonlineservingservice)\n",
|
||||
"lets you serve feature values for small batches of entities. It's designed for latency-sensitive service, such as online model prediction. For example, for a movie service, you might want to quickly shows movies that the current user would most likely watch by using online predictions."
|
||||
]
|
||||
},
|
||||
@@ -1393,9 +1532,7 @@
|
||||
],
|
||||
"metadata": {
|
||||
"colab": {
|
||||
"collapsed_sections": [
|
||||
"ze4-nDLfK4pw"
|
||||
],
|
||||
"collapsed_sections": [],
|
||||
"name": "gapic-feature-store.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
|
After Width: | Height: | Size: 83 KiB |
|
After Width: | Height: | Size: 141 KiB |
|
After Width: | Height: | Size: 230 KiB |
|
After Width: | Height: | Size: 140 KiB |
|
After Width: | Height: | Size: 140 KiB |
@@ -459,7 +459,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil cp gs://cloud-samples-data/ai-platform-unified/matching_engine/glove-100-angular.hdf5 ."
|
||||
"! gsutil cp gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5 ."
|
||||
]
|
||||
},
|
||||
{
|
||||
|
||||
@@ -11,8 +11,8 @@ The purpose of this set of notebooks and markdown files is to demonstrate Google
|
||||
1. [Data Management](stage1)
|
||||
2. [Experimentation](stage2)
|
||||
3. [Formalization](stage3)
|
||||
4. Evaluation
|
||||
5. Deployment
|
||||
6. Serving
|
||||
4. [Evaluation](stage4)
|
||||
5. [Deployment](stage5)
|
||||
6. [Serving](stage6)
|
||||
7. Monitoring
|
||||
8. Continuous Training
|
||||
|
||||
@@ -22,18 +22,90 @@ The first stage in MLOps is the collection and preparation for the purpose of de
|
||||
- Data is preprocessed for training and evaluation using Dataflow.
|
||||
- Data augmentation is performed on-the-fly and is coupled with model feeding.
|
||||
|
||||
<img src='stage1.jpg'>
|
||||
<img src='stage1v2.png'>
|
||||
|
||||
## Notebooks
|
||||
|
||||
### Get Started
|
||||
|
||||
[Get Started with BQ datasets](get_started_bq_datasets.ipynb)
|
||||
[Get started with Vertex AI datasets](get_started_vertex_datasets.ipynb)
|
||||
|
||||
[Get Started with Vertex datasets](get_started_vertex_datasets.ipynb)
|
||||
```
|
||||
The steps performed include:
|
||||
- Create a Vertex AI `Dataset` resource for:
|
||||
- image data
|
||||
- text data
|
||||
- video data
|
||||
- tabular data
|
||||
- forecasting data
|
||||
- Search `Dataset` resources using a filter.
|
||||
- Read a sample of a `BigQuery` dataset into a dataframe.
|
||||
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
|
||||
- Detect anomalies in new data using TensorFlow Data Validation.
|
||||
- Generate a TFRecord feature specification using TensorFlow Transform from the data schema.
|
||||
- Export a dataset and convert to TFRecords.
|
||||
```
|
||||
|
||||
[Get Started with Dataflow](get_started_dataflow.ipynb)
|
||||
[Get started with Dataflow](get_started_dataflow.ipynb)
|
||||
|
||||
```
|
||||
The steps performed include:
|
||||
- Offline preprocessing of data:
|
||||
- Serially - w/o dataflow
|
||||
- Parallel - with dataflow
|
||||
- Upstream preprocessing of data:
|
||||
- tabular data
|
||||
- image data
|
||||
```
|
||||
|
||||
[Create an unlabelled Vertex AI AutoML text entity extraction dataset from pdfs using Vision API](get_started_with_visionapi_and_vertex_datasets.ipynb)
|
||||
|
||||
```
|
||||
The steps performed include:
|
||||
1. Using `Vision API` to perform Optical Character Recognition (OCR) to extract text from PDF files.
|
||||
2. Processing the results and saving them to text files.
|
||||
3. Generating a `Vertex AI Dataset` import file.
|
||||
4. Creating a new unlabelled text entity extraction `Vertex AI Dataset` resource in `Vertex AI`.
|
||||
```
|
||||
|
||||
[Get started with BigQuery datasets](get_started_bq_datasets.ipynb)
|
||||
|
||||
```
|
||||
The steps performed include:
|
||||
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- compatible for `AutoML` training.
|
||||
- Extract a copy of the dataset from `BigQuery` to a CSV file in Cloud Storage -- compatible for `AutoML` or custom training.
|
||||
- Select rows from a `BigQuery` dataset into a `pandas` dataframe -- compatible for custom training.
|
||||
- Select rows from a `BigQuery` dataset into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
|
||||
- Select rows from extracted CSV files into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
|
||||
- Create a `BigQuery` dataset from CSV files.
|
||||
- Extract data from `BigQuery` table into a `DMatrix` -- compatible for custom training `XGBoost` models.
|
||||
```
|
||||
|
||||
[Get started with Vertex AI data labeling](get_started_with_data_labeling.ipynb)
|
||||
|
||||
```
|
||||
The steps performed include:
|
||||
- Create a Specialist Pool for data labelers.
|
||||
- Create a data labeling job.
|
||||
- Submit the data labeling job.
|
||||
- List data labeling jobs.
|
||||
- Cancel a data labeling job.
|
||||
|
||||
```
|
||||
|
||||
### E2E Stage Example
|
||||
|
||||
[Stage 1: Data Management](mlops_data_management.ipynb)
|
||||
|
||||
|
||||
```
|
||||
The steps performed include:
|
||||
- Explore and visualize the data.
|
||||
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- for AutoML training.
|
||||
- Extract a copy of the dataset to a CSV file in Cloud Storage.
|
||||
- Create a Vertex AI `Dataset` resource from CSV files -- alternative for AutoML training.
|
||||
- Read a sample of the `BigQuery` dataset into a dataframe.
|
||||
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
|
||||
- Generate a TFRecord feature specification using TensorFlow Data Validation from the data schema.
|
||||
- Preprocess a portion of the BigQuery data using `Dataflow` -- for custom training.
|
||||
```
|
||||
|
||||
@@ -8,7 +8,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2020 Google LLC\n",
|
||||
"# Copyright 2022 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
@@ -33,14 +33,19 @@
|
||||
"\n",
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/get_started_bq_datasets.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/get_started_bq_datasets.ipynb\">\n",
|
||||
" Open in Google Cloud Notebooks\n",
|
||||
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
|
||||
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
|
||||
" Open in Vertex AI Workbench\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>\n",
|
||||
@@ -59,17 +64,6 @@
|
||||
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 1 : data management: get started with BigQuery datasets."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dataset:gsod,lrg"
|
||||
},
|
||||
"source": [
|
||||
"### Dataset\n",
|
||||
"\n",
|
||||
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -82,12 +76,12 @@
|
||||
"\n",
|
||||
"This tutorial uses the following Google Cloud ML services:\n",
|
||||
"\n",
|
||||
"- `Vertex Datasets`\n",
|
||||
"- `Vertex AI Datasets`\n",
|
||||
"- `BigQuery Datasets`\n",
|
||||
"\n",
|
||||
"The steps performed include:\n",
|
||||
"\n",
|
||||
"- Create a Vertex `Dataset` resource from `BigQuery` table -- compatible for `AutoML` training.\n",
|
||||
"- Create a Vertex AI `Dataset` resource from `BigQuery` table -- compatible for `AutoML` training.\n",
|
||||
"- Extract a copy of the dataset from `BigQuery` to a CSV file in Cloud Storage -- compatible for `AutoML` or custom training.\n",
|
||||
"- Select rows from a `BigQuery` dataset into a `pandas` dataframe -- compatible for custom training.\n",
|
||||
"- Select rows from a `BigQuery` dataset into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.\n",
|
||||
@@ -104,10 +98,10 @@
|
||||
"source": [
|
||||
"### Recommendations\n",
|
||||
"\n",
|
||||
"When doing E2E MLOps on Google Cloud, the following best practices with structured (tabular) data in BigQuery:\n",
|
||||
"When doing E2E MLOps on Google Cloud, following are the best practices when dealing with structured (tabular) data in BigQuery:\n",
|
||||
"\n",
|
||||
"- For AutoML training:\n",
|
||||
" - Create a managed dataset with Vertex `TabularDataset`.\n",
|
||||
" - Create a managed dataset with Vertex AI `TabularDataset`.\n",
|
||||
" - Use the BigQuery table as the input to the dataset.\n",
|
||||
" - Specify columns and columns transformations when running the AutoML training pipeline job.\n",
|
||||
"\n",
|
||||
@@ -124,7 +118,7 @@
|
||||
" - Within the generator (upstream)\n",
|
||||
" - Within the model (downstream)\n",
|
||||
" - XGBoost model training:\n",
|
||||
" - Use BigQuery ML builtin XGBoost training.\n",
|
||||
" - Use BigQuery ML built-in XGBoost training.\n",
|
||||
" - Alternatively, create a DMatrix generator from CSV files extracted from BigQuery table.\n",
|
||||
" - Pytorch model training:\n",
|
||||
" - Extract the BigQuery to a pandas dataframe.\n",
|
||||
@@ -132,12 +126,39 @@
|
||||
" - Create a DataLoader generator from the pandas dataframe.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"- Alternately:\n",
|
||||
"- Alternatively:\n",
|
||||
" - Extract the BigQuery table to CSV files.\n",
|
||||
" - Preprocess the CSV files.\n",
|
||||
" - Create a tf.data.Dataset generator from the CSV files."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dataset:gsod,lrg"
|
||||
},
|
||||
"source": [
|
||||
"### Dataset\n",
|
||||
"\n",
|
||||
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). In this version of the dataset you consider the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9e483012a752"
|
||||
},
|
||||
"source": [
|
||||
"### Costs\n",
|
||||
"This tutorial uses billable components of Google Cloud:\n",
|
||||
"\n",
|
||||
"- Vertex AI\n",
|
||||
"- Cloud Storage\n",
|
||||
"- BigQuery\n",
|
||||
"\n",
|
||||
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -146,7 +167,7 @@
|
||||
"source": [
|
||||
"## Installations\n",
|
||||
"\n",
|
||||
"Install *one time* the packages for executing the MLOps notebooks."
|
||||
"Install the following packages to execute this notebook."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -157,38 +178,26 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"ONCE_ONLY = False\n",
|
||||
"if ONCE_ONLY:\n",
|
||||
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "install_xgboost"
|
||||
},
|
||||
"source": [
|
||||
"Install the latest GA version of *XGBoost* library as well."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "install_xgboost"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip3 install -U xgboost $USER_FLAG"
|
||||
"import os\n",
|
||||
"\n",
|
||||
"# The Vertex AI Workbench Notebook product has specific requirements\n",
|
||||
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\") and not os.getenv(\"VIRTUAL_ENV\")\n",
|
||||
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
|
||||
" \"/opt/deeplearning/metadata/env_version\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
|
||||
"USER_FLAG = \"\"\n",
|
||||
"if IS_WORKBENCH_NOTEBOOK:\n",
|
||||
" USER_FLAG = \"--user\"\n",
|
||||
"\n",
|
||||
"# Install the packages\n",
|
||||
"! pip3 install --upgrade pyarrow $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
|
||||
"! pip3 install -U xgboost $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -220,6 +229,32 @@
|
||||
" app.kernel.do_shutdown(True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "84cd83853240"
|
||||
},
|
||||
"source": [
|
||||
"## Before you begin\n",
|
||||
"\n",
|
||||
"### Set up your Google Cloud project\n",
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
|
||||
"\n",
|
||||
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
|
||||
"\n",
|
||||
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
|
||||
"\n",
|
||||
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
|
||||
"\n",
|
||||
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
|
||||
"Cloud SDK uses the right project for all the commands in this notebook.\n",
|
||||
"\n",
|
||||
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -285,7 +320,7 @@
|
||||
"\n",
|
||||
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
|
||||
"\n",
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)"
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -296,7 +331,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"REGION = \"us-central1\" # @param {type: \"string\"}"
|
||||
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
|
||||
"\n",
|
||||
"if REGION == \"[your-region]\":\n",
|
||||
" REGION = \"us-central1\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -323,6 +361,67 @@
|
||||
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "77c385f0db59"
|
||||
},
|
||||
"source": [
|
||||
"### Authenticate your Google Cloud account\n",
|
||||
"\n",
|
||||
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
|
||||
"\n",
|
||||
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
|
||||
"\n",
|
||||
"**Otherwise**, follow these steps:\n",
|
||||
"\n",
|
||||
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
|
||||
"\n",
|
||||
"1. **Click Create service account**.\n",
|
||||
"\n",
|
||||
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
|
||||
"\n",
|
||||
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
|
||||
"\n",
|
||||
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
|
||||
"\n",
|
||||
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "535223fa4b84"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If on Vertex AI Workbench, then don't execute this code\n",
|
||||
"IS_COLAB = False\n",
|
||||
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
|
||||
" \"DL_ANACONDA_HOME\"\n",
|
||||
"):\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" IS_COLAB = True\n",
|
||||
" from google.colab import auth as google_auth\n",
|
||||
"\n",
|
||||
" google_auth.authenticate_user()\n",
|
||||
"\n",
|
||||
" # If you are running this notebook locally, replace the string below with the\n",
|
||||
" # path to your service account key and run this cell to authenticate your GCP\n",
|
||||
" # account.\n",
|
||||
" elif not os.getenv(\"IS_TESTING\"):\n",
|
||||
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -333,12 +432,7 @@
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"When you submit a custom training job using the Vertex SDK, you upload a Python package\n",
|
||||
"containing your training code to a Cloud Storage bucket. Vertex AI runs\n",
|
||||
"the code from this package. In this tutorial, Vertex AI also saves the\n",
|
||||
"trained model that results from your job in the same bucket. You can then\n",
|
||||
"create an `Endpoint` resource based on this output in order to serve\n",
|
||||
"online predictions.\n",
|
||||
"When you create a dataset resource using the Vertex SDK, you can provide a Cloud Storage bucket that contains the data. Vertex AI creates the dataset resource from the data. In this tutorial, Vertex AI also creates a dataset resource from your data in the Cloud Storage bucket.\n",
|
||||
"\n",
|
||||
"Set the name of your Cloud Storage bucket below. Bucket names must be globally unique across all Google Cloud projects, including those outside of your organization."
|
||||
]
|
||||
@@ -351,7 +445,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
|
||||
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
|
||||
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -362,8 +457,9 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
|
||||
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
|
||||
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -383,7 +479,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil mb -l $REGION $BUCKET_NAME"
|
||||
"! gsutil mb -l $REGION $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -403,7 +499,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
"! gsutil ls -al $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -412,9 +508,6 @@
|
||||
"id": "setup_vars"
|
||||
},
|
||||
"source": [
|
||||
"### Set up variables\n",
|
||||
"\n",
|
||||
"Next, set up some variables used throughout the tutorial.\n",
|
||||
"### Import libraries and define constants"
|
||||
]
|
||||
},
|
||||
@@ -426,84 +519,21 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import google.cloud.aiplatform as aip"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_bq"
|
||||
},
|
||||
"source": [
|
||||
"#### Import BigQuery\n",
|
||||
"\n",
|
||||
"Import the BigQuery package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_bq"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import google.cloud.aiplatform as aiplatform\n",
|
||||
"import pandas as pd\n",
|
||||
"import xgboost as xgb\n",
|
||||
"from google.cloud import bigquery"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_xgboost"
|
||||
},
|
||||
"source": [
|
||||
"#### Import XGBoost\n",
|
||||
"\n",
|
||||
"Import the XGBoost package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_xgboost"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import xgboost as xgb"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_pandas"
|
||||
},
|
||||
"source": [
|
||||
"#### Import pandas\n",
|
||||
"\n",
|
||||
"Import the pandas package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_pandas"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import pandas as pd"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "init_aip:mbsdk,region"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK for Python\n",
|
||||
"### Initialize Vertex AI SDK for Python\n",
|
||||
"\n",
|
||||
"Initialize the Vertex SDK for Python for your project and corresponding bucket."
|
||||
"Initialize the Vertex AI SDK for Python for your project and corresponding bucket."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -514,7 +544,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"aip.init(project=PROJECT_ID, location=REGION)"
|
||||
"aiplatform.init(project=PROJECT_ID, location=REGION)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -536,7 +566,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"bqclient = bigquery.Client()"
|
||||
"bqclient = bigquery.Client(project=PROJECT_ID)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -547,7 +577,7 @@
|
||||
"source": [
|
||||
"#### Location of BigQuery training data.\n",
|
||||
"\n",
|
||||
"Now set the variable `IMPORT_FILE` to the location of the data table in BigQuery."
|
||||
"Now, set the variable `IMPORT_FILE` to the location of the data table in BigQuery and `BQ_TABLE` with the table id."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -589,10 +619,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"dataset = aip.TabularDataset.create(\n",
|
||||
"dataset = aiplatform.TabularDataset.create(\n",
|
||||
" display_name=\"NOAA historical weather data\" + \"_\" + TIMESTAMP,\n",
|
||||
" bq_source=[IMPORT_FILE],\n",
|
||||
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
|
||||
" labels={\"user_metadata\": BUCKET_URI[5:]},\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"label_column = \"mean_temp\"\n",
|
||||
@@ -608,7 +638,7 @@
|
||||
"source": [
|
||||
"### Copy the dataset to Cloud Storage\n",
|
||||
"\n",
|
||||
"Next, you make a copy of the BigQuery dataset, as a CSV file, to Cloud Storage using the BigQuery extract command.\n",
|
||||
"Next, you make a copy of the BigQuery table as a CSV file, to Cloud Storage using the BigQuery extract command.\n",
|
||||
"\n",
|
||||
"Learn more about [BigQuery command line interface](https://cloud.google.com/bigquery/docs/reference/bq-cli-reference)."
|
||||
]
|
||||
@@ -624,9 +654,9 @@
|
||||
"comps = BQ_TABLE.split(\".\")\n",
|
||||
"BQ_PROJECT_DATASET_TABLE = comps[0] + \":\" + comps[1] + \".\" + comps[2]\n",
|
||||
"\n",
|
||||
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_NAME/mydata*.csv\n",
|
||||
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_URI/mydata*.csv\n",
|
||||
"\n",
|
||||
"IMPORT_FILES = ! gsutil ls $BUCKET_NAME/mydata*.csv\n",
|
||||
"IMPORT_FILES = ! gsutil ls $BUCKET_URI/mydata*.csv\n",
|
||||
"\n",
|
||||
"print(IMPORT_FILES)\n",
|
||||
"\n",
|
||||
@@ -662,15 +692,12 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if \"IMPORT_FILES\" in globals():\n",
|
||||
" gcs_source = IMPORT_FILES\n",
|
||||
"else:\n",
|
||||
" gcs_source = [IMPORT_FILE]\n",
|
||||
"gcs_source = IMPORT_FILES\n",
|
||||
"\n",
|
||||
"dataset = aip.TabularDataset.create(\n",
|
||||
"dataset = aiplatform.TabularDataset.create(\n",
|
||||
" display_name=\"NOAA historical weather data\" + \"_\" + TIMESTAMP,\n",
|
||||
" gcs_source=gcs_source,\n",
|
||||
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
|
||||
" labels={\"user_metadata\": BUCKET_URI[5:]},\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"\n",
|
||||
@@ -692,6 +719,30 @@
|
||||
"Learn more about [Creating BigQuery views](https://cloud.google.com/bigquery/docs/views)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "7dc142433e50"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Set dataset name and view name in BigQuery\n",
|
||||
"BQ_MY_DATASET = \"[your-dataset-name]\"\n",
|
||||
"BQ_MY_TABLE = \"[your-view-name]\"\n",
|
||||
"\n",
|
||||
"# Otherwise, use the default names\n",
|
||||
"if (\n",
|
||||
" BQ_MY_DATASET == \"\"\n",
|
||||
" or BQ_MY_DATASET is None\n",
|
||||
" or BQ_MY_DATASET == \"[your-dataset-name]\"\n",
|
||||
"):\n",
|
||||
" BQ_MY_DATASET = \"mlops_dataset_\" + TIMESTAMP\n",
|
||||
"\n",
|
||||
"if BQ_MY_TABLE == \"\" or BQ_MY_TABLE is None or BQ_MY_TABLE == \"[your-view-name]\":\n",
|
||||
" BQ_MY_TABLE = \"mlops_view_\" + TIMESTAMP"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -700,8 +751,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BQ_MY_DATASET = 'mydataset'\n",
|
||||
"BQ_MY_TABLE = 'myview'\n",
|
||||
"# Create the resources\n",
|
||||
"! bq --location=US mk -d \\\n",
|
||||
"$PROJECT_ID:$BQ_MY_DATASET\n",
|
||||
"\n",
|
||||
@@ -742,8 +792,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Download a table.\n",
|
||||
"table = bigquery.TableReference.from_string(\"bigquery-public-data.samples.gsod\")\n",
|
||||
"# Download the table.\n",
|
||||
"table = bigquery.TableReference.from_string(BQ_TABLE)\n",
|
||||
"\n",
|
||||
"rows = bqclient.list_rows(\n",
|
||||
" table,\n",
|
||||
@@ -1029,22 +1079,6 @@
|
||||
"TABLE_ID = \"gsod\"\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def create_bigquery_dataset(dataset_id):\n",
|
||||
" dataset = bigquery.Dataset(\n",
|
||||
" bigquery.dataset.DatasetReference(PROJECT_ID, dataset_id)\n",
|
||||
" )\n",
|
||||
" dataset.location = \"us\"\n",
|
||||
"\n",
|
||||
" try:\n",
|
||||
" dataset = bqclient.create_dataset(dataset) # API request\n",
|
||||
" return True\n",
|
||||
" except Exception as err:\n",
|
||||
" print(err)\n",
|
||||
" if err.code != 409: # http_client.CONFLICT\n",
|
||||
" raise\n",
|
||||
" return False\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def load_data_into_bigquery(url, dataset_id, table_id):\n",
|
||||
" create_bigquery_dataset(dataset_id)\n",
|
||||
" dataset = bqclient.dataset(dataset_id)\n",
|
||||
@@ -1077,13 +1111,11 @@
|
||||
"source": [
|
||||
"### Read BigQuery table into XGboost DMatrix\n",
|
||||
"\n",
|
||||
"Currently, there is no direct data feeding connector between BigQuery and the open source XGBoost.\n",
|
||||
"Currently, there is no direct data feeding connector between BigQuery and the open source XGBoost. The BigQuery ML service has a built-in XGBoost training module.\n",
|
||||
"\n",
|
||||
"The BigQuery ML service has XGBoost training builtin.\n",
|
||||
"Alernatively, you extract the data either as a pandas dataframe or as CSV files. The extracted data is then given as an input to a `DMatrix` object when training the model.\n",
|
||||
"\n",
|
||||
"Alernatively, you extract the data either as a pandas dataframe or as CSV files. The extracted data is then inputted to a `DMatrix` object when training the model.\n",
|
||||
"\n",
|
||||
"Learn more about [Getting started with builtin XGBoost](https://cloud.google.com/ai-platform/training/docs/algorithms/xgboost-start)"
|
||||
"Learn more about [Getting started with built-in XGBoost](https://cloud.google.com/ai-platform/training/docs/algorithms/xgboost-start)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1094,7 +1126,7 @@
|
||||
"source": [
|
||||
"### Read pandas table into XGboost DMatrix\n",
|
||||
"\n",
|
||||
"Next, you load the pandas dataframe into a `DMatrix` object. XGBoost does not support non-numeric inputs. Any column that is categorical will need to be one-hot encoded prior to loading the dataframe."
|
||||
"Next, you load the pandas dataframe into a `DMatrix` object. XGBoost does not support non-numeric inputs. Any column that is categorical need to be one-hot encoded prior to loading the dataframe."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1107,7 +1139,7 @@
|
||||
"source": [
|
||||
"dataframe[\"station_number\"] = pd.to_numeric(dataframe[\"station_number\"])\n",
|
||||
"labels = dataframe[\"mean_temp\"]\n",
|
||||
"data = dataframe.drop(4)\n",
|
||||
"data = dataframe.drop([\"mean_temp\"], axis=1)\n",
|
||||
"\n",
|
||||
"dtrain = xgb.DMatrix(data, label=labels)"
|
||||
]
|
||||
@@ -1120,7 +1152,7 @@
|
||||
"source": [
|
||||
"### Read CSV files into XGboost DMatrix\n",
|
||||
"\n",
|
||||
"Currently, there is no Cloud Storage support in XGBoost. If you use CSV files for input, you will need to download them locally."
|
||||
"Currently, there is no Cloud Storage support in XGBoost. If you use CSV files for input, you need to download them locally."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1142,86 +1174,42 @@
|
||||
"id": "cleanup:mbsdk"
|
||||
},
|
||||
"source": [
|
||||
"# Cleaning up\n",
|
||||
"# Clean up\n",
|
||||
"\n",
|
||||
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
|
||||
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
|
||||
"\n",
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
|
||||
"\n",
|
||||
"- Dataset\n",
|
||||
"- Pipeline\n",
|
||||
"- Model\n",
|
||||
"- Endpoint\n",
|
||||
"- AutoML Training Job\n",
|
||||
"- Batch Job\n",
|
||||
"- Custom Job\n",
|
||||
"- Hyperparameter Tuning Job\n",
|
||||
"- Cloud Storage Bucket"
|
||||
"- Vertex AI Dataset resource\n",
|
||||
"- Cloud Storage Bucket\n",
|
||||
"- BigQuery Dataset\n",
|
||||
"\n",
|
||||
"Set `delete_storage` to _True_ to delete the storage resources used in this notebook."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "cleanup:mbsdk"
|
||||
"id": "47ad926d84e8"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"delete_all = True\n",
|
||||
"import os\n",
|
||||
"\n",
|
||||
"if delete_all:\n",
|
||||
" # Delete the dataset using the Vertex dataset object\n",
|
||||
" try:\n",
|
||||
" if \"dataset\" in globals():\n",
|
||||
" dataset.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"# Delete the dataset using the Vertex dataset object\n",
|
||||
"dataset.delete()\n",
|
||||
"\n",
|
||||
" # Delete the model using the Vertex model object\n",
|
||||
" try:\n",
|
||||
" if \"model\" in globals():\n",
|
||||
" model.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"# Delete the temporary BigQuery dataset\n",
|
||||
"! bq rm -r -f $PROJECT_ID:$DATASET_ID\n",
|
||||
"\n",
|
||||
" # Delete the endpoint using the Vertex endpoint object\n",
|
||||
" try:\n",
|
||||
" if \"endpoint\" in globals():\n",
|
||||
" endpoint.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the AutoML or Pipeline training job\n",
|
||||
" try:\n",
|
||||
" if \"dag\" in globals():\n",
|
||||
" dag.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the custom training job\n",
|
||||
" try:\n",
|
||||
" if \"job\" in globals():\n",
|
||||
" job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the batch prediction job using the Vertex batch prediction object\n",
|
||||
" try:\n",
|
||||
" if \"batch_predict_job\" in globals():\n",
|
||||
" batch_predict_job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
|
||||
" try:\n",
|
||||
" if \"hpt_job\" in globals():\n",
|
||||
" hpt_job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" if \"BUCKET_NAME\" in globals():\n",
|
||||
" ! gsutil rm -r $BUCKET_NAME"
|
||||
"delete_storage = False\n",
|
||||
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
|
||||
" # Delete the created GCS bucket\n",
|
||||
" ! gsutil rm -r $BUCKET_URI\n",
|
||||
" # Delete the created BigQuery datasets\n",
|
||||
" ! bq rm -r -f $PROJECT_ID:$BQ_MY_DATASET"
|
||||
]
|
||||
}
|
||||
],
|
||||
|
||||
@@ -33,14 +33,20 @@
|
||||
"\n",
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/get_started_dataflow.ipynb\">\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/get_started_dataflow.ipynb\">\n",
|
||||
" Open in Google Cloud Notebooks\n",
|
||||
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
|
||||
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
|
||||
" Open in Vertex AI Workbench\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>\n",
|
||||
@@ -59,17 +65,6 @@
|
||||
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 1 : data management: get started with Dataflow."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dataset:gsod,lrg"
|
||||
},
|
||||
"source": [
|
||||
"### Dataset\n",
|
||||
"\n",
|
||||
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -131,6 +126,34 @@
|
||||
"Alternately for AutoML tabular model training, you can reconfigure the otherwise default preprocessing."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dataset:gsod,lrg"
|
||||
},
|
||||
"source": [
|
||||
"### Dataset\n",
|
||||
"\n",
|
||||
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9e483012a752"
|
||||
},
|
||||
"source": [
|
||||
"### Costs\n",
|
||||
"This tutorial uses billable components of Google Cloud:\n",
|
||||
"\n",
|
||||
"- Vertex AI\n",
|
||||
"- Cloud Storage\n",
|
||||
"- BigQuery\n",
|
||||
"- Dataflow\n",
|
||||
"\n",
|
||||
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing), and [Dataflow pricing](https://cloud.google.com/dataflow/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -139,7 +162,7 @@
|
||||
"source": [
|
||||
"## Installations\n",
|
||||
"\n",
|
||||
"Install *one time* the packages for executing the MLOps notebooks."
|
||||
"Install the following packages to execute this notebook."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -150,18 +173,26 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"ONCE_ONLY = False\n",
|
||||
"if ONCE_ONLY:\n",
|
||||
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG"
|
||||
"import os\n",
|
||||
"\n",
|
||||
"# The Vertex AI Workbench Notebook product has specific requirements\n",
|
||||
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\") and not os.getenv(\"VIRTUAL_ENV\")\n",
|
||||
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
|
||||
" \"/opt/deeplearning/metadata/env_version\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
|
||||
"USER_FLAG = \"\"\n",
|
||||
"if IS_WORKBENCH_NOTEBOOK:\n",
|
||||
" USER_FLAG = \"--user\"\n",
|
||||
"\n",
|
||||
"! pip3 install -U tensorflow==2.5 $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-transform==1.2 $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade apache-beam[gcp] $USER_FLAG -q"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -193,6 +224,32 @@
|
||||
" app.kernel.do_shutdown(True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "84cd83853240"
|
||||
},
|
||||
"source": [
|
||||
"## Before you begin\n",
|
||||
"\n",
|
||||
"### Set up your Google Cloud project\n",
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
|
||||
"\n",
|
||||
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
|
||||
"\n",
|
||||
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
|
||||
"\n",
|
||||
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
|
||||
"\n",
|
||||
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
|
||||
"Cloud SDK uses the right project for all the commands in this notebook.\n",
|
||||
"\n",
|
||||
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -258,7 +315,7 @@
|
||||
"\n",
|
||||
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
|
||||
"\n",
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)"
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -269,7 +326,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"REGION = \"us-central1\" # @param {type: \"string\"}"
|
||||
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
|
||||
"\n",
|
||||
"if REGION == \"[your-region]\":\n",
|
||||
" REGION = \"us-central1\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -296,6 +356,67 @@
|
||||
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "77c385f0db59"
|
||||
},
|
||||
"source": [
|
||||
"### Authenticate your Google Cloud account\n",
|
||||
"\n",
|
||||
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
|
||||
"\n",
|
||||
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
|
||||
"\n",
|
||||
"**Otherwise**, follow these steps:\n",
|
||||
"\n",
|
||||
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
|
||||
"\n",
|
||||
"1. **Click Create service account**.\n",
|
||||
"\n",
|
||||
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
|
||||
"\n",
|
||||
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
|
||||
"\n",
|
||||
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
|
||||
"\n",
|
||||
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "535223fa4b84"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If on Vertex AI Workbench, then don't execute this code\n",
|
||||
"IS_COLAB = False\n",
|
||||
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
|
||||
" \"DL_ANACONDA_HOME\"\n",
|
||||
"):\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" IS_COLAB = True\n",
|
||||
" from google.colab import auth as google_auth\n",
|
||||
"\n",
|
||||
" google_auth.authenticate_user()\n",
|
||||
"\n",
|
||||
" # If you are running this notebook locally, replace the string below with the\n",
|
||||
" # path to your service account key and run this cell to authenticate your GCP\n",
|
||||
" # account.\n",
|
||||
" elif not os.getenv(\"IS_TESTING\"):\n",
|
||||
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -324,7 +445,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
|
||||
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
|
||||
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -335,8 +457,9 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
|
||||
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -356,7 +479,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil mb -l $REGION $BUCKET_NAME"
|
||||
"! gsutil mb -l $REGION $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -376,7 +499,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
"! gsutil ls -al $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -399,7 +522,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import google.cloud.aiplatform as aip"
|
||||
"import google.cloud.aiplatform as aiplatform"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -474,7 +597,7 @@
|
||||
"id": "import_numpy"
|
||||
},
|
||||
"source": [
|
||||
"#### Import pandas\n",
|
||||
"#### Import numpy\n",
|
||||
"\n",
|
||||
"Import the numpy package into your Python environment."
|
||||
]
|
||||
@@ -540,9 +663,9 @@
|
||||
"id": "init_aip:mbsdk,region"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK for Python\n",
|
||||
"### Initialize Vertex AI SDK for Python\n",
|
||||
"\n",
|
||||
"Initialize the Vertex SDK for Python for your project and corresponding bucket."
|
||||
"Initialize the Vertex AI SDK for Python for your project and corresponding bucket."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -553,7 +676,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"aip.init(project=PROJECT_ID, location=REGION)"
|
||||
"aiplatform.init(project=PROJECT_ID, location=REGION)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -674,6 +797,31 @@
|
||||
"dataframe[\"station_number\"] = pd.to_numeric(dataframe[\"station_number\"])"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "bqml_create_dataset"
|
||||
},
|
||||
"source": [
|
||||
"### Create BQ dataset resource\n",
|
||||
"\n",
|
||||
"First, you create an empty dataset resource in your project."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "bqml_create_dataset"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BQ_MY_DATASET = 'samples'\n",
|
||||
"BQ_MY_TABLE = 'gsod'\n",
|
||||
"! bq --location=US mk -d \\\n",
|
||||
"$PROJECT_ID:$BQ_MY_DATASET"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -977,7 +1125,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"SCHEMA_LOCATION = BUCKET_NAME + \"/schema.txt\"\n",
|
||||
"SCHEMA_LOCATION = BUCKET_URI + \"/schema.txt\"\n",
|
||||
"\n",
|
||||
"# When running Apache Beam directly (file is directly accessed)\n",
|
||||
"tfdv.write_schema_text(output_path=SCHEMA_LOCATION, schema=schema)\n",
|
||||
@@ -1122,7 +1270,7 @@
|
||||
" )\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"EXPORTED_DATA_PREFIX = os.path.join(BUCKET_NAME, \"exported_data\")\n",
|
||||
"EXPORTED_DATA_PREFIX = os.path.join(BUCKET_URI, \"exported_data\")\n",
|
||||
"\n",
|
||||
"QUERY_STRING = \"SELECT {},{} FROM {} LIMIT 500\".format(\n",
|
||||
" \"CAST(station_number as STRING) AS station_number,year,month,day\",\n",
|
||||
@@ -1135,7 +1283,7 @@
|
||||
" \"runner\": RUNNER,\n",
|
||||
" \"raw_data_query\": QUERY_STRING,\n",
|
||||
" \"exported_data_prefix\": EXPORTED_DATA_PREFIX,\n",
|
||||
" \"temp_location\": os.path.join(BUCKET_NAME, \"temp\"),\n",
|
||||
" \"temp_location\": os.path.join(BUCKET_URI, \"temp\"),\n",
|
||||
" \"project\": PROJECT_ID,\n",
|
||||
" \"region\": REGION,\n",
|
||||
" \"setup_file\": \"./setup.py\",\n",
|
||||
@@ -1160,17 +1308,7 @@
|
||||
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
|
||||
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
|
||||
"\n",
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
|
||||
"\n",
|
||||
"- Dataset\n",
|
||||
"- Pipeline\n",
|
||||
"- Model\n",
|
||||
"- Endpoint\n",
|
||||
"- AutoML Training Job\n",
|
||||
"- Batch Job\n",
|
||||
"- Custom Job\n",
|
||||
"- Hyperparameter Tuning Job\n",
|
||||
"- Cloud Storage Bucket"
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1181,60 +1319,11 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"delete_all = True\n",
|
||||
"delete_storage = True\n",
|
||||
"\n",
|
||||
"if delete_all:\n",
|
||||
" # Delete the dataset using the Vertex dataset object\n",
|
||||
" try:\n",
|
||||
" if \"dataset\" in globals():\n",
|
||||
" dataset.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the model using the Vertex model object\n",
|
||||
" try:\n",
|
||||
" if \"model\" in globals():\n",
|
||||
" model.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the endpoint using the Vertex endpoint object\n",
|
||||
" try:\n",
|
||||
" if \"endpoint\" in globals():\n",
|
||||
" endpoint.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the AutoML or Pipeline training job\n",
|
||||
" try:\n",
|
||||
" if \"dag\" in globals():\n",
|
||||
" dag.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the custom training job\n",
|
||||
" try:\n",
|
||||
" if \"job\" in globals():\n",
|
||||
" job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the batch prediction job using the Vertex batch prediction object\n",
|
||||
" try:\n",
|
||||
" if \"batch_predict_job\" in globals():\n",
|
||||
" batch_predict_job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
|
||||
" try:\n",
|
||||
" if \"hpt_job\" in globals():\n",
|
||||
" hpt_job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" if \"BUCKET_NAME\" in globals():\n",
|
||||
" ! gsutil rm -r $BUCKET_NAME"
|
||||
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
|
||||
" if \"BUCKET_URI\" in globals():\n",
|
||||
" ! gsutil rm -r $BUCKET_URI"
|
||||
]
|
||||
}
|
||||
],
|
||||
|
||||
@@ -8,7 +8,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"# Copyright 2022 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
@@ -29,20 +29,26 @@
|
||||
"id": "title:generic,gcp"
|
||||
},
|
||||
"source": [
|
||||
"# E2E ML on GCP: MLOps stage 1 : data management: get started with Vertex datasets\n",
|
||||
"# E2E ML on GCP: MLOps stage 1 : data management: get started with Vertex AI datasets\n",
|
||||
"\n",
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/get_started_vertex_datasets.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_vertex_datasets.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/get_started_vertex_datasets.ipynb\">\n",
|
||||
" Open in Google Cloud Notebooks\n",
|
||||
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_vertex_datasets.ipynb\">\n",
|
||||
"<img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/get_started_vertex_datasets.ipynb\">\n",
|
||||
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
|
||||
" Open in Vertex AI Workbench\n",
|
||||
" </a>\n",
|
||||
" </td> \n",
|
||||
"</table>\n",
|
||||
"<br/><br/><br/>"
|
||||
]
|
||||
@@ -67,16 +73,16 @@
|
||||
"source": [
|
||||
"### Objective\n",
|
||||
"\n",
|
||||
"In this tutorial, you learn how to use `Vertex Dataset` for training with `Vertex AI`.\n",
|
||||
"In this tutorial, you learn how to use `Vertex AI Dataset` for training with `Vertex AI`.\n",
|
||||
"\n",
|
||||
"This tutorial uses the following Google Cloud ML services:\n",
|
||||
"\n",
|
||||
"- `Vertex Datasets`\n",
|
||||
"- `Vertex AI Datasets`\n",
|
||||
"- `BigQuery Datasets`\n",
|
||||
"\n",
|
||||
"The steps performed include:\n",
|
||||
"\n",
|
||||
"- Create a Vertex `Dataset` resource for:\n",
|
||||
"- Create a Vertex AI `Dataset` resource for:\n",
|
||||
" - image data\n",
|
||||
" - text data\n",
|
||||
" - video data\n",
|
||||
@@ -100,7 +106,7 @@
|
||||
"source": [
|
||||
"### Recommendations\n",
|
||||
"\n",
|
||||
"When doing E2E MLOps on Google Cloud, the following best practices with Vertex Datasets:\n",
|
||||
"When doing E2E MLOps on Google Cloud, the following best practices with Vertex AI Datasets:\n",
|
||||
"\n",
|
||||
"- Use CSV index file format for image data\n",
|
||||
"- Use CSV index file format for text data:\n",
|
||||
@@ -116,7 +122,7 @@
|
||||
"\n",
|
||||
"- Use `filter` and `order_by` parameters in the `list()` methods to find the latest versions of datasets.\n",
|
||||
"\n",
|
||||
"- When custom training with a `Vertex Dataset`:\n",
|
||||
"- When custom training with a `Vertex AI Dataset`:\n",
|
||||
" - tabular data :\n",
|
||||
" - Use the CSV index file or BigQuery table reference.\n",
|
||||
" - Create a tf.data.Dataset generator from the CSV index file/BigQuery table.\n",
|
||||
@@ -133,6 +139,33 @@
|
||||
" - Create a tf.data.Dataset from the TFRecords."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "533dd6fe83c8"
|
||||
},
|
||||
"source": [
|
||||
"### Datasets\n",
|
||||
"\n",
|
||||
"This tutorial uses a variety of public datasets to demonstrate using a `Vertex AI` managed dataset."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9e483012a752"
|
||||
},
|
||||
"source": [
|
||||
"### Costs\n",
|
||||
"This tutorial uses billable components of Google Cloud:\n",
|
||||
"\n",
|
||||
"- Vertex AI\n",
|
||||
"- Cloud Storage\n",
|
||||
"- BigQuery\n",
|
||||
"\n",
|
||||
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -141,7 +174,7 @@
|
||||
"source": [
|
||||
"## Installations\n",
|
||||
"\n",
|
||||
"Install *one time* the packages for executing the MLOps notebooks."
|
||||
"Install the packages required for executing this notebook."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -152,18 +185,27 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"ONCE_ONLY = False\n",
|
||||
"if ONCE_ONLY:\n",
|
||||
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG"
|
||||
"import os\n",
|
||||
"\n",
|
||||
"# The Vertex AI Workbench Notebook product has specific requirements\n",
|
||||
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\") and not os.getenv(\"VIRTUAL_ENV\")\n",
|
||||
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
|
||||
" \"/opt/deeplearning/metadata/env_version\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
|
||||
"USER_FLAG = \"\"\n",
|
||||
"if IS_WORKBENCH_NOTEBOOK:\n",
|
||||
" USER_FLAG = \"--user\"\n",
|
||||
"\n",
|
||||
"! pip3 install -U tensorflow $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-data-validation $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-transform $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-io $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
|
||||
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q\n",
|
||||
"! pip3 install --upgrade db-dtypes $USER_FLAG -q! pip3 install --upgrade future $USER_FLAG -q"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -195,6 +237,32 @@
|
||||
" app.kernel.do_shutdown(True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "cb082379ed5b"
|
||||
},
|
||||
"source": [
|
||||
"## Before you begin\n",
|
||||
"\n",
|
||||
"### Set up your Google Cloud project\n",
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
|
||||
"\n",
|
||||
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
|
||||
"\n",
|
||||
"1. [Enable the Vertex AI API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com). \n",
|
||||
"\n",
|
||||
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
|
||||
"\n",
|
||||
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
|
||||
"Cloud SDK uses the right project for all the commands in this notebook.\n",
|
||||
"\n",
|
||||
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -221,7 +289,7 @@
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "autoset_project_id"
|
||||
"id": "nWlzLu5ELxWd"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
@@ -236,7 +304,7 @@
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "set_gcloud_project_id"
|
||||
"id": "c021ca495967"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
@@ -260,7 +328,7 @@
|
||||
"\n",
|
||||
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
|
||||
"\n",
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)"
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -271,7 +339,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"REGION = \"us-central1\" # @param {type: \"string\"}"
|
||||
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
|
||||
"\n",
|
||||
"if REGION == \"[your-region]\":\n",
|
||||
" REGION = \"us-central1\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -298,6 +369,66 @@
|
||||
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "927085b84a07"
|
||||
},
|
||||
"source": [
|
||||
"### Authenticate your Google Cloud account\n",
|
||||
"\n",
|
||||
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
|
||||
"\n",
|
||||
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
|
||||
"\n",
|
||||
"**Otherwise**, follow these steps:\n",
|
||||
"\n",
|
||||
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
|
||||
"\n",
|
||||
"**Click Create service account**.\n",
|
||||
"\n",
|
||||
"In the **Service account name** field, enter a name, and click **Create**.\n",
|
||||
"\n",
|
||||
"In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex\" into the filter box, and select **Vertex Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
|
||||
"\n",
|
||||
"Click Create. A JSON file that contains your key downloads to your local environment.\n",
|
||||
"\n",
|
||||
"Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "89788a802687"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If on Vertex AI Workbench, then don't execute this code\n",
|
||||
"IS_COLAB = \"google.colab\" in sys.modules\n",
|
||||
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
|
||||
" \"DL_ANACONDA_HOME\"\n",
|
||||
"):\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" from google.colab import auth as google_auth\n",
|
||||
"\n",
|
||||
" google_auth.authenticate_user()\n",
|
||||
"\n",
|
||||
" # If you are running this notebook locally, replace the string below with the\n",
|
||||
" # path to your service account key and run this cell to authenticate your GCP\n",
|
||||
" # account.\n",
|
||||
" elif not os.getenv(\"IS_TESTING\"):\n",
|
||||
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -326,7 +457,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
|
||||
"BUCKET_URI = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -337,8 +468,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
|
||||
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_URI = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -358,7 +489,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil mb -l $REGION $BUCKET_NAME"
|
||||
"! gsutil mb -l $REGION $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -378,7 +509,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
"! gsutil ls -al $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -390,7 +521,11 @@
|
||||
"### Set up variables\n",
|
||||
"\n",
|
||||
"Next, set up some variables used throughout the tutorial.\n",
|
||||
"### Import libraries and define constants"
|
||||
"### Import libraries and define constants\n",
|
||||
"\n",
|
||||
"Import the BigQuery package, TensorFlow Data Validation (TFDV) package and TensorFlow Data Validation package into your Python environment. \n",
|
||||
"\n",
|
||||
"Import TensorFlow Transform (TFT) package and pandas into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -401,106 +536,22 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import google.cloud.aiplatform as aip"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_bq"
|
||||
},
|
||||
"source": [
|
||||
"#### Import BigQuery\n",
|
||||
"\n",
|
||||
"Import the BigQuery package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_bq"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import google.cloud.aiplatform as aip\n",
|
||||
"import pandas as pd\n",
|
||||
"import tensorflow_data_validation as tfdv\n",
|
||||
"import tensorflow_transform as tft\n",
|
||||
"from google.cloud import bigquery"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_tfdv"
|
||||
},
|
||||
"source": [
|
||||
"#### Import TensorFlow Data Validation\n",
|
||||
"\n",
|
||||
"Import the TensorFlow Data Validation (TFDV) package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_tfdv"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import tensorflow_data_validation as tfdv"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_tft"
|
||||
},
|
||||
"source": [
|
||||
"#### Import TensorFlow Transform\n",
|
||||
"\n",
|
||||
"Import the TensorFlow Transform (TFT) package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_tft"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import tensorflow_transform as tft"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "import_pandas"
|
||||
},
|
||||
"source": [
|
||||
"#### Import pandas\n",
|
||||
"\n",
|
||||
"Import the pandas package into your Python environment."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_pandas"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import pandas as pd"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "init_aip:mbsdk,region"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK for Python\n",
|
||||
"### Initialize Vertex AI SDK for Python\n",
|
||||
"\n",
|
||||
"Initialize the Vertex SDK for Python for your project and corresponding bucket."
|
||||
"Initialize the Vertex AI SDK for Python for your project and corresponding bucket."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -511,7 +562,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"aip.init(project=PROJECT_ID, location=REGION)"
|
||||
"aip.init(project=PROJECT_ID, location=REGION, staging_bucket=BUCKET_URI)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -542,9 +593,9 @@
|
||||
"id": "dataset_intro"
|
||||
},
|
||||
"source": [
|
||||
"## Vertex Datasets\n",
|
||||
"## Vertex AI Datasets\n",
|
||||
"\n",
|
||||
"Vertex `Datasets` are the means for managing your datasets within Vertex AI services. Vertex Datasets are also referred to as `Dataset` resources. There are four types of `Dataset` resources, specific to the data type:\n",
|
||||
"Vertex AI `Datasets` are the means for managing your datasets within Vertex AI services. Vertex AI Datasets are also referred to as `Dataset` resources. There are four types of `Dataset` resources, specific to the data type:\n",
|
||||
"\n",
|
||||
"- `ImageDataset`: image data\n",
|
||||
"- `TabularDataset`: tabular (structured) data\n",
|
||||
@@ -552,7 +603,7 @@
|
||||
"- `VideoDataset`: video data\n",
|
||||
"- `TimeSeriesDataset`: forecasting data\n",
|
||||
"\n",
|
||||
"A Vertex `Dataset` provides the following capabilities:\n",
|
||||
"A Vertex AI `Dataset` provides the following capabilities:\n",
|
||||
"\n",
|
||||
"- A unique internal identifier for automatic (programatic) processes.\n",
|
||||
"- A user specificed (display name) identifier for interactive processes.\n",
|
||||
@@ -565,26 +616,13 @@
|
||||
"Learn more about [All dataset documentation](https://cloud.google.com/vertex-ai/docs/datasets/datasets)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:flowers,csv,icn"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = (\n",
|
||||
" \"gs://cloud-samples-data/vision/automl_classification/flowers/all_data_v2.csv\"\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "create_dataset:image,icn"
|
||||
},
|
||||
"source": [
|
||||
"### Create the Dataset\n",
|
||||
"### Create an Image Dataset\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `ImageDataset` class, which takes the following parameters:\n",
|
||||
"\n",
|
||||
@@ -599,6 +637,19 @@
|
||||
"Learn more about [ImageDataset](https://cloud.google.com/vertex-ai/docs/datasets/prepare-image)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:flowers,csv,icn"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = (\n",
|
||||
" \"gs://cloud-samples-data/vision/automl_classification/flowers/all_data_v2.csv\"\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -616,24 +667,13 @@
|
||||
"print(dataset.resource_name)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:hmdb,csv,vcn"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"gs://automl-video-demo-data/hmdb_split1_5classes_train_inf.csv\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "create_dataset:video,vcn"
|
||||
},
|
||||
"source": [
|
||||
"### Create the Dataset\n",
|
||||
"### Create a Video Dataset\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `VideoDataset` class, which takes the following parameters:\n",
|
||||
"\n",
|
||||
@@ -647,6 +687,17 @@
|
||||
"Learn more about [VideoDataset](https://cloud.google.com/vertex-ai/docs/datasets/prepare-video)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:hmdb,csv,vcn"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"gs://automl-video-demo-data/hmdb_split1_5classes_train_inf.csv\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -664,24 +715,13 @@
|
||||
"print(dataset.resource_name)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:happydb,csv,tcn"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"gs://cloud-ml-data/NL-classification/happiness.csv\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "create_dataset:text,tcn"
|
||||
},
|
||||
"source": [
|
||||
"### Create the Dataset\n",
|
||||
"### Create a Text Dataset\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `TextDataset` class, which takes the following parameters:\n",
|
||||
"\n",
|
||||
@@ -696,6 +736,17 @@
|
||||
"Learn more about [TextDataset](https://cloud.google.com/vertex-ai/docs/datasets/prepare-text)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:happydb,csv,tcn"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"gs://cloud-ml-data/NL-classification/happiness.csv\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -713,6 +764,24 @@
|
||||
"print(dataset.resource_name)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "create_dataset:tabular,bq,lrg,v2"
|
||||
},
|
||||
"source": [
|
||||
"### Create a Tabular Dataset\n",
|
||||
"\n",
|
||||
"#### CSV input data\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `TabularDataset` class for CSV input data, which takes the following parameters:\n",
|
||||
"\n",
|
||||
"- `display_name`: The human readable name for the `Dataset` resource.\n",
|
||||
"- `gcs_source`: A list of one or more dataset index files to import the data items into the `Dataset` resource.\n",
|
||||
"\n",
|
||||
"Learn more about [TabularDataset from CSV files](https://cloud.google.com/vertex-ai/docs/datasets/create-dataset-api#aiplatform_create_dataset_tabular_gcs_sample-python)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -721,27 +790,50 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"bq://bigquery-public-data.samples.gsod\"\n",
|
||||
"BQ_TABLE = \"bigquery-public-data.samples.gsod\""
|
||||
"IMPORT_FILE = \"gs://cloud-samples-data/tables/iris_1000.csv\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "create_dataset:tabular,bq,lrg,v2"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"dataset = aip.TabularDataset.create(\n",
|
||||
" display_name=\"example\" + \"_\" + TIMESTAMP, gcs_source=[IMPORT_FILE]\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"print(dataset.resource_name)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "create_dataset:tabular,bq,lrg,v2"
|
||||
"id": "854dd1e0195c"
|
||||
},
|
||||
"source": [
|
||||
"### Create the Dataset\n",
|
||||
"#### BigQuery input data\n",
|
||||
"\n",
|
||||
"#### CSV input data\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `TabularDataset` class, which takes the following parameters:\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `TabularDataset` class for BigQuery table input, which takes the following parameters:\n",
|
||||
"\n",
|
||||
"- `display_name`: The human readable name for the `Dataset` resource.\n",
|
||||
"- `gcs_source`: A list of one or more dataset index files to import the data items into the `Dataset` resource.\n",
|
||||
"- `labels`: User defined metadata. In this example, you store the location of the Cloud Storage bucket containing the user defined data.\n",
|
||||
"- `bq_source`: A list of one or more BigQuery tables to import the data items into the `Dataset` resource.\n",
|
||||
"\n",
|
||||
"Learn more about [TabularDataset from CSV files](https://cloud.google.com/vertex-ai/docs/datasets/create-dataset-api#aiplatform_create_dataset_tabular_gcs_sample-python)"
|
||||
"Learn more about [TabularDataset from BigQuery table](https://cloud.google.com/vertex-ai/docs/datasets/create-dataset-api#aiplatform_create_dataset_tabular_bigquery_sample-pythonn)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "86343c146300"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"bq://bigquery-public-data.samples.gsod\"\n",
|
||||
"BQ_TABLE = \"bigquery-public-data.samples.gsod\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -759,15 +851,63 @@
|
||||
"print(dataset.resource_name)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "82e9fe20ce71"
|
||||
},
|
||||
"source": [
|
||||
"#### Dataframe input data\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create_from_dataframe` method for the `TabularDataset` class for pandas dataframe input, which takes the following parameters:\n",
|
||||
"\n",
|
||||
"- `display_name`: The human readable name for the `Dataset` resource.\n",
|
||||
"- `df_source`: The pandas dataframe to import the data items into the `Dataset` resource.\n",
|
||||
"- `staging_path`: The BigQuery table to store the imported data."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:covid,csv,forecast"
|
||||
"id": "3805f945ffdd"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"gs://cloud-samples-data/ai-platform/covid/bigquery-public-covid-nyt-us-counties-train.csv\""
|
||||
"# Download the table.\n",
|
||||
"table = bigquery.TableReference.from_string(BQ_TABLE)\n",
|
||||
"\n",
|
||||
"rows = bqclient.list_rows(\n",
|
||||
" table,\n",
|
||||
" max_results=10000,\n",
|
||||
" selected_fields=[\n",
|
||||
" bigquery.SchemaField(\"station_number\", \"STRING\"),\n",
|
||||
" bigquery.SchemaField(\"year\", \"INTEGER\"),\n",
|
||||
" bigquery.SchemaField(\"month\", \"INTEGER\"),\n",
|
||||
" bigquery.SchemaField(\"day\", \"INTEGER\"),\n",
|
||||
" bigquery.SchemaField(\"mean_temp\", \"FLOAT\"),\n",
|
||||
" ],\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"dataframe = rows.to_dataframe()\n",
|
||||
"print(dataframe.head())"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "create_dataset:tabular,bq,lrg,v2"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"dataset = aip.TabularDataset.create_from_dataframe(\n",
|
||||
" display_name=\"example\" + \"_\" + TIMESTAMP,\n",
|
||||
" df_source=dataframe,\n",
|
||||
" staging_path=f\"bq://{PROJECT_ID}.samples.gsod\",\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"print(dataset.resource_name)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -776,7 +916,7 @@
|
||||
"id": "create_dataset:tabular,forecast,v2"
|
||||
},
|
||||
"source": [
|
||||
"### Create the Dataset\n",
|
||||
"### Create a Time Series Dataset\n",
|
||||
"\n",
|
||||
"Next, create the `Dataset` resource using the `create` method for the `TimeSeriesDataset` class, which takes the following parameters:\n",
|
||||
"\n",
|
||||
@@ -787,6 +927,17 @@
|
||||
"Learn more about [TimeSeriesDataset](https://cloud.google.com/vertex-ai/docs/datasets/prepare-tabular)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "import_file:covid,csv,forecast"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"IMPORT_FILE = \"gs://cloud-samples-data/ai-platform/covid/bigquery-public-covid-nyt-us-counties-train.csv\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -809,7 +960,7 @@
|
||||
"id": "dataset_intro:methods"
|
||||
},
|
||||
"source": [
|
||||
"## Vertex Dataset properties and methods\n",
|
||||
"## Vertex AI Dataset properties and methods\n",
|
||||
"\n",
|
||||
"The following are the `Dataset` methods:\n",
|
||||
"\n",
|
||||
@@ -898,7 +1049,7 @@
|
||||
"source": [
|
||||
"## TensorFlow Data Validation\n",
|
||||
"\n",
|
||||
"The TensorFlow Data Validation (TFDV) package is used in conjunction with Vertex and BigQuery datasets for:\n",
|
||||
"The TensorFlow Data Validation (TFDV) package is used in conjunction with Vertex AI and BigQuery datasets for:\n",
|
||||
"\n",
|
||||
"- Generating dataset statistics.\n",
|
||||
"- Generating data schema for data validation.\n",
|
||||
@@ -1147,9 +1298,9 @@
|
||||
"comps = BQ_TABLE.split(\".\")\n",
|
||||
"BQ_PROJECT_DATASET_TABLE = comps[0] + \":\" + comps[1] + \".\" + comps[2]\n",
|
||||
"\n",
|
||||
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_NAME/mydata*.csv\n",
|
||||
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_URI/mydata*.csv\n",
|
||||
"\n",
|
||||
"IMPORT_FILES = ! gsutil ls $BUCKET_NAME/mydata*.csv\n",
|
||||
"IMPORT_FILES = ! gsutil ls $BUCKET_URI/mydata*.csv\n",
|
||||
"\n",
|
||||
"print(IMPORT_FILES)\n",
|
||||
"\n",
|
||||
@@ -1207,6 +1358,38 @@
|
||||
"To create a dataframe from multiple CSV sources, you read each CSV file and concatenate the dataframes together."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "bcd2e4e0703b"
|
||||
},
|
||||
"source": [
|
||||
"If you are running this notebook on Colab, run the following cell to install packages fsspec and gcsfs."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "927bd3f92268"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If on Workbench AI Notebook, then don't execute this code\n",
|
||||
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\"):\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" ! pip3 install fsspec\n",
|
||||
" ! pip3 install gcsfs"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -1267,7 +1450,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"EXPORTED_DIR = f\"{BUCKET_NAME}/exported\"\n",
|
||||
"EXPORTED_DIR = f\"{BUCKET_URI}/exported\"\n",
|
||||
"exported_files = dataset.export_data(output_dir=EXPORTED_DIR)\n",
|
||||
"\n",
|
||||
"! gsutil ls $EXPORTED_DIR"
|
||||
@@ -1496,7 +1679,7 @@
|
||||
" data = f.readlines()\n",
|
||||
"\n",
|
||||
"# The path to the TFRecord cached file.\n",
|
||||
"GCS_TFRECORD_URI = BUCKET_NAME + \"/flowers.tfrecord\"\n",
|
||||
"GCS_TFRECORD_URI = BUCKET_URI + \"/flowers.tfrecord\"\n",
|
||||
"\n",
|
||||
"# Create the TFRecord cached file\n",
|
||||
"with tf.io.TFRecordWriter(GCS_TFRECORD_URI) as writer:\n",
|
||||
@@ -1530,14 +1713,7 @@
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
|
||||
"\n",
|
||||
"- Dataset\n",
|
||||
"- Pipeline\n",
|
||||
"- Model\n",
|
||||
"- Endpoint\n",
|
||||
"- AutoML Training Job\n",
|
||||
"- Batch Job\n",
|
||||
"- Custom Job\n",
|
||||
"- Hyperparameter Tuning Job\n",
|
||||
"- Cloud Storage Bucket"
|
||||
"- Bucket"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1548,60 +1724,16 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"delete_all = True\n",
|
||||
"delete_bucket = False\n",
|
||||
"\n",
|
||||
"if delete_all:\n",
|
||||
" # Delete the dataset using the Vertex dataset object\n",
|
||||
" try:\n",
|
||||
" if \"dataset\" in globals():\n",
|
||||
" dataset.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"# Delete the dataset using the Vertex dataset object\n",
|
||||
"datasets = aip.TabularDataset.list(filter=f'display_name=\"example_{TIMESTAMP}\"')\n",
|
||||
"for dataset in datasets:\n",
|
||||
" dataset.delete()\n",
|
||||
"\n",
|
||||
" # Delete the model using the Vertex model object\n",
|
||||
" try:\n",
|
||||
" if \"model\" in globals():\n",
|
||||
" model.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the endpoint using the Vertex endpoint object\n",
|
||||
" try:\n",
|
||||
" if \"endpoint\" in globals():\n",
|
||||
" endpoint.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the AutoML or Pipeline training job\n",
|
||||
" try:\n",
|
||||
" if \"dag\" in globals():\n",
|
||||
" dag.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the custom training job\n",
|
||||
" try:\n",
|
||||
" if \"job\" in globals():\n",
|
||||
" job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the batch prediction job using the Vertex batch prediction object\n",
|
||||
" try:\n",
|
||||
" if \"batch_predict_job\" in globals():\n",
|
||||
" batch_predict_job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
|
||||
" try:\n",
|
||||
" if \"hpt_job\" in globals():\n",
|
||||
" hpt_job.delete()\n",
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" if \"BUCKET_NAME\" in globals():\n",
|
||||
" ! gsutil rm -r $BUCKET_NAME"
|
||||
"# Delete the bucket\n",
|
||||
"if delete_bucket or os.getenv(\"IS_TESTING\"):\n",
|
||||
" ! gsutil rm -r $BUCKET_URI"
|
||||
]
|
||||
}
|
||||
],
|
||||
|
||||
@@ -33,14 +33,20 @@
|
||||
"\n",
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/mlops_data_management.ipynb\">\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/mlops_data_management.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official/automl/ml_ops_stage1/mlops_data_management.ipynb\">\n",
|
||||
" Open in Google Cloud Notebooks\n",
|
||||
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/mlops_data_management.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/mlops_data_management.ipynb\">\n",
|
||||
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
|
||||
" Open in Vertex AI Workbench\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>\n",
|
||||
@@ -59,17 +65,6 @@
|
||||
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 1 : data management."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dataset:bq,chicago,lbn"
|
||||
},
|
||||
"source": [
|
||||
"### Dataset\n",
|
||||
"\n",
|
||||
"The dataset used for this tutorial is the [Chicago Taxi](https://www.kaggle.com/chicago/chicago-taxi-trips-bq). The version of the dataset you will use in this tutorial is stored in a public BigQuery table. The trained model predicts whether someone would leave a tip for a taxi fare."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -114,6 +109,34 @@
|
||||
" - Preprocess the data with `Dataflow`"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "dataset:bq,chicago,lbn"
|
||||
},
|
||||
"source": [
|
||||
"### Dataset\n",
|
||||
"\n",
|
||||
"The dataset used for this tutorial is the [Chicago Taxi](https://www.kaggle.com/chicago/chicago-taxi-trips-bq). The version of the dataset used in this tutorial is stored in a public BigQuery table. The trained model predicts whether someone leaves a tip for a taxi fare."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9e483012a752"
|
||||
},
|
||||
"source": [
|
||||
"### Costs\n",
|
||||
"This tutorial uses billable components of Google Cloud:\n",
|
||||
"\n",
|
||||
"- Vertex AI\n",
|
||||
"- Cloud Storage\n",
|
||||
"- BigQuery\n",
|
||||
"- Dataflow\n",
|
||||
"\n",
|
||||
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing), and [Dataflow pricing](https://cloud.google.com/dataflow/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -133,19 +156,34 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"ONCE_ONLY = False\n",
|
||||
"import os\n",
|
||||
"\n",
|
||||
"# The Vertex AI Workbench Notebook product has specific requirements\n",
|
||||
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\") and not os.getenv(\"VIRTUAL_ENV\")\n",
|
||||
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
|
||||
" \"/opt/deeplearning/metadata/env_version\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
|
||||
"USER_FLAG = \"\"\n",
|
||||
"if IS_WORKBENCH_NOTEBOOK:\n",
|
||||
" USER_FLAG = \"--user\"\n",
|
||||
"\n",
|
||||
"ONCE_ONLY = True\n",
|
||||
"if ONCE_ONLY:\n",
|
||||
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
|
||||
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
|
||||
" ! pip3 install --upgrade kfp $USER_FLAG"
|
||||
" ! pip3 install -U tensorflow==2.5 $USER_FLAG -q\n",
|
||||
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG -q\n",
|
||||
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG -q\n",
|
||||
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade apache-beam[gcp]==2.33.0 $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade pyarrow $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG -q\n",
|
||||
" ! pip3 install --upgrade kfp $USER_FLAG -q\n",
|
||||
" ! pip3 install future $USER_FLAG -q"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -177,6 +215,32 @@
|
||||
" app.kernel.do_shutdown(True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "84cd83853240"
|
||||
},
|
||||
"source": [
|
||||
"## Before you begin\n",
|
||||
"\n",
|
||||
"### Set up your Google Cloud project\n",
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
|
||||
"\n",
|
||||
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
|
||||
"\n",
|
||||
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
|
||||
"\n",
|
||||
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
|
||||
"\n",
|
||||
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
|
||||
"Cloud SDK uses the right project for all the commands in this notebook.\n",
|
||||
"\n",
|
||||
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -242,7 +306,7 @@
|
||||
"\n",
|
||||
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
|
||||
"\n",
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)"
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -253,7 +317,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"REGION = \"us-central1\" # @param {type: \"string\"}"
|
||||
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
|
||||
"\n",
|
||||
"if REGION == \"[your-region]\":\n",
|
||||
" REGION = \"us-central1\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -280,6 +347,66 @@
|
||||
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "77c385f0db59"
|
||||
},
|
||||
"source": [
|
||||
"### Authenticate your Google Cloud account\n",
|
||||
"\n",
|
||||
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
|
||||
"\n",
|
||||
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
|
||||
"\n",
|
||||
"**Otherwise**, follow these steps:\n",
|
||||
"\n",
|
||||
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
|
||||
"\n",
|
||||
"1. **Click Create service account**.\n",
|
||||
"\n",
|
||||
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
|
||||
"\n",
|
||||
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
|
||||
"\n",
|
||||
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
|
||||
"\n",
|
||||
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "535223fa4b84"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If on Vertex AI Workbench, then don't execute this code\n",
|
||||
"IS_COLAB = \"google.colab\" in sys.modules\n",
|
||||
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
|
||||
" \"DL_ANACONDA_HOME\"\n",
|
||||
"):\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" from google.colab import auth as google_auth\n",
|
||||
"\n",
|
||||
" google_auth.authenticate_user()\n",
|
||||
"\n",
|
||||
" # If you are running this notebook locally, replace the string below with the\n",
|
||||
" # path to your service account key and run this cell to authenticate your GCP\n",
|
||||
" # account.\n",
|
||||
" elif not os.getenv(\"IS_TESTING\"):\n",
|
||||
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -308,7 +435,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
|
||||
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
|
||||
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -319,8 +447,9 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
|
||||
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -340,7 +469,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil mb -l $REGION $BUCKET_NAME"
|
||||
"! gsutil mb -l $REGION $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -360,7 +489,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
"! gsutil ls -al $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -515,7 +644,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
|
||||
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -537,7 +666,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"bqclient = bigquery.Client()"
|
||||
"bqclient = bigquery.Client(project=PROJECT_ID)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -660,6 +789,11 @@
|
||||
"LIMIT = 300000\n",
|
||||
"YEAR = 2020\n",
|
||||
"\n",
|
||||
"# First, create the dataset entry\n",
|
||||
"dataset = bigquery.Dataset(f\"{PROJECT_ID}.{BQ_DATASET}\")\n",
|
||||
"dataset.location = \"US\"\n",
|
||||
"dataset = bqclient.create_dataset(dataset, timeout=30)\n",
|
||||
"\n",
|
||||
"query = f\"\"\"\n",
|
||||
"CREATE OR REPLACE TABLE `{BQ_TABLE_COPY}`\n",
|
||||
"AS (\n",
|
||||
@@ -756,7 +890,7 @@
|
||||
"dataset = aip.TabularDataset.create(\n",
|
||||
" display_name=\"Chicago Taxi\" + \"_\" + TIMESTAMP,\n",
|
||||
" bq_source=[IMPORT_FILE],\n",
|
||||
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
|
||||
" labels={\"user_metadata\": BUCKET_NAME},\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"label_column = \"tip_bin\"\n",
|
||||
@@ -948,9 +1082,9 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"STATISTICS_SCHEMA = BUCKET_NAME + \"/statistics.jsonl\"\n",
|
||||
"STATISTICS_SCHEMA = BUCKET_URI + \"/statistics.jsonl\"\n",
|
||||
"\n",
|
||||
"tfdv.write_stats_text(stats, BUCKET_NAME + \"/statistics.jsonl\")\n",
|
||||
"tfdv.write_stats_text(stats, BUCKET_URI + \"/statistics.jsonl\")\n",
|
||||
"\n",
|
||||
"with tf.io.gfile.GFile(\n",
|
||||
" \"gs://\" + dataset.labels[\"user_metadata\"] + \"/metadata.jsonl\", \"r\"\n",
|
||||
@@ -963,7 +1097,7 @@
|
||||
") as f:\n",
|
||||
" json.dump(metadata, f)\n",
|
||||
"\n",
|
||||
"!gsutil cat $BUCKET_NAME/metadata.jsonl"
|
||||
"! gsutil cat $BUCKET_URI/metadata.jsonl"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1010,7 +1144,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"SCHEMA_LOCATION = BUCKET_NAME + \"/schema.txt\"\n",
|
||||
"SCHEMA_LOCATION = BUCKET_URI + \"/schema.txt\"\n",
|
||||
"\n",
|
||||
"# When running Apache Beam directly (file is directly accessed)\n",
|
||||
"tfdv.write_schema_text(output_path=SCHEMA_LOCATION, schema=schema)\n",
|
||||
@@ -1048,7 +1182,7 @@
|
||||
") as f:\n",
|
||||
" json.dump(metadata, f)\n",
|
||||
"\n",
|
||||
"!gsutil cat $BUCKET_NAME/metadata.jsonl"
|
||||
"! gsutil cat $BUCKET_URI/metadata.jsonl"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1100,7 +1234,7 @@
|
||||
"import setuptools\n",
|
||||
"\n",
|
||||
"REQUIRED_PACKAGES = [\n",
|
||||
" \"google-cloud-aiplatform==1.4.2\",\n",
|
||||
" \"google-cloud-aiplatform\",\n",
|
||||
" \"tensorflow-transform==1.2.0\",\n",
|
||||
" \"tensorflow-data-validation==1.2.0\",\n",
|
||||
"]\n",
|
||||
@@ -1371,10 +1505,10 @@
|
||||
" )\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"EXPORTED_JSONL_PREFIX = os.path.join(BUCKET_NAME, \"exported_data/jsonl\")\n",
|
||||
"EXPORTED_TFREC_PREFIX = os.path.join(BUCKET_NAME, \"exported_data/tfrec\")\n",
|
||||
"TRANSFORMED_DATA_PREFIX = os.path.join(BUCKET_NAME, \"transformed_data\")\n",
|
||||
"TRANSFORM_ARTIFACTS_DIR = os.path.join(BUCKET_NAME, \"transformed_artifacts\")\n",
|
||||
"EXPORTED_JSONL_PREFIX = os.path.join(BUCKET_URI, \"exported_data/jsonl\")\n",
|
||||
"EXPORTED_TFREC_PREFIX = os.path.join(BUCKET_URI, \"exported_data/tfrec\")\n",
|
||||
"TRANSFORMED_DATA_PREFIX = os.path.join(BUCKET_URI, \"transformed_data\")\n",
|
||||
"TRANSFORM_ARTIFACTS_DIR = os.path.join(BUCKET_URI, \"transformed_artifacts\")\n",
|
||||
"\n",
|
||||
"QUERY_STRING = \"SELECT * FROM {} LIMIT 300000\".format(BQ_TABLE)\n",
|
||||
"JOB_NAME = \"chicago\" + TIMESTAMP\n",
|
||||
@@ -1387,7 +1521,7 @@
|
||||
" \"transform_artifact_dir\": TRANSFORM_ARTIFACTS_DIR,\n",
|
||||
" \"exported_jsonl_prefix\": EXPORTED_JSONL_PREFIX,\n",
|
||||
" \"exported_tfrec_prefix\": EXPORTED_TFREC_PREFIX,\n",
|
||||
" \"temp_location\": os.path.join(BUCKET_NAME, \"temp\"),\n",
|
||||
" \"temp_location\": os.path.join(BUCKET_URI, \"temp\"),\n",
|
||||
" \"project\": PROJECT_ID,\n",
|
||||
" \"region\": REGION,\n",
|
||||
" \"setup_file\": \"./setup.py\",\n",
|
||||
@@ -1458,7 +1592,7 @@
|
||||
") as f:\n",
|
||||
" json.dump(metadata, f)\n",
|
||||
"\n",
|
||||
"!gsutil cat $BUCKET_NAME/metadata.jsonl"
|
||||
"! gsutil cat $BUCKET_URI/metadata.jsonl"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1472,17 +1606,9 @@
|
||||
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
|
||||
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
|
||||
"\n",
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial.\n",
|
||||
"\n",
|
||||
"- Dataset\n",
|
||||
"- Pipeline\n",
|
||||
"- Model\n",
|
||||
"- Endpoint\n",
|
||||
"- AutoML Training Job\n",
|
||||
"- Batch Job\n",
|
||||
"- Custom Job\n",
|
||||
"- Hyperparameter Tuning Job\n",
|
||||
"- Cloud Storage Bucket"
|
||||
"*Note:* stage2/mlops_experimentation is dependent on the resources created by this stage1 notebook."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1503,8 +1629,8 @@
|
||||
" except Exception as e:\n",
|
||||
" print(e)\n",
|
||||
"\n",
|
||||
" if \"BUCKET_NAME\" in globals():\n",
|
||||
" ! gsutil rm -r $BUCKET_NAME"
|
||||
" if \"BUCKET_URI\" in globals():\n",
|
||||
" ! gsutil rm -r $BUCKET_URI"
|
||||
]
|
||||
}
|
||||
],
|
||||
|
||||