Compare commits

...
Author SHA1 Message Date
ivanmkc d7591ed256 Improved git diff logic 2022-06-22 20:53:03 -04:00
Andrew FerlitschandGitHub 41fc83ad03 upgrade: current notebook standards (#655)
* update: current standards

* update: current standards

* Update sdk_custom_image_classification_batch_explain.ipynb

* fix: bucket nit
2022-06-22 16:59:39 -07:00
Andrew FerlitschandGitHub 9928276dc3 upgrade: current notebook standard (#653)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update sdk_automl_tabular_binary_classification_batch_explain.ipynb

* fix: bucket nit
2022-06-22 16:58:42 -07:00
Andrew FerlitschandGitHub 6607f93f5e upgrade: updated curated notebook to current standards (#648)
* upgrade: current standards

* upgrade: current standards

* fix: missed nits

* fix: missed nits

* Update automl-text-classification.ipynb

* Update automl-text-classification.ipynb

* rm extra comma
2022-06-22 16:56:38 -07:00
Andrew FerlitschandGitHub dcc0cfe06e upgrade: current notebook standards (#686)
* upgrade: notebook standard

* upgrade: notebook standard
2022-06-22 16:50:13 -07:00
Andrew FerlitschandGitHub 00d5c5c4bf Update README.md 2022-06-22 15:34:01 -07:00
Andrew FerlitschandGitHub f8152dde19 Update README.md 2022-06-22 15:24:14 -07:00
Andrew FerlitschandGitHub 0586e04c21 upgrade: current notebook standards (#656)
* update: current standards

* update: current standards

* fix: bucket nit
2022-06-22 15:06:01 -07:00
Andrew FerlitschandGitHub 3de18a7fab upgrade: current notebook standards (#674)
* upgrade: current notebook standard

* upgrade: current notebook standard

* fix: bucket

* fix: bucket
2022-06-22 15:03:54 -07:00
Andrew FerlitschandGitHub dc0bf24cc5 Update README.md 2022-06-22 14:58:28 -07:00
Andrew FerlitschandGitHub 8ce4c3070c Update README.md 2022-06-22 14:53:54 -07:00
Andrew FerlitschandGitHub 13c3acb976 Update README.md 2022-06-22 14:50:45 -07:00
Andrew FerlitschandGitHub c1150ff584 Update README.md 2022-06-22 14:39:06 -07:00
Andrew FerlitschandGitHub 4f11d70f7e Update README.md 2022-06-22 14:34:02 -07:00
Andrew FerlitschandGitHub 2bf9a2b317 Update README.md 2022-06-22 14:24:53 -07:00
Andrew FerlitschandGitHub b1e0ad0c4f Update README.md 2022-06-22 14:15:22 -07:00
Andrew FerlitschandGitHub 5624f92f02 Update README.md 2022-06-22 14:12:18 -07:00
Andrew FerlitschandGitHub 1335032954 Update README.md 2022-06-22 14:05:24 -07:00
Andrew FerlitschandGitHub 0b13c66e07 Update README.md 2022-06-22 14:01:55 -07:00
Andrew FerlitschandGitHub ef25b54926 update: add index (#684) 2022-06-22 13:58:06 -07:00
Andrew FerlitschandGitHub 064dbfeefa fix: bucket nit 2022-06-22 12:34:50 -07:00
Andrew FerlitschandGitHub 044c69e7a5 upgrade: current notebook standards (#654)
* update: current standards

* update: current standards
2022-06-22 12:33:26 -07:00
Andrew FerlitschandGitHub 32a46e7471 upgrade: current standards (#649)
* upgrade: current standards

* upgrade: current standards

* fix: missed nits

* fix: missed nits
2022-06-22 12:30:16 -07:00
Andrew FerlitschandGitHub b52d59822d upgrade: current notebook standards (#657)
* update: current standards

* update: current standards

* update: current standards

* update: current standards

* Update sdk_custom_tabular_regression_batch_explain.ipynb

* fix: indent issue

* fix: indent issue

* fix: bucket

* fix: bucket

* fix: image

* fix: image

* fix: cleanup

* fix: cleanup

* fix: cleanup
2022-06-22 11:47:17 -07:00
Andrew FerlitschandGitHub 529995ecde upgrade: current notebook standard (#671)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update google_cloud_pipeline_components_automl_tabular.ipynb

* fix: bucket

* fix: bucket
2022-06-22 11:35:38 -07:00
Andrew FerlitschandGitHub 0726328c92 upgrade: current notebook standard (#667)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update model_monitoring.ipynb

* Update model_monitoring.ipynb
2022-06-22 11:21:32 -07:00
Andrew FerlitschandGitHub 090e83c286 fix: more broken links 2022-06-22 11:19:17 -07:00
Andrew FerlitschandGitHub c3802626b9 fix: links issue 672 2022-06-22 11:18:08 -07:00
Andrew FerlitschandGitHub 9570c2477f upgrade: current notebook standards (#682)
* upgrade: current notebook standards

* upgrade: current notebook standards
2022-06-22 11:09:27 -07:00
Andrew FerlitschandGitHub 2b1a898b2a upgrade: current notebook standards (#680)
* upgrade: current notebook standards

* upgrade: current notebook standards
2022-06-22 11:09:04 -07:00
Andrew FerlitschandGitHub f2a42aa66e upgrade: current notebook standard (#679)
* upgrade: notebook standard

* upgrade: notebook standard

* fix: bucket

* fix: bucket
2022-06-22 11:08:37 -07:00
Andrew FerlitschandGitHub 30a03f1fd1 upgrade: current notebook standards (#678)
* upgrade: notebook standard

* upgrade: notebook standard

* Update google_cloud_pipeline_components_model_train_upload_deploy.ipynb

* fix: bucket nits

* fix: bucket
2022-06-22 11:08:08 -07:00
Andrew FerlitschandGitHub ca25448f59 upgrade: current notebook standard (#673)
* upgrade: current notebook standard

* upgrade: current notebook standard

* fix: bucket nit

* fix: bucket nit
2022-06-22 11:07:37 -07:00
Andrew FerlitschandGitHub 8f922710b0 upgrade: current notebook standard (#670)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update google_cloud_pipeline_components_automl_images.ipynb

* fix: bucket

* fix: bucket
2022-06-22 11:06:31 -07:00
Andrew FerlitschandGitHub 9509c6ab9d upgrade: current notebook standard (#669)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update lightweight_functions_component_io_kfp.ipynb

* fix: nits

* fix: nits

* fix: nits

* fix: nits
2022-06-22 11:05:47 -07:00
Andrew FerlitschandGitHub ccba176979 upgrade: current notebook standard (#665)
* upgrade: notebook standard

* upgrade: notebook standard

* Update sdk-feature-store.ipynb

* Update sdk-feature-store.ipynb

* Update sdk-feature-store.ipynb

* fix: aip reference

* fix: nits

* fix: nits
2022-06-22 11:05:07 -07:00
Andrew FerlitschandGitHub 1b8f383897 upgrade: current notebook standard (#663)
* update: current standards

* update: current standards

* fix: bucket

* fix: bucket
2022-06-22 09:36:49 -07:00
Andrew FerlitschandGitHub e5cd9e86d2 upgrade: notebook to latest standard (#651)
* fix: missed nits

* fix: missed nits
2022-06-22 08:56:10 -07:00
Andrew FerlitschandGitHub a7e86a4f26 upgrade: current notebook standard (#668)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
2022-06-21 20:23:18 -07:00
Ivan CheungandGitHub 8f0c73b32c Fixed cleanup scripts (#676) 2022-06-21 20:13:37 -07:00
Andrew FerlitschandGitHub c7d7b48a91 upgrade: notebook to current standards (#650)
* upgrade: current standards

* upgrade: current standards
2022-06-21 18:25:25 -07:00
Karl WeinmeisterandGitHub 583eb90f07 fix: CONTRIBUTING.md did not have nbfmt as final step 2022-06-20 13:56:49 -05:00
c3a9249c0c Workaround tensorboard/GCS issue for Cloud Shell (#386)
* Workaround tensorboard/GCS issue for Cloud Shell

Without `--load_fast=false` there will be `401 Unauthorized` for GCS log loads. 
See https://github.com/tensorflow/tensorboard/issues/4784#issuecomment-868945650

* PR #386: Fix missing import

`import json` was missing.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-19 10:07:09 -05:00
Karl WeinmeisterandGitHub 81b70e779c ci: Remove protobuf from requirements.txt 2022-06-19 09:38:45 -05:00
Karl WeinmeisterandGitHub 085713a818 ci: Add protobuf to requirements.txt 2022-06-18 17:20:45 -05:00
Karl WeinmeisterandGitHub 5af7c851dc Fix: update typo in GAPIC Feature Store notebook 2022-06-18 17:10:49 -05:00
691312d467 Add import feature analysis config sample code into gapic-feature-sto… (#548)
* Add import feature analysis config sample code into gapic-feature-store.ipynb

* Fixing linter for gapic-feature-store.ipynb

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 17:09:37 -05:00
650c256c13 Fixes link to colab (#627)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:26:36 -05:00
9b00c4380b chore(deps): update actions/setup-python action to v4 (#622)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:21:49 -05:00
Karl WeinmeisterandGitHub 4851457e93 ci: Add Python version to support setup-python v4 2022-06-18 16:19:09 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
1c54878fab build(deps): bump tensorflow (#595)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:08:07 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
c139b84454 build(deps): bump tensorflow (#593)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-06-18 16:02:53 -05:00
15c38b4ca6 chore(deps): update dependency pyupgrade to v2.34.0 (#457)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 15:59:54 -05:00
Ivan CheungandGitHub 271c949a71 Update README.md (#642) 2022-06-17 14:59:05 -07:00
Andrew FerlitschandGitHub 09b5401434 update: fine-tuning notebook (#641)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms

* review: updates from review

* review: updates from review

* updates: fine tuning
2022-06-17 13:41:10 -07:00
dad76547f0 inardini - mobile gaming feature store blog review (#635)
* review content and image

* linter test passed

* andy review fixes

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-17 10:39:18 -07:00
Andrew FerlitschandGitHub c14a110c81 Update get_started_with_custom_training_pipeline_components.ipynb 2022-06-16 14:24:08 -07:00
Andrew FerlitschandGitHub d1e16546cc Update get_started_with_bqml_pipeline_components.ipynb 2022-06-16 14:23:29 -07:00
Andrew FerlitschandGitHub f91bc3d0c9 Update get_started_with_bq_tfdv_pipeline_components.ipynb 2022-06-16 14:22:56 -07:00
Andrew FerlitschandGitHub 5168808b6c fix: colab link 2022-06-16 14:22:23 -07:00
Andrew FerlitschandGitHub 501cca7b5e fix: colab link 2022-06-16 14:21:31 -07:00
Andrew FerlitschandGitHub f19d40d858 Update mlops_experimentation.ipynb 2022-06-16 13:49:17 -07:00
Andrew FerlitschandGitHub 5a721ce01d Update get_started_with_visionapi_and_automl.ipynb 2022-06-16 13:48:31 -07:00
Andrew FerlitschandGitHub 66421fb4d8 fix: colab link 2022-06-16 13:47:47 -07:00
Andrew FerlitschandGitHub 3658ee8c88 Update get_started_with_tabnet.ipynb 2022-06-16 13:46:10 -07:00
Andrew FerlitschandGitHub afaab4bb02 Update get_started_with_cmek_training.ipynb 2022-06-16 13:45:08 -07:00
Andrew FerlitschandGitHub c1e004bdff fix: colab link 2022-06-16 13:44:22 -07:00
Andrew FerlitschandGitHub 874e5a3ef5 Update get_started_vertex_training_xgboost.ipynb 2022-06-16 13:43:11 -07:00
Andrew FerlitschandGitHub 51529f370c fix: broken table 2022-06-16 13:41:01 -07:00
Andrew FerlitschandGitHub 5ddf98866c Update get_started_vertex_training_sklearn.ipynb 2022-06-16 13:40:22 -07:00
Andrew FerlitschandGitHub fbb6830876 fix: colab link 2022-06-16 13:30:01 -07:00
Andrew FerlitschandGitHub ee1bb281da fix: colab link 2022-06-16 13:28:16 -07:00
Andrew FerlitschandGitHub da2f7e88fe fix: update location of public dataset bucket 2022-06-16 12:43:15 -07:00
Andrew FerlitschandGitHub 3fb28e353f fix: remove internal link 2022-06-16 12:40:02 -07:00
Andrew FerlitschandGitHub c8e7f44f0a fix: updates from review (#640)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms

* review: updates from review

* review: updates from review
2022-06-16 12:36:28 -07:00
3d9049aeeb remove old hard-coded instances for prediction (#633)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-16 11:50:01 -07:00
Andrew FerlitschandGitHub 7b8726af24 fix: perms for using MR in BQML (#634)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms
2022-06-15 14:55:17 -07:00
Andrew FerlitschandGitHub 0443b05360 feat: add create tabular dataset from dataframe example (#632)
* feat: add example of import from dataframe

* feat: add example of import from dataframe
2022-06-14 11:44:30 -07:00
Ivan CheungandGitHub e422dbdef2 Added official version of tabular regression batch bq (#331)
* Added official version of tabular regression batch bq

* Ran linter

* Fixed cleanup

* Additional cleanup

* Added working version

* Refactored and made work

* Ran linter and cleaned up

* Renamed aip to aiplatform

* Replaced online with batch

* Renamed notebook

* Ran linter and cleaned up

* Fixed bug

* Fixed SQL by adding backticks

* Install google-cloud-bigquery[all]

* Refactored datasets

* Ran linter

* Removed GCS cells

* Fixed import file

* Fixed SQL issues and added cleanup of training dataset

* Fixed hardcorded table

* Fixed brand names

* Fixed header

* Fixed results table

* Addressed tech writing review comments

* Ran linter
2022-06-14 14:14:06 -04:00
Andrew FerlitschandGitHub ec5fc0b1c8 Update get_started_vertex_training_r.ipynb 2022-06-14 10:05:36 -07:00
Andrew FerlitschandGitHub c52e3f20ba Update get_started_vertex_training_pytorch.ipynb 2022-06-14 10:04:45 -07:00
Andrew FerlitschandGitHub e367dceceb Update get_started_vertex_training_lightgbm.ipynb 2022-06-14 10:04:11 -07:00
Andrew FerlitschandGitHub 19b8666808 Update get_started_vertex_training.ipynb 2022-06-14 10:03:24 -07:00
Andrew FerlitschandGitHub a2df0e9fca Update get_started_vertex_tensorboard.ipynb 2022-06-14 10:01:52 -07:00
Andrew FerlitschandGitHub 73b094550e Update get_started_vertex_feature_store.ipynb 2022-06-14 09:59:24 -07:00
Andrew FerlitschandGitHub d05ae109e1 Update get_started_vertex_experiments.ipynb 2022-06-14 09:57:55 -07:00
Andrew FerlitschandGitHub fdb25791d5 Update get_started_vertex_distributed_training.ipynb 2022-06-14 09:57:19 -07:00
Andrew FerlitschandGitHub 5a88492498 Update get_started_bqml_training.ipynb 2022-06-14 09:56:34 -07:00
Andrew FerlitschandGitHub f19a12b829 Update get_started_automl_training.ipynb 2022-06-14 09:55:53 -07:00
Andrew FerlitschandGitHub 3ed0ea73f4 Update get_started_bq_datasets.ipynb 2022-06-14 09:08:47 -07:00
Andrew FerlitschandGitHub b98fd24a72 Update get_started_bq_datasets.ipynb 2022-06-13 21:29:41 -07:00
Andrew FerlitschandGitHub eb4e9a0f91 Update get_started_vertex_datasets.ipynb 2022-06-13 21:27:16 -07:00
Andrew FerlitschandGitHub ec7c136b0a Update get_started_vertex_datasets.ipynb 2022-06-13 21:26:24 -07:00
Andrew FerlitschandGitHub ee7e43cc1a Update mlops_data_management.ipynb 2022-06-13 20:24:57 -07:00
Andrew FerlitschandGitHub ea9f5f3c5c Update get_started_with_data_labeling.ipynb 2022-06-13 20:24:22 -07:00
Andrew FerlitschandGitHub bd44798412 Update get_started_vertex_datasets.ipynb 2022-06-13 20:23:37 -07:00
Andrew FerlitschandGitHub 2af0cc0f80 fix: test for local execution 2022-06-13 20:22:57 -07:00
Andrew FerlitschandGitHub 5c0fa14d2d Update get_started_bq_datasets.ipynb 2022-06-13 20:21:44 -07:00
Andrew FerlitschandGitHub 7cc50d3203 Update README.md 2022-06-13 13:58:20 -07:00
Andrew FerlitschandGitHub 9c7da13177 Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:39:33 -07:00
Andrew FerlitschandGitHub 45e0645f0b Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:38:55 -07:00
Andrew FerlitschandGitHub cb884cc74a Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:38:22 -07:00
Ivan CheungandGitHub d3a6475580 Fixed mistake in batch prediction request section (#617)
* Fixed mistake in batch prediction request section

* Fixed linter requirements
2022-06-10 17:13:45 -04:00
4e7061b2db added MLPerf benchmark reference and updated Criteo sample to use GRPC for stock containers (#630)
* added MLPerf benchmark reference and updated Criteo sample to use GRPC for stock containers

* addressed feedback for BERT sample and did similar changes to Criteo sample

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-10 12:06:25 -07:00
Ivan CheungandGitHub 0250879f65 Added notebook substitution for common case of 1 notebook (#625) 2022-06-10 14:44:43 -04:00
Andrew FerlitschandGitHub 5cee23ae68 Update get_started_with_autoscaling.ipynb 2022-06-09 15:02:28 -07:00
Andrew FerlitschandGitHub d518558b3d Update README.md 2022-06-09 15:01:55 -07:00
Andrew FerlitschandGitHub 5c085c843f feat: notebook on autoscaling (#629)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook

* feat: airflow+vertex

* feat: airflow+vertex

* feat: notebook on autoscaling

* feat: notebook on autoscaling
2022-06-09 14:57:41 -07:00
Michael HuandGitHub 936b434ac4 fix: typo in links in bqml arima notebook (#616)
Notebook used as template had incorrect link format. Apply the same fixes as #514 to the arima notebook.
2022-06-09 17:52:12 -04:00
Michael HuandGitHub 43059c9fd9 fix: pin protobuf version to 3.19.0 (#621) 2022-06-09 12:49:45 -07:00
Andrew FerlitschandGitHub 19f72d426d fix: typos 2022-06-08 11:59:37 -07:00
Andrew FerlitschandGitHub 14ecaf3023 Update README.md 2022-06-08 11:58:18 -07:00
Andrew FerlitschandGitHub 80c93a9b6d feat: airflow with vertex pipelines (#624)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook

* feat: airflow+vertex

* feat: airflow+vertex
2022-06-08 11:55:11 -07:00
Andrew FerlitschandGitHub 06a1b4dc57 Update README.md 2022-06-07 09:48:16 -07:00
Andrew FerlitschandGitHub 4e779eedf1 Update README.md 2022-06-07 09:45:10 -07:00
Andrew FerlitschandGitHub afb341f5fd feat: new R notebook (#618)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook
2022-06-07 09:39:44 -07:00
e34b0fa115 chore(deps): pin dependency protobuf to v (#606)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:13:56 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
6fa0345f25 build(deps): bump tensorflow (#596)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-06-06 18:09:52 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Andrew Ferlitsch
dd43ae6639 build(deps): bump tensorflow (#594)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:08:37 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Ivan CheungAndrew Ferlitsch
840385e0a7 build(deps): bump tensorflow (#592)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:07:48 -07:00
Michael HuandGitHub 9daaf51a1f add bqml arima and vertex forecasting comparison notebook (#581)
Adds a notebook that demonstrates how to compare a Vertex Forecasting model against a BQML ARIMA+ model trained using a first-party GCPC pipeline.
2022-06-06 20:48:30 -04:00
Andrew FerlitschandGitHub 9b2511e54e Update README.md 2022-06-06 13:38:55 -07:00
Andrew FerlitschandGitHub b6674e6540 feat: notebook for co-hosting models (#615)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting
2022-06-06 13:35:47 -07:00
Ivan CheungandGitHub a109cb6d44 fix: Added explanations output to forecasting notebook (#613)
* Added explanations output to forecasting notebook

* Simplified and added XAI

* Fix conflicts

* Ran linter

* Fixed batch prediction request explanation
2022-06-06 10:00:07 -07:00
Ivan CheungandGitHub f730d6b9de Added ability to test a single notebook (#608)
* Added ability to test a single notebook

* Added output_url to table

* Removed ML Ops notebooks
2022-06-06 10:30:31 -04:00
0947f2792d Made some minor changes to Sdk big query custom container training (#522)
* minor changes done

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:58:45 -07:00
dbf19acde4 Adds the updated telecom-subscriber-churn-prediction notebook to official and removes from community (#506)
* updates and adds the telecom-subscriber-churn-prediction notebook to official and removes from the community

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:53:21 -07:00
1aaa833153 Adds manual-scaling config and explanation to the Automl-forecasting-batch notebook in official folder (#514)
* adds manual-scaling config and explanation to the notebook

* ran linter test after installing linter requirement updates

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:50:23 -07:00
c73d995680 Made minor changes to sdk_automl_image_object_detection_batch.ipynb file (#513)
* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:45:55 -07:00
3fe5028724 Malansari automl vision api notebook update (#612)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

* Fixed sample dataset link to point to public version

* Fixed linting issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-04 09:14:23 -07:00
Andrew FerlitschandGitHub 44dd24f910 Update README.md 2022-06-02 15:57:04 -07:00
Andrew FerlitschandGitHub c20a9c4e63 update: AutoML + MLMD (#605)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD
2022-06-02 15:50:05 -07:00
Ivan CheungandGitHub edffdf34b7 Pin protobuf version to avoid broken dependencies. 2022-06-02 17:25:28 -04:00
340c24c5b4 Added custom container explainability notebook (#564)
* Commit for lint

* Commit after name change

* Commit of notebook and CODEOWNERS

Added custom container with xai notebook, and explainable_ai folder in the community folder

* Removed extra copy of file

* Remove extra file

* Updated per review from DPE

* Lint test updates

* linter ran

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-02 12:28:15 -07:00
Andrew FerlitschandGitHub 11f20f3f08 fix: replace BLAH (#600)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH
2022-06-01 11:19:02 -07:00
Andrew FerlitschandGitHub 199b330aa5 Update get_started_automl_mlmd.ipynb 2022-05-31 18:37:05 -07:00
Andrew FerlitschandGitHub 5143db1024 feat: Add DIY MLMD with AutoML (#598)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML
2022-05-31 18:35:23 -07:00
Andrew FerlitschandGitHub 2f0bd3de15 fix: correct reference to service 2022-05-31 13:50:51 -07:00
Andrew FerlitschandGitHub 4d6c541967 feat: XAI + custom server (#597) 2022-05-31 13:31:20 -07:00
Andrew FerlitschandGitHub 5228a5c978 Update README.md 2022-05-31 12:47:16 -07:00
Andrew FerlitschandGitHub c6118bd17d feat: start stage 7 (#591)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine

* feat: LightGBM

* feat: LightGBM

* feat: start stage7

* feat: start stage8
2022-05-31 09:48:49 -07:00
Andrew FerlitschandGitHub d2c9e84af4 Add files via upload 2022-05-26 09:30:17 -07:00
Andrew FerlitschandGitHub fe0a0ff055 Update README.md 2022-05-26 09:30:04 -07:00
Andrew FerlitschandGitHub 40e287245d Delete stage5v2.png 2022-05-26 09:29:50 -07:00
Andrew FerlitschandGitHub c79646a537 Add files via upload 2022-05-26 09:26:24 -07:00
Andrew FerlitschandGitHub e293e1c2fb Update README.md 2022-05-26 09:26:09 -07:00
Andrew FerlitschandGitHub f2ab65bd03 Delete stage4v2.png 2022-05-26 09:25:51 -07:00
Andrew FerlitschandGitHub aa686516d3 Add files via upload 2022-05-25 14:42:01 -07:00
Andrew FerlitschandGitHub 11c80a0251 Update README.md 2022-05-25 14:41:45 -07:00
Andrew FerlitschandGitHub c5e9e5812b Delete stage3v2.png 2022-05-25 14:41:29 -07:00
Andrew FerlitschandGitHub 98b126fa0b Update README.md 2022-05-25 14:34:29 -07:00
Andrew FerlitschandGitHub 55553f9e69 Update README.md 2022-05-25 14:33:56 -07:00
Andrew FerlitschandGitHub 563013c745 Add files via upload 2022-05-25 14:33:10 -07:00
Andrew FerlitschandGitHub fefb9778a7 Update README.md 2022-05-25 14:32:53 -07:00
Andrew FerlitschandGitHub be1831082c Update README.md 2022-05-25 14:11:47 -07:00
Andrew FerlitschandGitHub 9e15ee2e8a Add files via upload 2022-05-25 14:11:21 -07:00
Andrew FerlitschandGitHub ceff7d7271 Delete stage2v2.png 2022-05-25 14:10:51 -07:00
Andrew FerlitschandGitHub df9b5cd6f0 Add files via upload 2022-05-24 16:17:27 -07:00
Andrew FerlitschandGitHub bc57801525 Update README.md 2022-05-24 16:17:06 -07:00
Andrew FerlitschandGitHub 1b403373d3 Delete stage1.png 2022-05-24 16:16:49 -07:00
Andrew FerlitschandGitHub 987fb74ca6 Add files via upload 2022-05-24 15:13:15 -07:00
Andrew FerlitschandGitHub 65a209bc7b Update README.md 2022-05-24 15:12:55 -07:00
Andrew FerlitschandGitHub 16e6d9e90f Delete stage6c.png 2022-05-24 15:12:32 -07:00
Andrew FerlitschandGitHub 7ce6bee763 Delete stage6b.png 2022-05-24 15:12:18 -07:00
Andrew FerlitschandGitHub 6d7ca3eb55 Delete stage6a.png 2022-05-24 15:12:05 -07:00
Andrew FerlitschandGitHub 8e9f205e9a Add files via upload 2022-05-24 14:58:15 -07:00
Andrew FerlitschandGitHub 5fdb6c4368 Update README.md 2022-05-24 14:57:50 -07:00
Andrew FerlitschandGitHub 71ebfd402c Delete stage5.png 2022-05-24 14:57:33 -07:00
Andrew FerlitschandGitHub 6e4ca83531 Update README.md 2022-05-24 14:43:12 -07:00
Andrew FerlitschandGitHub 05793d6a3c Add files via upload 2022-05-24 14:42:39 -07:00
Andrew FerlitschandGitHub 3dc374b7db Delete stage4.png 2022-05-24 14:42:13 -07:00
Andrew FerlitschandGitHub 3ac8a4f617 Add files via upload 2022-05-24 14:22:20 -07:00
Andrew FerlitschandGitHub 21b4b5b063 Delete stage3v3.png 2022-05-24 14:22:11 -07:00
Andrew FerlitschandGitHub 9ffd921ca4 Update README.md 2022-05-24 14:21:38 -07:00
Andrew FerlitschandGitHub 14e6ebbb95 Add files via upload 2022-05-24 14:21:08 -07:00
Andrew FerlitschandGitHub 277b685a39 Delete stage3.png 2022-05-24 14:20:58 -07:00
Andrew FerlitschandGitHub 67e7715ed9 Update README.md 2022-05-24 13:59:19 -07:00
Andrew FerlitschandGitHub bb87900209 Add files via upload 2022-05-24 13:58:51 -07:00
Andrew FerlitschandGitHub 96ebe7286b Delete stage2.png 2022-05-24 13:58:24 -07:00
Andrew FerlitschandGitHub 0b3a5dde09 Add files via upload 2022-05-24 13:57:41 -07:00
Andrew FerlitschandGitHub 17a30360b4 Delete stage2.png 2022-05-24 13:57:24 -07:00
Andrew FerlitschandGitHub b386f51916 Update README.md 2022-05-24 13:40:25 -07:00
Andrew FerlitschandGitHub dd4f40c7f4 Add files via upload 2022-05-24 13:39:51 -07:00
Andrew FerlitschandGitHub d402fc085a Delete stage1.jpg 2022-05-24 13:39:38 -07:00
Andrew FerlitschandGitHub a12b9cd60f Add files via upload 2022-05-24 13:38:11 -07:00
Andrew FerlitschandGitHub bf1032d550 Delete stage1.jpg 2022-05-24 13:38:01 -07:00
Andrew FerlitschandGitHub dea05e1e36 Add files via upload 2022-05-24 13:36:59 -07:00
Andrew FerlitschandGitHub a9f0117c82 Update README.md 2022-05-23 17:09:39 -07:00
Andrew FerlitschandGitHub 83f1fe9ecd Add files via upload 2022-05-23 17:08:06 -07:00
Andrew FerlitschandGitHub 7344274037 Add files via upload 2022-05-23 17:06:53 -07:00
Andrew FerlitschandGitHub e36bfa9a3b Add files via upload 2022-05-23 17:03:27 -07:00
Andrew FerlitschandGitHub 950aa245b8 Update README.md 2022-05-23 16:55:52 -07:00
Andrew FerlitschandGitHub ac47b2e370 Update README.md 2022-05-20 13:01:42 -07:00
Andrew FerlitschandGitHub 6662fc809b Update README.md 2022-05-20 13:00:49 -07:00
Andrew FerlitschandGitHub 12b3171d5e feat: LightGBM (#583)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine

* feat: LightGBM

* feat: LightGBM
2022-05-20 12:58:37 -07:00
Andrew FerlitschandGitHub 579d4751bd Update README.md 2022-05-20 12:41:10 -07:00
Andrew FerlitschandGitHub d4c607323d feat: swivel + ME (#582)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine
2022-05-20 12:39:42 -07:00
nayaknishantandGitHub 3ad30738a7 docs: fixing CODEOWNERS and instructions hyperlinks (#580)
When opening a PR, the CODEOWNERS and instructions hyperlinks throw a 404 error because they point to a URL that has been changed. Fixing these hyperlinks.
2022-05-19 13:20:23 -07:00
Andrew FerlitschandGitHub 119273ae7e Ml.googleapis fix (#579)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:42:55 -07:00
Andrew FerlitschandGitHub 95bc39a685 fix: enable APIs stage5 (#578)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:30:11 -07:00
Andrew FerlitschandGitHub b054104851 fix: enable APIs stage4 (#577)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:23:49 -07:00
Andrew FerlitschandGitHub e0e0cf849a fix: enable APIs stage3 (#576)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:15:29 -07:00
Andrew FerlitschandGitHub c95b3d7088 fix : enable APIs stage2 (#575)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 11:51:49 -07:00
Andrew FerlitschandGitHub 19c2bdb008 fix: enable APIs stage1 (#574)
* fix: enable apis

* fix: enable apis
2022-05-19 11:36:12 -07:00
Andrew FerlitschandGitHub 3c815f3888 update: new template edition (#572)
* fix: new template review updates

* fix: new template review updates

* mport -> import

* fix: dummy code sample required an import

dummy code samples (not otherwise part of template) -- should be self contained since they will be deleted by the template user.

* fix: added install for self-contained code passes ingestion test

* fix: example code (not otherwise part of template) not self-contained.

* fix: continue update so code example is self-contained

* update: numpy already installed in test env
2022-05-19 11:24:19 -07:00
cfcd9b29fd Malansari automl vision api notebook (#573)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-19 11:14:17 -07:00
Ivan CheungandGitHub 4fca7d98b2 Increases notebook concurrency and linted CI files (#512)
* Fixed private pool issues

* Ran linter

* Added worker timeouts

* Tweaked timeout

* Removed gcloud requirement

* Removed unneeded file
2022-05-18 18:58:54 -04:00
Andrew FerlitschandGitHub dea950bcb6 fix: DPE styling (#570)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:32:30 -07:00
Andrew FerlitschandGitHub 4c43755fb6 Mlops 8v3 (#569)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:11:31 -07:00
Andrew FerlitschandGitHub 374942a9e9 fix: DPE-style tuning (#568) 2022-05-18 14:01:13 -07:00
Andrew FerlitschandGitHub 8add418428 Mlops 8v2 (#567)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:46:24 -07:00
Andrew FerlitschandGitHub 9d73cc4574 fix: DPE style tuning (#566)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:29:45 -07:00
Andrew FerlitschandGitHub 5edb4bb1bf fix: DPE-styling (#565)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 12:29:01 -07:00
Andrew FerlitschandGitHub 0e811868d3 fix: links 2022-05-18 11:33:56 -07:00
Andrew FerlitschandGitHub 9efcfa25e8 fix: links 2022-05-18 11:27:11 -07:00
48036cf581 vision api notebook - updated link to open in Vertex AI Workbench (#562)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-18 11:20:39 -07:00
Andrew FerlitschandGitHub 79fd9b4049 Update README.md 2022-05-17 11:05:54 -07:00
Andrew FerlitschandGitHub 46b2181a4e fix: typos in two towers (#563)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers
2022-05-17 11:04:01 -07:00
Andrew FerlitschandGitHub d04f25a8bd Update README.md 2022-05-16 15:13:45 -07:00
Andrew FerlitschandGitHub 9f341c350c fix: two towers (#561)
* fix: two towers

* fix: two towers
2022-05-16 15:11:44 -07:00
Ivan CheungandGitHub f22f97f680 fix: Updated matching engine dependency and fixed cases (#557)
* fix: Updated dependency and fixed cases

* Ran linter

* Renamed to Vertex AI Workbench notebook

* Additional text fixes
2022-05-16 13:06:04 -04:00
Andrew FerlitschandGitHub fe75745d44 feat: WIP: twotowers+matching engine (#560)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine

* feat: wip: twotowers

* feat: wip: twotowers
2022-05-13 14:03:43 -07:00
Andrew FerlitschandGitHub bbc9f1337e Update README.md 2022-05-13 08:56:39 -07:00
Andrew FerlitschandGitHub eb1fa9213a feat: add notebook for matching engine (#559)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine
2022-05-12 15:55:21 -07:00
Mohammad Al-AnsariandGitHub a7033a6527 Updates to visionapi notebook (#556)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting
2022-05-11 11:23:50 -07:00
Andrew FerlitschandGitHub 7e6c2d69c8 update: ModelEval as SDK (#555)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK
2022-05-10 15:33:52 -07:00
Andrew FerlitschandGitHub 1a21b81804 fix: stage5 DPE style (#554)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 14:11:31 -07:00
Andrew FerlitschandGitHub 2bbd520613 fix: stage4 DPE styling (#553)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 13:58:44 -07:00
Andrew FerlitschandGitHub 8285e4ebd1 Mlops 8 (#552)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:56:43 -07:00
Andrew FerlitschandGitHub 859849894e fix: stage3 workbench (#551)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:38:52 -07:00
Andrew FerlitschandGitHub e74dd48ae0 fix: 2nd round workbench (#550)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:12:27 -07:00
Andrew FerlitschandGitHub a14eb71210 fix: check for workbench (#549)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench
2022-05-10 11:37:44 -07:00
Mohammad Al-AnsariandGitHub 0b6a9718ff Added author / reviewer informationAdded sample files (#544)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference
2022-05-09 13:59:59 -07:00
Andrew FerlitschandGitHub 6ac0d8a029 Update README.md 2022-05-09 13:48:00 -07:00
Andrew FerlitschandGitHub 2ee013bcab Delete get_started_nvidia_triton_serving.ipynb 2022-05-09 13:47:18 -07:00
Andrew FerlitschandGitHub 1ebb3f5714 Mlops 8 (#547)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server
2022-05-09 13:46:35 -07:00
Andrew FerlitschandGitHub 11c5134961 Update README.md 2022-05-09 13:40:51 -07:00
Andrew FerlitschandGitHub e328b7268f feat: triton server (#546)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server
2022-05-09 13:38:37 -07:00
Andrew FerlitschandGitHub d297e99e5a Update get_started_with_machine_management.ipynb 2022-05-09 12:20:03 -07:00
Andrew FerlitschandGitHub 48c7a4c82e fix: spelling 2022-05-09 12:15:07 -07:00
Andrew FerlitschandGitHub eb3b52f863 Update README.md 2022-05-09 12:10:40 -07:00
Andrew FerlitschandGitHub 4e58cca127 Update get_started_with_machine_management.ipynb 2022-05-09 12:09:07 -07:00
Andrew FerlitschandGitHub 182a98768f feat: machine resource settings (#545)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings
2022-05-09 12:06:56 -07:00
Andrew FerlitschandGitHub f483447235 Update README.md 2022-05-06 19:07:16 -07:00
Andrew FerlitschandGitHub c59050608b feat: vision api and automl (#543)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data
2022-05-06 19:04:43 -07:00
Andrew FerlitschandGitHub 3b9844f92c update: add co-author (#542)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth

* update: add co-author

* update: add co-author
2022-05-06 15:27:05 -07:00
Andrew FerlitschandGitHub ee301a22f6 clean: remove BLAH 2022-05-06 12:38:30 -07:00
Andrew FerlitschandGitHub b7d16f66aa fix: workbench auth (#541)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth
2022-05-06 10:18:06 -07:00
Andrew FerlitschandGitHub 57aad5b802 fix: compat issue with Vertex AI and TFX Transform (#540)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility
2022-05-05 19:04:13 -07:00
Andrew FerlitschandGitHub 9e311433ba fix: mistakes in tfx notebook (#539)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes
2022-05-05 14:58:04 -07:00
Andrew FerlitschandGitHub 04b310927a Update README.md 2022-05-05 13:36:36 -07:00
Andrew FerlitschandGitHub 2fed3ad014 feat: add TFX pipeline (#538)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX
2022-05-05 13:34:22 -07:00
Andrew FerlitschandGitHub 0ec94e0af6 fix: IS_COLAB (#535)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA
2022-05-04 13:55:11 -07:00
9470be0900 adds the updated service-account code to mlops/stage3/get_started_with_dataproc_serverless_pipeline_components notebook (#529)
* adds the updated service-account setting code to notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:55 -07:00
479a0c6271 adds the updated service-account code to mlops/stage3/get_started_with_automl_pipeline_components notebook (#528)
* adds the updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:13 -07:00
053f9c397f adds the updated service-account code to mlops/stage3/get_started_with_kubeflow_pipelines notebook (#527)
* adds updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:03:39 -07:00
Andrew FerlitschandGitHub 2c82469756 fix: service account 2022-05-03 08:33:17 -07:00
Andrew FerlitschandGitHub fdfc7009d0 fix: correct IS_COLAB (#531)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB
2022-05-02 14:25:08 -07:00
Andrew FerlitschandGitHub 59fcfe137d fix: typo in stage 2022-05-02 14:00:16 -07:00
Andrew FerlitschandGitHub 9b434b32bc feat: more eval examples (#530)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work
2022-05-02 13:19:07 -07:00
fc27cd8628 Added service account fetch code for colab in get_started_with_rapid_prototyping_bqml_automl file (#520)
* made changes

* ran linter test

* added minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:45 -07:00
a62f03c396 Added service account fetch code for colab in get_started_with_custom_training_pipeline_components file (#519)
* made changes

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:08 -07:00
a270439814 Added service account fetch code for colab in get_started_with_bqml_pipeline_components file (#518)
* changes made

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:20:18 -07:00
sudarshan-SpringMLandGitHub a97af4a078 Added service account fetch code for colab in get_started_with_bq_tfdv_pipeline_components file (#517)
* added service account code for colab

* ran linter test

* made changes

* ran linter test
2022-05-02 09:19:29 -07:00
Andrew FerlitschandGitHub d7127cc22f fix: IS_COLAB (#526)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:25:49 -07:00
Andrew FerlitschandGitHub 802ab4edd8 fix: DPE-styling (#525)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:10:19 -07:00
Andrew FerlitschandGitHub ae7f28fb31 fix: DPE-styling updates (#524)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 14:06:59 -07:00
f63e3e6e4c Added colab link and made changes in the code in such a way that docker commands can run on colab environment for the file get_started_vertex_training_pytorch (#508)
* Added colab in the notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-29 11:55:51 -07:00
Andrew FerlitschandGitHub b9bb497ebc fix: IS_COLAB (#523)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 11:54:21 -07:00
Andrew FerlitschandGitHub 4368b9e7f8 feat: GAPIC->SDK for private endpoint (#516)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints
2022-04-28 09:59:49 -07:00
2e9cb5d2cf minor change for 'Get started with dataflow pipeline components' (#500)
* Add minor changes to get_started_with_dataflow_pipeline_components

* minor changes and tested

* remove variable dataflow_wait_op, since not used in other places.

* remove variable dataflow_wait_op, since not used in other places

* removed unused import

* Run linter test

* Add gcloud project set when using colab

* Run linter

* correct anem toColab logo Run in Colab

* run linter

* correct the list of items to remove

* Run linter

* Run liinter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 16:45:20 -07:00
9ec8a93e05 Minor changes has been done to pipelines_intro_kfp (#494)
* minor changes done

* ran linter test

* chnanged the as per review coments

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:42:34 -07:00
3ed8778656 Made few changes to sdk-feature-store (#486)
* Added vertexai notebook

* Ran the linter test

* Made the required changes based on the comments

* Ran linter test again

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:39:03 -07:00
Andrew FerlitschandGitHub bf5e3cf870 fix: delete tmp BQ model (#510)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model
2022-04-27 09:30:35 -07:00
c23215893d minor changes on stage1 ml ops - Get started vertex datasets (#474)
* Add minor changes to get_started_vertex_datasets notebook

* run linter

* Run Linter test

* Add google authentication cell for colab execution

* run linter

* correct the project id definition

* Run linter

* Add project id cell

* run liner

* Added imports that are required

* run linter test

* Add gcloud project set

* Run linter

* add linter run

* Running linter test

* run linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-25 10:11:27 -07:00
Andrew FerlitschandGitHub 1c96f7ca71 fix: notebook run in colab (#505)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker
2022-04-22 18:50:29 -07:00
Andrew FerlitschandGitHub 0d5661835b feat: add docker support in Colab (#504)
* feat: add colab code for docker

* feat: add colab code for docker
2022-04-22 13:54:29 -07:00
fe1a3c0bc9 Adds Colab part and minor changes to ml_ops/stage2/get_started_bqml_training notebook (#491)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

* adds colab part and minor changes

* ran linter test

* retains the newly added code lost in conflicts

* ran linter test

* converts vertex to vertex ai

* ran linter test

* moves deletion of temporary BQ table outside delete_storage condition

* ran linter test

* adds bigquery-storage dependency to the notebook tested on Colab

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 11:09:49 -07:00
82bffb87f1 Made some minor changes to sdk-metric-parameter-tracking-for-locally-trained-models (#480)
* Added to correct path

* Ran linter test

* Made some changes

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 00:05:57 -07:00
sudarshan-SpringMLandGitHub 741c6732f1 Made minor changes to sdk-metric-parameter-tracking-for-custom-jobs file (#479)
* modified file

* modified file

* ran linter test

* deleted file in community folder

* ran linter test

* changed folder name in links

* ran linter test

* resolved comments

* ran linter test

* modified file

* ran linter test
2022-04-22 00:05:07 -07:00
9d8caf7888 Added markup text mentioning the role provided to service account used by notebook instance & provided key-version value while destroying it in notebook get_started_with_cmek_training (#495)
* Changes made to notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 23:37:19 -07:00
e63d354413 Made minor changes to rapid_prototyping_bqml_automl file and moved file from community to official (#496)
* added file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:44:18 -07:00
831c515477 Adding official version for Fraud detection notebook (#321)
* deleted file in community folder

* modified notebook

* ran linter test

* renamed managed_notebooks folder to workbench

* ran linter

* resolved comments

* ran linter test

* pulled new version of branch

* ran linter again

* resolved comments

* ran linter test

* removed %%time and added --user flag to all pip installs

* ran linter test

* added debug statements

* ran linter test

* added verbose

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:07:58 -07:00
Andrew FerlitschandGitHub 06ba5d6804 fix: SaraRob installation updates (#501)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-21 11:37:44 -07:00
0137cd106e adds Colab part and minor changes to ml_ops/stage2/get_started_vertex_experiments notebook in community folder (#493)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:20:29 -07:00
8b3b63d714 Adds Colab part and minor changes to ml_ops/stage2/get_started_automl_training notebook (#492)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-21 09:19:34 -07:00
bf79916f29 Adds Colab part to ml_ops/stage1/get_started_bq_datasets notebook (#490)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

* adds Colab part and minor changes

* ran linter test

* updates the enable apis step in setup project section

* ran linter test

* changes vertex to vertex ai

* ran linter test

* moves temporary BQ table deletion outside the delete_storage condition

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:17:49 -07:00
6bf462f79d Notebook fix to handle GCS outputs and resolve (AutoML Tabular Forecasting notebook error: no row field 'name' #453) (#477)
* notebook fix to handle gcs output

* linter test

* minor bug fix and markup added

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:13:52 -07:00
Andrew FerlitschandGitHub 106cdee495 feat: update model eval metrics for comparison (#498)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-20 19:21:23 -07:00
dfb7301733 Inardini - feature store demo blog review (#484)
* review for blog

* linter code passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:17:17 -07:00
da707b2cbc Made minor changes to custom-tabular-bq-managed-dataset file (#473)
* modified notebook

* modified file

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:07:07 -07:00
873ba9dde9 Made minor changes to get_started_with_rapid_prototyping_bqml_automl file (#459)
* modified file

* made linter changes

* made changes

* linter test issues resolved

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:06:27 -07:00
Andrew FerlitschandGitHub 15c452f39d fix: Issue 451, add db-dtypes to requirements (#458)
* fix: issue 451

* fix: issue 451
2022-04-18 12:14:56 -07:00
Andrew FerlitschandGitHub be7111815b fix: getting SERVICE ACCOUNT 2022-04-18 10:59:44 -07:00
17db1a952b Tabnet - Add serving (#482)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

* Add deployment in Vertex AI

* Add delete the resource

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 12:51:55 -07:00
Andrew FerlitschandGitHub 455143d0f0 Update README.md 2022-04-15 12:26:06 -07:00
Andrew FerlitschandGitHub f0892852cb Update README.md 2022-04-15 12:24:39 -07:00
Andrew FerlitschandGitHub ca48556d0c feat: add tabnet notebook (#483)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example

* feat: add tabnet notebook

* feat: add tabnet notebook
2022-04-15 12:21:51 -07:00
Aleksey VlasenkoandGitHub f961aa3174 Minor updates basing on team feedback (#481) 2022-04-15 10:56:46 -07:00
64c8eca7df Refresh of Distributed Hyperparameter Tuning for Colab (#461)
* notebook refresh from vertex ai sdk project

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 08:49:36 -07:00
b3332c1742 minro changes to get_started_with_hpt_pipeline_components (#465)
* minor changes made to notebook

* ran lintertest

* added coment

* ran lintertest

* made changes sujjested in git review

* ran linter test

* changes done as per review

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-14 17:02:23 -07:00
Aleksey VlasenkoandGitHub b35f697a75 Adding samples for Vertex AI Prediction optimized TensorFlow runtime (#475)
* adding Vertex AI optimized TensorFlow runtime samples

* updated URLs, added code to import benchmark.py

* fixed 'Open in Vertex AI Workbench' links

* final cleanup

* added @vlasesnkoalexey as an owner of notebooks/community/vertex_endpoints/optimized_tensorflow_runtime

* rerun linter
2022-04-14 10:14:27 -07:00
3bc32a1d48 Adds Colab part to the ml_ops/stage3/get_started_with_automl_pipelines notebook (#472)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

* adds Colab part to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:52:06 -07:00
d66f851554 Adds Colab part to the ml_ops/stage3/get_started_with_kubeflow_pipelines notebook (#471)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

* adds colab changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:34 -07:00
d733f107e1 Made minor changes to get_started_with_custom_training_pipeline_components file (#470)
* added colab related content

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:01 -07:00
805e2e1c83 Made minor changes to get_started_with_bqml_pipeline_components file (#469)
* made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:50:18 -07:00
03dc17d9d7 updates ml_ops/stage3/get_started_with_dataproc_serverless_pipelines notebook (adds delete-batch code + adds colab part + updates textual content) in community folder (#464)
* updates: adds delete-batch code  + adds colab part + updates textual content

* sets delete_bucket to False as default

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:49:26 -07:00
a4909f823e Adds changes for Colab support to the ml_ops/stage2/get-started-with-vertex-featstore notebook (#462)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

* adds the colab changes and minor textual changes

* ran linter test

* adds the colab changes to the notebook and minor textual changes

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:48:58 -07:00
e91b259595 Made minor changes to file get_started_vertex_training_xgboost.ipynb (#436)
* modified file

* run linter test

* run in colab

* added coment

* run lintertest

* changed as per review coments

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:08:04 -07:00
14284046e4 Made minor changes to get_started_vertex_tensorboard (#437)
* Adding a notebook

* Ran linter test

* Added Colab

* Ran the linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:07:24 -07:00
59a9a5e6ba Notebook Refresh E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Distributed Training (#434)
* notebook refresh from vertex ai sdk project

* update with linter test changes

* linter fix

* linter issue

* notebook colab workbench links

* linter test

* linter fix

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:06:01 -07:00
Andrew FerlitschandGitHub f3b0a9e0c0 Update README.md 2022-04-11 18:56:52 -07:00
Andrew FerlitschandGitHub 92b572a364 feat: add raw predict example (#468)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example
2022-04-11 18:53:45 -07:00
014be9b530 Made minor changes to get_started_with_data_labeling_2 (#463)
* added colab link and made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:07:13 -07:00
fa675e0082 inardini real time churn feature store demo fixes (#455)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

* name fixes. linter code done. passed.

* fix project id and region

* test done

* format

* linter test done.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:01:27 -07:00
Andrew FerlitschandGitHub 113cbb9709 Update README.md 2022-04-11 14:54:27 -07:00
Andrew FerlitschandGitHub b72bdc8112 Update README.md 2022-04-11 12:31:03 -07:00
Andrew FerlitschandGitHub 0842fa8354 Update README.md 2022-04-11 12:30:38 -07:00
Andrew FerlitschandGitHub 4e4f3f4095 Ml ops 7v6 (#467)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed
2022-04-11 12:16:47 -07:00
Andrew FerlitschandGitHub d014febeb9 Update README.md 2022-04-11 11:37:42 -07:00
Andrew FerlitschandGitHub a3264df643 feat: add BQML + MR example (#466)
* feat: add BQML+MR example

* feat: add BQML+MR example
2022-04-11 11:36:50 -07:00
f0208e3e37 Made minor changes to get_started_with_custom_training_pipeline_components (#456)
* modified file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:37 -07:00
f84e1b9cbc Updates ml_ops/stage3/get-started-kubeflow-pipeline-notebook in the community folder (#449)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:05 -07:00
16b2086031 Made minor changes to get_started_with_bqml_pipeline_components (#444)
* modified notebook

* linter modifications made

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:30:20 -07:00
0e24ba565d Updates ml_ops/stage3/get-started-automl-pipeline-notebook in the community folder (#440)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:37 -07:00
49718b02a5 Made minor changes to get_started_with_bq_tfdv_pipeline_components (#439)
* modified notebook

* linter test issues resolved

* ran linter test

* added colab option

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:03 -07:00
63031ed364 Updates ml_ops/stage2/get_started_vertex_featurestore notebook in community folder. (#426)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:26:57 -07:00
9fd325e25b Made minor changes to file get_started_with_data_labeling (#425)
* modified notebook

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:22:12 -07:00
93af43419c Updates Mlops/stage2/get-started-automl-training notebook in the community folder (#409)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 13:03:29 -07:00
c8f0cdb74a Refresh of Distributed Hyperparameter Tuning Notebook (#454)
* notebook refresh

* linter test

* notebook refresh added corrected cleanup

* linter test

* notebook refresh added corrected cleanup

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 14:07:47 -05:00
19368fe5cc inardini google cloud pipelines dataproc tabular (#445)
* add dataproc components tabular notebook

* add src package

* add codeowner

* linter test done. almost ok except for the flake8 E231. need to follow up with andy

* fix typos based on andy review

* linter test done. review with andy

* hyperparameter_tuning_op fix

* project name

* add delete repo

* fix image

* linter test done

* fix image reference

* fix typo image reference

* minor fixes

* karl fixes

* karl fixes on links

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:10:33 -07:00
6a05e0eb6c inardini real time churn feature store demo (#448)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:21:22 -05:00
40d643f11c Change bq://bigquery-public-data:iowa_liquor_sales_forecasting.2021_sales_predict for PREDICTION_DATASET_BQ_PATH (#423)
Co-authored-by: Jungwoon Lee <jungwoonlee@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 09:10:10 -05:00
Andrew FerlitschandGitHub 72009cd21b fix: misspelling of BigQuery 2022-04-06 20:15:07 -07:00
Andrew FerlitschandGitHub cc9a50f40b Update get_started_with_vertex_private_endpoints.ipynb 2022-04-06 19:56:51 -07:00
Andrew FerlitschandGitHub e3135e8875 Update README.md 2022-04-06 17:42:45 -07:00
Andrew FerlitschandGitHub 59eb297151 feat: add notebook for private endpoints (#450)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: notebook for private endpoints

* feat: notebook for private endpoints
2022-04-06 17:41:10 -07:00
32b0c1c89e Mco mvmm (#420) - move model monitoring notebook from community to official
* license tweak

* remove unused import json

* fixed a missing import

* add sleep(300) to test my theory

* add missing newline

* put sleep behind a conditional

* revert new notebook name to previous name for compatibility with extant links

* fix quoting syntax error

* reformatted due to relint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-06 22:37:53 +01:00
3328a8190d Adding sample to use (auto) scaling config for Feature Store online store (#367)
* Add example using auto scale

* Format with nbqa

* Complete sentence

* Give the sample for CreateFeaturestoreRequest only, instead of actual call to create FS to avoid duplicate resource or extra cleanup.

* Remove unused import

* Remove version pinning

* Add try block to avoid error when test was not cleanup properly.

* Lint

* Fix import

* Merge print lro result with the call in the same try block

* Fix typo

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-04-05 17:02:49 -07:00
7aa6acdca6 fix UnboundLocalError in TF-Agents Bandits Guide (#446)
In "Step by Step Guide to Building Reinforcement Learning Applications using Vertex AI", the replay_buffer was unbound if training_data_spec_transformation_fn was provided to the train() function

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-05 16:30:40 -05:00
Andrew FerlitschandGitHub 7926ff1264 Update README.md 2022-04-05 11:10:12 -07:00
Andrew FerlitschandGitHub 67b926dfb4 feat: add notebook for FastAPI server (#447)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server
2022-04-05 11:08:09 -07:00
327f9e7a4b Fix typo in notebook heading. (#443)
* Fix typo in notebook heading.

* Fix linting issues.

Co-authored-by: Win Woo <wwoo@google.com>
2022-04-05 08:43:47 -05:00
Andrew FerlitschandGitHub 8be220d089 fix missing + 2022-04-04 14:40:27 -07:00
Andrew FerlitschandGitHub 2dad40f49f bucket setting fine-tuning 2022-04-04 14:39:45 -07:00
Andrew FerlitschandGitHub 99b724028f Update README.md 2022-04-04 13:51:43 -07:00
Andrew FerlitschandGitHub 909fbcb0d4 feat: notebook for TF Serving binary (#442)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions

* feat: notebook for TF Serving

* feat: notebook for TF Serving
2022-04-04 13:49:39 -07:00
Andrew FerlitschandGitHub 351fc3e4d3 fix: remove unused print_op 2022-04-04 09:05:33 -07:00
252b3d31a3 Inardini bqml components pipeline official blog (#416)
* bqml pipeline notebook for official blog

* add notebook to CODEOWNERS

* add author name

* requirements commenting fix

* linter test done

* unpin the maintenance version for kfp

* fix: install conflicts

* Update google_cloud_pipeline_components_bqml_text.ipynb

* add karl fix

* lint test done

* add andy fixes

* linter test done

* flip order of the special METADATA fix

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
2022-04-04 09:00:17 -07:00
Andrew FerlitschandGitHub bfdfaab38c Update README.md 2022-04-01 16:11:28 -07:00
Andrew FerlitschandGitHub 21a5963f84 feat: notebook for tf serving functions (#438)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions
2022-04-01 16:09:39 -07:00
9452249dce Added a new section called "Grant Dataproc roles to the Service Account" (#433)
* Ml ops 7v2 (#429)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* Update README.md

* Add files via upload

* Update README.md

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* feat: new notebook on endpoints (#430)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* wrong location

* Create README.md

* Update README.md

* Update README.md

* Update README.md

* Update README.md

* fix: links

* fix: title

* fix: example for reconfiguring the traffic split (#431)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* Add section on granting Dataproc IAM roles.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Win Woo <wwoo@google.com>
2022-03-31 20:14:16 -07:00
Andrew FerlitschandGitHub 49a9df058f fix: example for reconfiguring the traffic split (#431)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint
2022-03-31 15:27:27 -07:00
Andrew FerlitschandGitHub f99b7e5d17 fix: title 2022-03-31 12:28:15 -07:00
Andrew FerlitschandGitHub ac03c57a94 fix: links 2022-03-31 12:27:47 -07:00
Andrew FerlitschandGitHub 2e4cf648c5 Update README.md 2022-03-31 12:27:01 -07:00
Andrew FerlitschandGitHub f000baa328 Update README.md 2022-03-31 12:26:35 -07:00
Andrew FerlitschandGitHub 113f89604a Update README.md 2022-03-31 12:26:01 -07:00
Andrew FerlitschandGitHub 5019a004ce Update README.md 2022-03-31 12:25:42 -07:00
Andrew FerlitschandGitHub a577f3844a Create README.md 2022-03-31 12:25:31 -07:00
Andrew FerlitschandGitHub 88c7f0f690 wrong location 2022-03-31 12:24:20 -07:00
Andrew FerlitschandGitHub a18792499a feat: new notebook on endpoints (#430)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue
2022-03-31 12:23:22 -07:00
Andrew FerlitschandGitHub 0b5fc8bb3c Delete stage6b.png 2022-03-30 19:34:52 -07:00
Andrew FerlitschandGitHub 1f77410fda Add files via upload 2022-03-30 19:34:31 -07:00
Andrew FerlitschandGitHub 45fb57f29c Delete stage6c.png 2022-03-30 19:34:11 -07:00
Andrew FerlitschandGitHub 3380b394eb Delete stage6b.png 2022-03-30 19:34:03 -07:00
Andrew FerlitschandGitHub 1286cc5044 Add files via upload 2022-03-30 19:33:20 -07:00
Andrew FerlitschandGitHub 1ce1af791c Delete stage6c.png 2022-03-30 19:31:24 -07:00
Andrew FerlitschandGitHub 2587e329ee Delete stage6b.png 2022-03-30 19:31:15 -07:00
Andrew FerlitschandGitHub 37d4816051 Update README.md 2022-03-30 19:30:19 -07:00
Andrew FerlitschandGitHub d9dff882b8 Add files via upload 2022-03-30 19:29:41 -07:00
Andrew FerlitschandGitHub 26cc2c5278 Update README.md 2022-03-30 19:21:49 -07:00
Andrew FerlitschandGitHub 69aff1bdc4 Ml ops 7v2 (#429)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:20:41 -07:00
Andrew FerlitschandGitHub 567994f2b1 fix: add missing details to objective in endpoint notebooks (#428)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:16:02 -07:00
Andrew FerlitschandGitHub e316c7b8aa Update README.md 2022-03-30 17:31:59 -07:00
Andrew FerlitschandGitHub c07a059a8b Update README.md 2022-03-30 17:30:46 -07:00
Andrew FerlitschandGitHub 7b4bbffc41 feat: add endpoint notebook (#427)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example

* feat: add endpoint notebook

* feat: add endpoint notebook
2022-03-30 15:44:54 -07:00
bdc011ef34 Made some minor changes to get_started_vertex_training_pytorch (#406)
* Added notebook

* Ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-30 08:21:22 -05:00
Andrew FerlitschandGitHub 44ea0d7c61 Update README.md 2022-03-28 17:00:01 -07:00
Andrew FerlitschandGitHub aa950e5ee4 feat: add TFHub model example (#422)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example
2022-03-28 16:57:04 -07:00
Andrew FerlitschandGitHub 247906e50e fix: WORKDIR in Dockerfile 2022-03-28 15:52:28 -07:00
81b2493a44 Made minor changes to get_started_vertex_training_r (#417)
* addd file

* modified file

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-28 13:26:54 -07:00
WhiteSource RenovateandGitHub 97b0edb222 chore(deps): update dependency black to v22.3.0 (#421) 2022-03-28 14:23:25 -05:00
sudarshan-SpringMLandGitHub f0a9e4b9fe added mlops folder to tested_folders file (#418) 2022-03-28 10:37:21 -05:00
Andrew FerlitschandGitHub f35bbcaec5 update: details on dsl.Condition (#415)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition
2022-03-26 09:51:01 -07:00
Andrew FerlitschandGitHub 2822061dc9 Update README.md 2022-03-25 16:00:46 -07:00
Andrew FerlitschandGitHub be481c8d17 feat: add data labeling notebook (#414)
* feat: add data labeling notebook

* feat: add data labeling notebook
2022-03-25 15:56:22 -07:00
Andrew FerlitschandGitHub 605a972122 fix: testing issues (#413)
* fix: testing issues

* fix: testing issues
2022-03-25 13:26:53 -07:00
Andrew FerlitschandGitHub 66d98d9fe7 fix: testing issues (#412)
* fix: test failures

* fix: test failures
2022-03-25 10:58:39 -07:00
Krishna Chaitanya MovvaandGitHub 6445ed37c9 Updates the Mlops/stage2/ get-started-vertex-experiments notebook in the community folder (#410)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test
2022-03-25 10:52:21 -05:00
Andrew FerlitschandGitHub ca745aeee8 fix: better cleanup (#407)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook

* fix: better cleanup

* fix: better cleanup
2022-03-24 18:58:43 -07:00
f806b4927b Adds updated Mlops/stage1/get-started-bq notebook to the community folder (#392)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:51 -05:00
2942eb5d7f minor changes on Sdk automl tabular regression online bq1 (#369)
* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* Fix Bucket name variable

* run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:30 -05:00
2a5d6650ee Adds updated Mlops/stage2/get-started-bqml-training notebook to the community folder (#397)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:11:01 -05:00
Andrew FerlitschandGitHub 43e971f57a Update README.md 2022-03-24 11:38:17 -07:00
Andrew FerlitschandGitHub 785779613b feat: add dataproc notebook (#405)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook
2022-03-23 15:43:53 -07:00
Andrew FerlitschandGitHub 481193f0ca cleanup: delete created resources in the pipeline (#404)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline
2022-03-23 14:06:58 -07:00
Karl WeinmeisterandGitHub 2cb3cccd14 Fix: Linting issues in two tower notebook (#402) 2022-03-22 16:08:12 -05:00
7c16766994 minor changes in sdk automl image object detection batch (#370)
* Add minor changes to automl image object detection

* run linter

* Correct the milli nodes hours

* fix errors

* fix getenv

* Run linter

* remove tabular notebook, wrongly added

* Correct the bucket varible and minor changes to text

* Run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-22 13:18:27 -07:00
Andrew FerlitschandGitHub 448d18deca update: for official (#401)
* update: for official

* update: for official
2022-03-22 09:26:34 -07:00
97022b0733 Feat: Add Pluto on Workbench tutorial (#399)
* Initial commit

* Undo master commit

* Initial commit

* Update CODEOWNERS

* Add links to resolve PR comments

Co-authored-by: Ward K Harold <wkh@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 10:10:46 -05:00
c2a3e2d4cd deprecate: gapic XAI notebooks replaced by SDK notebooks (#394)
* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 09:46:47 -05:00
manuelamunateguiandGitHub b2dfcf17c8 E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Training for Scikit-Learn (#398)
* notebook refresh

* linter test after refresh
2022-03-22 09:37:09 -05:00
Andrew FerlitschandGitHub d061f09281 fix: replace os.environ with os.getenv - 2nd batch (#396)
* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv
2022-03-19 12:02:47 -05:00
daa64efd40 fix: replace os.environ with os.getenv (#393)
* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-18 16:44:34 -05:00
Andrew FerlitschandGitHub a37deabe27 Update README.md 2022-03-18 13:15:34 -07:00
Andrew FerlitschandGitHub 6009ef0def Update README.md 2022-03-18 13:14:34 -07:00
Andrew FerlitschandGitHub edc644b0d0 Update README.md 2022-03-18 13:13:15 -07:00
Andrew FerlitschandGitHub 1297af8baf Create README.md 2022-03-18 13:11:38 -07:00
Andrew FerlitschandGitHub b8b1b6675b Update README.md 2022-03-18 13:09:51 -07:00
Andrew FerlitschandGitHub 7d3b7abc44 fix: review updates (#395)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl

* review: edits per Erwin review

* review: edits per Erwin review
2022-03-18 12:09:53 -07:00
Rajesh ThallamandGitHub 9a572f298e [community-content] Notebook to demo NVIDIA Triton Inference Server on Vertex AI Prediction (#391)
* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Fixes based on feedback to NVIDIA Triton on Vertex AI Prediction community notebook
2022-03-18 11:31:01 -05:00
b53ca9e678 Tabnet (#375)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-17 17:20:01 -05:00
Andrew FerlitschandGitHub 9aceec161a Update README.md 2022-03-17 14:50:24 -07:00
Andrew FerlitschandGitHub 98b186ed55 feat: notebook for bqml+automl combined (#390)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl
2022-03-17 14:46:29 -07:00
sudarshan-SpringMLandGitHub f23ee1b5a8 Made small changes to Get started vertex vizier notebook (#389)
* modified notebook

* ran linter test

* modified notebook changed copyright licence year

* ran linter test
2022-03-17 10:03:19 -05:00
c6d779f1fc Featurestore colab update (#387)
* update featurestore colab comment

* delete some changes

* delete some changes 2

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-16 21:31:22 -05:00
Andrew FerlitschandGitHub 8908b27b08 feat: finish CPR notebook (#388)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook
2022-03-16 14:00:03 -07:00
Andrew FerlitschandGitHub 8947c9b116 feat: more CPR (#385)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook
2022-03-15 11:56:29 -07:00
Andrew FerlitschandGitHub 9464caac6e Update README.md 2022-03-14 17:40:15 -07:00
Andrew FerlitschandGitHub 98ce91c575 feat: add CPR notebook (#384)
* feat: add CPR notebook

* feat: add CPR notebook
2022-03-14 17:38:47 -07:00
Andrew FerlitschandGitHub 07f8feda3d Update README.md 2022-03-14 11:19:31 -07:00
Andrew FerlitschandGitHub a4e0496ff5 feat: CMEK training (#383)
* feat: add FS from panda

* feat: add FS from panda

* feat: add CMEK example

* feat: add CMEK example
2022-03-14 11:15:35 -07:00
cf162c02c8 chore(deps): update dependency pyupgrade to v2.31.1 (#381)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:34:58 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
831aae94df build(deps): bump pillow (#378)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:33:36 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
3fd9f28778 build(deps): bump pillow (#379)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:32:20 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a656e8e2a8 build(deps): bump pillow (#380)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-03-14 09:30:19 -05:00
Morgan DuandGitHub 2f02152703 fix: pip install google-cloud-aiplatform (#376) 2022-03-10 12:00:08 -06:00
9d08f8ce67 Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components (#372)
* Using BQML 1st-party components and 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML components and upgrade to 1.0.0 of GCPC

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:34:12 -06:00
ec6d508793 adds automl-text-sentiment-analysis-online notebook (#293)
* adds automl-text-sentiment-analysis-online notebook

* adds the cleaned up automl-text-sentiment-analysis notebook after running linter test

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* deletes the source file from the community/sdk folder

* updates the colab, git & workbench links in the notebook

* ran linter test

* updates the license year to 2022 and simplifies the clean-up step for bucket-deletion

* ran linter test

* adds TESTING env condition while deleting the buckets

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:09:10 -06:00
WhiteSource RenovateandGitHub 772e35ea75 chore(deps): update dependency nbqa to v1.3.1 (#374) 2022-03-09 08:24:16 -06:00
Andrew FerlitschandGitHub 1d28f886c8 feat: add example of FS values from dataframe (#373)
* feat: add FS from panda

* feat: add FS from panda
2022-03-08 17:44:59 -08:00
Andrew FerlitschandGitHub d3dc8aeb9a fix: missing create dataset schema (#371)
* fix: missing dataset create

* fix: missing dataset create
2022-03-07 11:53:39 -08:00
WhiteSource RenovateandGitHub a07d762934 chore(deps): update dependency nbqa to v1.3.0 (#368) 2022-03-07 09:53:42 -06:00
Andrew FerlitschandGitHub 85ac9e127d update: v1 (#366)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* update: v1

* update: v1
2022-03-04 17:47:56 -08:00
Gal ZahaviandGitHub 011c2823ff Update CODEOWNERS (#361) 2022-03-04 22:43:10 +02:00
Karl WeinmeisterandGitHub f28a94f03f docs: Add visualization of repo structure to README.md (#364) 2022-03-04 12:46:26 -06:00
5ecfc80cb9 Adds minor changes(license year and clean-up step) to Sdk automl video action recognition batch notebook (#355)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

* updates the license year to 2022 and simplifies the lean-up step for bucket created

* ran linter test

* removes the file from the community folder

* adds the TESTING env condition while deleting the buckets

* ran linter test successfully

* adds TESTING env condition while deleting the bucket

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-04 12:44:39 -06:00
Andrew FerlitschandGitHub e5e36ba050 fix: upgrades to v1 (#360)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 20:05:36 -08:00
Andrew FerlitschandGitHub 0ad9116d6a fix: v1 upgrades (#359)
* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 17:49:45 -08:00
0516032443 Update CODEOWNERS (#354)
* Update CODEOWNERS

* Update CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:23:19 -06:00
95d211c90f Fixing minor issues in sdk_automl_text_entity_extraction_online.ipynb (#329)
* modified colab,github,vertexAI links and added vertex logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:17:48 -06:00
12d6a75ef7 Fixing minor issues in sdk_automl_video_object_tracking_batch.ipynb (#328)
* changed master to main for links and added vertex AI logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:07:50 -06:00
Andrew FerlitschandGitHub 06153dc373 Update README.md 2022-03-02 11:45:01 -08:00
Andrew FerlitschandGitHub 02afa91fc3 Ml ops 6v3 (#352)
* fix: eval comp improvement

* fix: eval comp improvement

* feat: add to KFP get started
2022-03-02 10:38:42 -08:00
Karl WeinmeisterandGitHub c8b212789f Revert "ci: Apply filter to format_and_lint_job (#348)" (#351)
This reverts commit 95256d3fcf.
2022-03-02 09:44:03 -06:00
Karl WeinmeisterandGitHub 95256d3fcf ci: Apply filter to format_and_lint_job (#348)
* ci: Apply filter to format_and_lint_job

Only run when PR contains a notebook file

* Minor fix
2022-03-02 09:29:38 -06:00
Karl WeinmeisterandGitHub 8a6d174c99 Create README.md for notebooks folder 2022-03-01 19:44:41 -06:00
WhiteSource RenovateandGitHub d36cf7f662 chore(deps): update actions/setup-python action to v3 (#337) 2022-03-01 19:04:32 -06:00
WhiteSource RenovateandGitHub 1b02a542c8 chore(deps): update actions/checkout action to v3 (#347) 2022-03-01 19:02:39 -06:00
Ivan CheungandGitHub 45430bb010 Fixed minor issues (#345) 2022-03-01 14:56:50 -06:00
Ivan CheungandGitHub be2a139ade Delete notebooks/community/feature_store/assets directory 2022-02-28 20:21:17 -05:00
70d77b24f6 feature store e2e with assets (#343)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)

* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>

* Added files in their old folder

* Deleted unneeded file

* Ran linter

* Fixed CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-28 19:23:15 -05:00
Ivan CheungandGitHub 50c25d6d7b Revert "A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)" (#338)
This reverts commit 5bcdc0bc64.
2022-02-28 11:01:39 -05:00
5bcdc0bc64 A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-28 07:47:26 -08:00
eff0f95b58 Automl links fix (#330)
* fixing links to open notebook - main and images

* linter test changes

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:57:25 -06:00
50b53d31bd Jfacevedo endpoints tfhub obj detect (#319)
* Deploying TF Hub object detection model using Vertex endpoints

* Add user to codeowners

* fix path in CODEOWNERS

* clear all outputs

* run linter

* manual lint fix

* fix more linting errors

* order imports in alphabetical order

* run linter

* made changes requested on feedback

* automate fetching endpoint model id

* fix hardcoded value in bash command

* generalize region endpoint and project in bash cell

* retrieve endpoint and model ids programatically

* fix formatting

* run linter

* Remove pipfile

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:55:54 -06:00
Andrew FerlitschandGitHub b5a56852f3 fix: automl eval component improvement (#333)
* fix: eval comp improvement

* fix: eval comp improvement
2022-02-25 12:07:06 -08:00
b7486e34ad Sdk automl video action recognition batch (#310)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 11:31:19 -06:00
3edc5f1425 Notebook template (#326)
* modified vertex AI link

* minor change

* changed master to main and added vertex logo

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 10:16:34 -06:00
65b4b73cb5 Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook (#288)
* Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook.ipynb

* format with linter

* add import for tensorflow when in the testing environment

* linter

* fix dependency issues for testing env

* address comments

* eval component  does not output gcp_resources yet, still in experimental

* added location to aip.init

* add deletion for model and batch prediction jobs

* typo, missed a comma.

* linter

* Remove tensorflow import + use gsutil to check if artifacts exist.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 15:36:35 -08:00
Ivan CheungandGitHub 186c08e8c3 Update sdk_matching_engine_for_indexing.ipynb 2022-02-24 17:47:53 -05:00
Ivan CheungandGitHub 7721aa0def Added matching engine with SDK notebook (#327)
* Matching engine

* Added notebook

* Updated CODEOWNERS

* Fixed links

* Added logo

* Renamed Workbench
2022-02-24 14:57:16 -05:00
4987c60e03 updating gcloud usage because a flag was renamed (#320)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 09:33:33 -06:00
Andrew FerlitschandGitHub cd845f7fdd feat: start on model eval notebook (#325)
* fix: bqml export format

* fix: bqml export format

* feat: start on custom model eval

* feat: start on custom model eval
2022-02-23 12:56:01 -08:00
Andrew FerlitschandGitHub 9e84d9e782 fix: bqml doc for exporting model (#324)
* fix: bqml export format

* fix: bqml export format
2022-02-23 12:44:43 -08:00
nayaknishantandGitHub 23c7fcc97f fix: changed bucket URL from pantheon to console (#323)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console
2022-02-23 13:17:12 -06:00
e4024efbc7 feat: add community notebook for Vertex AI SDK Feature Store with Pandas (#311)
* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* fix: lint

* fix: addressed feedback

* fix: format

* fix: lint

* Linted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-23 10:22:28 -08:00
Ivan CheungandGitHub c4d53108af Matching Engine: Updated location for data (#322)
Switched to gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5
2022-02-23 12:03:48 -05:00
be8fe3564d Sdk automl video classification batch (#295)
* notebook refresh from vertex ai sdk project batch 1

* successfully ran linter test

* removed global variable import file

* update with linter test changes

* removing community version of dk_automl_video_classification_batch.ipynb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:11:42 -08:00
1f95775057 Sdk automl text entity extraction online (#283)
* added notebook

* ran linter

* fix aip not defined error

* ran lint

* resolved git comments

* ran linter

* deleted file in community folder and removed globals

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:07:55 -08:00
f2a4dd875e Sdk automl video object tracking batch (#281)
* added notebook

* changed folder

* reinstalled linter

* ran linter

* pulled new changes and merged

* resolved comments

* resolved comments

* ran linter

* deleted file in community folder and removed globals in file

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-22 21:06:52 -08:00
Aaron DietzandGitHub 67dd2300c8 updating text (#309) 2022-02-22 17:17:00 -05:00
Aaron DietzandGitHub b5391b06b4 Pricing optimization update (#308)
* updating text

* rename

* rename
2022-02-22 17:13:16 -05:00
Aaron DietzandGitHub 54f2c71c13 updating text (#307) 2022-02-22 16:51:54 -05:00
Aaron DietzandGitHub 6697900126 updating text (#306) 2022-02-22 16:39:46 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
9ff3400b44 build(deps): bump tensorflow (#316)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 13:01:06 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
3ff0726ebf build(deps): bump tensorflow (#315)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 08:54:19 -06:00
Amy WuandGitHub c96c939dfe Fix RL samples (#270)
* Update step_by_step sample

* Update mlops sample and fix worker_pool_specs issue for thr trainer component

* Fix lint

* Fix lint

* Fix lint

* Fix import order

* Fix nbfmt

* Update component.yaml

* Format notebook

* Update component.yaml url

* Lint
2022-02-17 16:37:52 -08:00
719cf280c9 Updating markdown text to meet higher standard (#305)
* Updating markdown text to meet higher standard

* formatted nb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-17 17:45:15 -06:00
4ec6e2df04 [community-content] PyTorch on Google Cloud Vertex AI - Fixes based on feedback (#290)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

* PyTorch on Vertex - fixes based on review

* PyTorch on Vertex - linter fixes

* PyTorch on Vertex - fixes based on feedback

* PyTorch on Vertex - fixes based on feedback

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 17:41:48 -06:00
031a9190c3 automl-tabular-classification.ipynb: Added missing code and removed unneeded text (#255)
* Added missing code and removed unneeded text

* Ran linter

* Ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 08:03:16 -08:00
5204dcf327 update training and batch predict notebook with importer (#303)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:56 -08:00
cad623ef84 update hp tuning sample to use importer (#302)
* update hp tuning sample to use importer

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:23 -08:00
a59f58f8b6 Use importer for the bqml (#299)
* Use importer for the bqml

* Update get_started_with_bqml_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:00:44 -08:00
nayaknishantandGitHub d89c613f5d moving REGION up (#300)
* moving REGION up

* moving REGION up and csv file name
2022-02-16 17:11:46 -08:00
Andrew FerlitschandGitHub fa265ddb2f feat: fix for sklearn XAI (#301)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1

* fix: XAI for sklearn

* fix: XAI for sklearn
2022-02-16 17:00:16 -08:00
ec3dd04935 SDK Featurestore notebook (#284)
* SDK Featurestore notebook

* fixed issues, tried to make notebook more readable, style

* removed previous notebook

* moved sdk-feature-store to community (for now)

* made fixes

* moved BQ output table cells down

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-02-16 16:04:43 -08:00
Andrew FerlitschandGitHub 0c83e81410 fix: 0.3.0 breaking change 2022-02-16 14:13:57 -08:00
Andrew FerlitschandGitHub 7808a843cc fix: breaking 0.3.0 change 2022-02-16 14:02:36 -08:00
Andrew FerlitschandGitHub 615d7706af fix: breaking change in 0.3.0 2022-02-16 13:53:35 -08:00
Ivan CheungandGitHub f05ca4d06a Added project to BQ client instantiation (#285) 2022-02-16 16:27:08 -05:00
Andrew FerlitschandGitHub cb4145e2b6 test: fix for testing (#298)
* test: fixes for testing

* test: fixes for testing
2022-02-16 11:23:45 -08:00
6917c9aa7b adding initial sample notebook for Tensorboard (#286)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 09:45:01 -08:00
Andrew FerlitschandGitHub c1d2451656 feat: update to v1 (#294)
* feat: update to v1

* feat: update to v1

* feat: update to v1

* feat: update to v1
2022-02-16 09:35:41 -08:00
Ivan CheungandGitHub c41ec1fabd Cleaned up cleanup section (#291) 2022-02-16 10:28:42 -05:00
Ivan CheungandGitHub 273c91882e Delete setup_env.md 2022-02-15 20:45:06 -05:00
Ivan CheungandGitHub ad6b5e5830 Update test_notebook_vm.txt 2022-02-15 18:17:11 -05:00
Ivan CheungandGitHub d441eb9d7a Update test_notebook_vm.txt 2022-02-15 18:14:37 -05:00
Andrew FerlitschandGitHub 139d805c9f feat: update to v1 (#292)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1
2022-02-15 11:20:22 -08:00
Andrew FerlitschandGitHub 783347fc8e feat: update FS notebook to use SDK (#287)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK
2022-02-14 13:21:28 -08:00
6d722d081d Fix links (#274)
* Fixes and renames link to launch automl-text-classification.pynb in Vertex AI Workbench

* Fixes and renames link to launch sdk_automl_tabular_forecasting_batch.pynb in Vertex AI Workbench

* Fixes links for launching notebook in Vertex AI Workbench for Explainable AI samples

* Fixes link for launching notebook in Vertex AI Workbench for model monitoring sample

* Fixes links to launch pipelines notebook samples

* Fixed lint problem in automl-text-classification.ipynb

* Autofixed lint errors

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-14 11:48:41 -05:00
Andrew FerlitschandGitHub 33a8c6ca0e feat: add create component example (#279)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example
2022-02-10 14:23:22 -08:00
Karl WeinmeisterandGitHub ae043400f5 Add survey to README.md (#272) 2022-02-10 14:52:33 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
e41f96b31f build(deps): bump tensorflow (#275)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:37:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
7220f15158 build(deps): bump tensorflow (#276)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:33:59 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
b8d7eaa767 build(deps): bump tensorflow (#278)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:31:20 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a612b463a8 build(deps): bump tensorflow (#277)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-10 09:16:10 -06:00
Andrew FerlitschandGitHub 493e7e81b5 Update README.md 2022-02-09 10:19:58 -08:00
Andrew FerlitschandGitHub b6cf0dbefd feat: XAI with sklearn (#273)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn
2022-02-09 10:17:16 -08:00
Brian KangandGitHub 5d5c08f9e7 Pytorch lightning sdk example - Missed Notebook added (#269)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Revert "Adjust Tensorboard to TensorBoard"

This reverts commit 9aac52e358b4ccc27a9a5a9e3bc5ef3305553462.

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard and and run lint
2022-02-08 16:36:30 -08:00
Andrew FerlitschandGitHub bfdfac0f81 feat: XAI notebook (#271)
* feat: get started XAI

* feat: get started XAI
2022-02-08 14:13:05 -08:00
Andrew FerlitschandGitHub 9c72b7e3e7 Update README.md 2022-02-08 12:57:22 -08:00
Andrew FerlitschandGitHub 46519e5c64 Update README.md 2022-02-08 12:26:57 -08:00
Brian KangandGitHub 0ff961e203 Pytorch lightning sdk example (#268)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model
2022-02-07 17:36:40 -08:00
Andrew FerlitschandGitHub cbc17c6832 feat: use gcsfuse (#265)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU

* feat: use gcsfuse

* feat: use gcsfuse
2022-02-04 11:17:51 -08:00
Andrew FerlitschandGitHub 93e5b15cba Update README.md 2022-02-04 11:09:31 -08:00
Andrew FerlitschandGitHub 081e65d076 Update README.md 2022-02-04 10:09:45 -08:00
Ivan CheungandGitHub 4ab2cfb713 feat: Added test_notebook_vm.txt to only test fast-running notebooks. Also fix private_pool not being used for tests. (#248)
* feat: Added test_notebook_vm.txt

* Propagate private pool to child builds

* Fixed workerpool issue

* Removed private pool requirement

* Added default pool

* Fixed private pool region issue

* Added comment

* Made private_pool_id arg optionally present

* Fixed when private pool is optional

* Fix regional issue bug

* Fixed pandas requirement

* Removed flaky notebook
2022-02-03 15:48:40 -05:00
Andrew FerlitschandGitHub a73335c0af feat: add batch and TPU (#262)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU
2022-02-02 17:45:31 -08:00
0f3e257773 Pricingoptimization (#249)
* added notebook

* ran lint

* updated main

* ran lint

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-02 13:25:41 -05:00
Andrew FerlitschandGitHub 57d734d84f fix: spelling (#260)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling
2022-02-01 17:07:10 -08:00
Andrew FerlitschandGitHub 07f2e9c999 Update README.md 2022-02-01 12:15:31 -08:00
Andrew FerlitschandGitHub 401883cae3 feat: add R notebook (#259)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook
2022-02-01 12:11:26 -08:00
7bc92e1e3c Update google_cloud_pipeline_components_automl_images.ipynb (#252)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-02-01 13:33:22 -06:00
de5f8b0653 Removed unneeded lines in linter (#257)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-01 12:19:19 -05:00
cfa73ed53b chore(deps): update dependency black to v22 (#254)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-31 13:50:57 -06:00
Andrew FerlitschandGitHub 67370bb1c7 Update README.md 2022-01-31 10:39:28 -08:00
Andrew FerlitschandGitHub f60593255a feat: add Pytorch notebook (#256)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook
2022-01-31 10:38:28 -08:00
Andrew FerlitschandGitHub c6f9b97615 test: rm caching of components (#247)
* fix: testing

* fix: testing

* fix: not installing pandas
2022-01-31 13:33:18 -05:00
Andrew FerlitschandGitHub 6161a394c2 fix: predict on exported BQML model (#250)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML
2022-01-27 10:35:20 -08:00
ivanmkc b35cd42015 Added exception check for deletion method 2022-01-27 11:54:29 -05:00
Ivan CheungandGitHub 5e323993db [WIP] Relax requirements for DLVM's (#238)
* Update requirements.txt

* Relax all CI requirements
2022-01-26 16:47:09 -05:00
Andrew FerlitschandGitHub f1623e419e Update README.md 2022-01-26 12:10:16 -08:00
Andrew FerlitschandGitHub a3047fb1bb feat: xgboost notebook (#246)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training
2022-01-26 12:09:07 -08:00
Karl WeinmeisterandGitHub b4d02f486e Update CODEOWNERS with new community blog post (#244) 2022-01-26 09:16:48 -08:00
9e24893b9b feat: Add sentiment analysis notebook (#195)
* added notebook

* ran lint

* resolved comments

* ran lint

* resolved comments

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-26 08:56:40 -06:00
47dec6ecef chore(deps): update dependency pyupgrade to v2.31.0 (#241)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:53:32 -06:00
059fea672c chore(deps): update dependency nbqa to v1.2.3 (#240)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:49:47 -06:00
389e804426 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#236)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:46:09 -06:00
Andrew FerlitschandGitHub 087a638c18 Update README.md 2022-01-25 22:16:55 -08:00
Andrew FerlitschandGitHub 97757c74ca feat: sklearn training (#243)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn
2022-01-25 22:15:51 -08:00
Andrew FerlitschandGitHub 08f3ad583b feat: finish hpt components notebook (#239)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook
2022-01-25 10:02:28 -08:00
Karl WeinmeisterandGitHub 16f01d31d3 chore: Update notebook template license date to 2022 (#237)
* chore: Update notebook template license date to 2022

* chore: Add extra space to address lint error
2022-01-25 11:20:00 -06:00
e0f6c66351 chore(deps): update dependency pandas to v1.4.0 (#233)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-24 13:58:50 -06:00
Ivan CheungandGitHub 3733b28772 Updated requirements (#235) 2022-01-24 14:54:31 -05:00
24f8912134 feat: Add inventory prediction notebook (#216)
* made changes

* made changes

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-24 14:07:42 -05:00
WhiteSource RenovateandGitHub cdc8847f9b chore(deps): update dependency papermill to v2.3.4 (#234) 2022-01-24 10:46:31 -06:00
Andrew FerlitschandGitHub 25bd4b9eb5 Update README.md 2022-01-21 19:05:35 -08:00
Andrew FerlitschandGitHub d476191252 feat: add notebooks (#232)
* feat: friday update

* feat: friday update
2022-01-21 17:14:31 -08:00
nicainandGitHub bf35d6a07c Add metadata to hide cells (#226) 2022-01-21 14:57:24 -08:00
5378d38a05 chore(deps): update dependency ipython to v8.0.1 (#222)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-21 11:15:14 -06:00
Ivan CheungandGitHub 85984f1173 Fixed broken Colab link 2022-01-20 17:52:56 -05:00
Ivan CheungandGitHub 92bb40349f Cleaned up cloud build by renaming files and moving methods around (#219)
* Cleaned up cloud build

* Fixed bug

* More renaming and comment cleanup

* Added helper file

* Fixed missing return
2022-01-20 15:55:38 -05:00
Rajesh ThallamandGitHub fcee9bf738 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#227)
* PyTorch on Vertex - Adding pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook, clearing outputs

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - reverting serving Dockerfile changes

* PyTorch on Vertex - linting fixes

* PyTorch on Vertex - updates to README

* PyTorch on Vertex - linter related fixes
2022-01-20 13:20:00 -06:00
nicainandGitHub cc2f3408ad Update Run After --> Run Selected Cell and All Below (#228) 2022-01-20 08:07:31 -06:00
nicainandGitHub 89fb218041 Alphafold on gcp tutorial (#221)
* Original alphafold Dockerfile and notebook as a starting point

* Migrate dependencies from notebook into Dockerfile

* adding build_docker.sh script for building docker image

* remove cell, and replace with accelerator configuration cell. Also remove dependency on google.colab

* dockerfile remove redundant

* Changing text in launch button

* add vertexai.png

* update notebook, including permalink to vertexai.png

* updating notebook markdown and correcting the vertexai.png image display

* add div brackets and fix broken launch link

* table instead of div

* width=40

* resizing vertexai image

* updated FAQ

* updated Licence

* add back in the output_file zip

* launch button at top of notebook

* default workdir aligned with JuptyerLab home directory

* intro paragraph

* update CPU instructions

* exchange notebook title and launch header

* Dockerfile license

* collapsing cells

* splitting out sequences into un-collapsed cell

* Update licence

* update download instructions text

* Remove "double-click" text

* hide cells

* Increasing indent to pass linting for alphafold_on_gcp (#224)

* increasing indent to pass linting

* more linting

* wild

* AMBER relaxation f-string

* hidden cells

* wild commit

* move links to main
2022-01-19 18:47:21 -08:00
Andrew FerlitschandGitHub 4d0c3781e5 Update README.md 2022-01-19 12:30:01 -08:00
Andrew FerlitschandGitHub e2e319ac7f Update README.md 2022-01-19 11:08:55 -08:00
Andrew FerlitschandGitHub 63508cad3f feat: add ml metadata notebook (#223)
* weekly updates

* weekly updates

* feat: add metadata notebook

* feat: add metadata notebook
2022-01-19 10:58:03 -08:00
0b6eb6eed1 Updates to automl tabular beans pipeline (#220)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-18 15:34:57 -06:00
Polong LinandGitHub a41cfdeba5 Fix typo: Wikepedia --> Wikipedia (#217) 2022-01-18 08:28:04 -06:00
7a6763ca33 chore(deps): update dependency numpy to v1.22.1 (#214)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 17:10:52 -06:00
Sara RobinsonandGitHub 2a6e19e4f9 Update MLMD notebook to use pipeline submit() method (#215) 2022-01-14 17:09:45 -06:00
9f9526b722 Delete Dockerfile (#198)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 14:28:30 -05:00
Ivan CheungandGitHub 267684b7c3 Added private pool to cloud build config (#211) 2022-01-14 14:27:34 -05:00
Andrew FerlitschandGitHub b74dd3d576 Update README.md 2022-01-13 16:22:14 -08:00
Andrew FerlitschandGitHub 278ae48842 Update README.md 2022-01-13 16:21:28 -08:00
Andrew FerlitschandGitHub 189ca12627 Update README.md 2022-01-13 16:20:39 -08:00
Andrew FerlitschandGitHub 5108f57ba8 feat: weekly updates (#212)
* weekly updates

* weekly updates
2022-01-13 16:19:21 -08:00
6bace666e4 chore(deps): update dependency ipython to v8 (#209)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-13 15:24:51 -06:00
4c35616d30 fix: Increase timeout on explainability notebooks to prevent build failure (#205)
* test: update timeout of testing

* test: increase timeout for testing

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-13 15:13:20 -06:00
cadbc733b8 chore(deps): update dependency numpy to v1.22.0 (#207)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-13 14:19:43 -06:00
ee6088957d Update Swivel sample and Matching Engine sample (#193)
* Update swivel and matchine engine samples

* Fix lint

* format notebooks

* fix lint

* fix lint

* upgrade google-python-api-client for testing pipeline

* upgrade google-api-core for testing pipeline

* install tensorflow after other required packages

* fix lint

* upgrade google-auth for testing

* install tensorflow in testing env

* upgrade pip with user flag

* remove kfp as a dependency

* separate matching engine notebook into another commit

* fix service account extraction

* service account is optional so comment it

* submit pipeline without specifying service account

* clarify how TensorBoard relates to Vertex ML metadata

* add reference to Vertex ML metadata

* fix typo

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-01-12 17:51:23 -08:00
58118c89f7 Chicago taxi fare prediction (#196)
* added notebook

* made changes

* ran linter

* small changes

* made changes

* ran linter

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 16:51:19 -06:00
108112c9a0 Predictive maintaince usecase (#194)
* added

* ran linter

* comments resolved

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 16:49:09 -06:00
Andrew FerlitschandGitHub 4f586719e7 Update README.md 2022-01-11 12:57:16 -08:00
31e4985480 chore(deps): update dependency nbconvert to v6.4.0 (#197)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 13:32:39 -06:00
672b8bd262 chore(deps): update dependency numpy to v1.21.5 (#191)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-11 13:28:22 -06:00
Andrew FerlitschandGitHub c64c185407 Update README.md 2022-01-10 15:52:05 -08:00
Andrew FerlitschandGitHub 19fd6aa4e3 Add files via upload 2022-01-10 15:48:47 -08:00
Andrew FerlitschandGitHub 55746d05f3 Update README.md 2022-01-10 14:08:44 -08:00
Andrew FerlitschandGitHub ad8d6382d4 Update README.md 2022-01-10 14:07:04 -08:00
Andrew FerlitschandGitHub 5114a6c09c Update README.md 2022-01-10 14:05:09 -08:00
Andrew FerlitschandGitHub f405c109e2 fix: git links (#206)
* https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
'

* feat: updates

* feat: add BQML components

* fix: git links

* fix: git links
2022-01-10 13:08:04 -08:00
Andrew FerlitschandGitHub ff646fee07 Delete mlops_data_management.ipynb 2022-01-10 12:55:36 -08:00
Andrew FerlitschandGitHub e517a8998c Update README.md 2022-01-06 11:30:03 -08:00
Andrew FerlitschandGitHub 776a699a76 feat: BQML (#201)
* https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
'

* feat: updates

* feat: add BQML components
2022-01-06 11:25:46 -08:00
a942a63959 chore(deps): update dependency ipython to v7.31.0 (#199)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-05 19:22:15 -06:00
Andrew FerlitschandGitHub 4b275e3370 feat: updates (#200)
* https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
'

* feat: updates
2022-01-05 09:59:12 -08:00
Karl WeinmeisterandGitHub 7bb6787800 docs: Update incorrect quote mark in CONTRIBUTING.md (#190) 2021-12-21 10:20:42 -08:00
Andrew FerlitschandGitHub d314dda749 fix: friday update (#192)
* friday updates

* friday updates
2021-12-20 10:37:30 -08:00
3e955d0b83 chore(deps): update dependency pandas to v1.3.5 (#189)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-12-16 17:20:10 -06:00
WhiteSource RenovateandGitHub ae058696eb chore(deps): update dependency matplotlib to v3.5.1 (#188) 2021-12-16 17:14:30 -06:00
fa62eef2d1 chore(deps): pin dependencies (#8)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-12-16 17:06:22 -06:00
Karl WeinmeisterandGitHub 16b9dcc09f build: Add tensorflow pip install to migration notebook (#185)
* Add tensorflow pip install to migration notebook

The build is failing due to tensorflow missing. Adding this dependency.

* build: Testing change to notebook test to resolve build error

* build: Reverted change to base branch
2021-12-16 14:30:41 -08:00
Ben LackeyandGitHub ed559bd9f4 Change URL to root repo (#183) 2021-12-14 08:42:18 -06:00
Andrew FerlitschandGitHub ddb825addf fix: MLops update (#182)
* fix: friday update

* fix: friday update

* fix: friday update

* fix: friday update

* fix: friday update
2021-12-13 10:42:29 -08:00
Andrew FerlitschandGitHub b78dfa38ef Update README.md 2021-12-10 12:35:54 -08:00
Andrew FerlitschandGitHub 101abf0566 fix: MLops 3v4 update (#181)
* fix: friday update

* fix: friday update

* fix: friday update
2021-12-10 10:43:14 -08:00
Karl WeinmeisterandGitHub d121d4a51d Update CODEOWNERS to reflect current ownership (#179) 2021-12-09 11:22:48 -08:00
Ben LackeyandGitHub 5d933b9b13 Add Neo4j notebook (#173)
* Add Neo4j notebook

* delete extra line

* Across this notebook, the dataframe assignment and display occurs both within and outside with statements. Consider following the pattern of the 2nd query, where it is outside.

* Typo: unlabled

* AutoML Tables is no longer a standalone product in Vertex AI, so I suggest the naming "Vertex AI for AutoML tabular data."
2021-12-09 13:03:31 -06:00
Karl WeinmeisterandGitHub bdd0b0453a Update linter requirements.txt (#176)
Updating linter dependencies based on conversation in #173
2021-12-08 14:39:12 -08:00
639ecb962e Change to pip3 and add to PATH (#169)
Hi.  I tried to run this all through cloud shell.  pip makes to Python 2.0 there and the command fails.  So, this PR has pip3.

Also, the cloud shell path didn't know about the directory where all this stuff installed, so I've added a command to add it to PATH.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-12-07 13:54:23 -06:00
Karl WeinmeisterandGitHub b3adc0bbf3 Update .github files for main branch conversion (#170) 2021-12-07 13:25:06 -06:00
36455b8125 Pipelines rui (#158)
* feat: customm train gcpc

* feat: customm train gcpc

* feat: customm train gcpc

* feat: updates for Karl review

* fix: build issues

* fix: build issues

* fix: lint issue

* fix: build issue

* fix: build issue

* fixL]: build issue

* added back google-python-api-client

* Updated google-api-core dependency

* Fixed quote issue

* Update location of google-api-core install

* Add force reinstall flag

* Separate TF and google-api-core installs

* add missing comma

* Added reinstall of google-auth

* Added force-reinstall for Tensorflow dependencies

* fix missing comma

* trying upgrade of google core packages

* Added diagnostic step and added httplib2

* Added more debugging statements

* Try changing user_flag when IS_TESTING set

* Update google-api-python-client dependency

* Add google-auth and force reinstall

* Update google-api-python-client

* Removed diagnostics and simplified test environment installs

* fix: TW review updates

* fix: TW review

* debug: notebook testing

* TW review update

* TW  review update

* test: force retest

* fix: lint

Co-authored-by: Karl Weinmeister <kweinmeister@google.com>
2021-12-03 11:13:12 -08:00
Andrew FerlitschandGitHub 1a748c7d1c Update mlops_experimentation.ipynb 2021-12-03 10:29:50 -08:00
Andrew FerlitschandGitHub 53734bf984 Ml opml ops 3v4 (#167)
* friday updates

* friday updates

* friday updates

* friday updates

* fix: custom train

* fix: custom train

* remove debug info

* fix: remove debug

* fix: remove debug

* fix: remove debug

* fix: remove debug

* fix: remove debug
2021-12-03 10:28:47 -08:00
Andrew FerlitschandGitHub 858ed794e6 feat: MLops 3v4 (#166)
* friday updates

* friday updates

* friday updates

* friday updates

* fix: custom train

* fix: custom train

* remove debug info

* fix: remove debug
2021-12-03 10:18:18 -08:00
Andrew FerlitschandGitHub e90e0fa7bd Update README.md 2021-11-30 18:42:23 -08:00
Andrew FerlitschandGitHub 81bbcce326 fix: custom train (#165)
* friday updates

* friday updates

* friday updates

* friday updates

* fix: custom train

* fix: custom train
2021-11-30 18:41:28 -08:00
Brian KangandGitHub d271648779 TPU pipeline to community folder (#164)
* TPU pipeline to community folder

* Changes per review by Andrew F

* Lint test

* Moved to community/pipelines

* Updated codeowners to reference pipelines folder

* Update to codeowners
2021-11-30 10:35:19 -05:00
Andrew FerlitschandGitHub f832c5d120 feat: stage 3 updates (#163)
* friday updates

* friday updates

* friday updates

* friday updates
2021-11-29 12:28:11 -08:00
Andrew FerlitschandGitHub 18f12353a7 feat: stage 3 friday updates (#160)
* feat: friday updates

* feat: friday updates

* feat: Friday updates

* feat: Friday updates
2021-11-19 15:59:27 -08:00
Karl WeinmeisterandGitHub a79a283a77 build: Add step to upgrade pip (#159)
* build: Add step to upgrade pip

* Changed location for running pip upgrade

* Removed whitespace
2021-11-19 15:02:48 -06:00
f67e0f0531 Add ML Metadata + Pipelines notebook (#59)
* feat: MLMD + Pipelines notebook

* Updates from notebook execution test

* Update with changes from linter

* Update MLMD notebook from feedback, upgrade to latest sdk versions

* Add metadata notebook to codeowners file

* Resolve merge conflicts with codeowners

* Update KFP and Vertex SDK versions

* Run the linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2021-11-18 12:23:42 -06:00
Andrew FerlitschandGitHub d6b6eb9483 Update README.md 2021-11-16 16:29:19 -08:00
096e3e1090 Moved forecasting to official folder (#84)
* Added forecasting notebook

* Fixed forecasting notebook

* Ran linter

* Small fix

* Fixed dataset variable name conflict

* Ran linter

* Fixed cleanup bug

* fix: remove online prediction reference

* fix: rephrase title to just AutoML tabular forecasting

* fix: update training time to one hour

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2021-11-16 16:24:06 -08:00
Andrew FerlitschandGitHub 400ff8c4a4 feat: get started BQML (#157)
* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates

* feat: add BML get started

* feat: add BML get started
2021-11-16 16:22:28 -08:00
Karl WeinmeisterandGitHub 1b0a3e8f90 Linting updates for PR #154 (#155)
* Removed extra scaling call in image notebooks

* formatting/linting updates
2021-11-16 15:05:26 -08:00
Andrew FerlitschandGitHub 91e17e3d80 Add files via upload 2021-11-16 10:02:37 -08:00
Andrew FerlitschandGitHub 40b80f357d Update README.md 2021-11-16 08:57:51 -08:00
Andrew FerlitschandGitHub 868423fd09 feat: updates for stage3 (#156)
* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates

* feat: stage3 updates
2021-11-16 08:56:00 -08:00
Karl WeinmeisterandGitHub 644612fde9 Removed extra scaling call in image notebooks (#154) 2021-11-15 17:45:02 -08:00
Ivan CheungandGitHub a2ae130378 Fixed edge case where no notebooks are detected (#152) 2021-11-15 13:11:17 -06:00
Karl WeinmeisterandGitHub dddd43c191 Revert "Temporary CI change to exempt failed notebooks (#148)" (#150)
This reverts commit 3632c5b849.
2021-11-15 13:03:46 -06:00
Andrew FerlitschandGitHub 6589d56e4c fix: install TF 2021-11-15 10:11:33 -08:00
Andrew FerlitschandGitHub 5d5c4b8e9d fix: add install for TF 2021-11-15 10:10:15 -08:00
Andrew FerlitschandGitHub d380f45485 fix: misspelling 2021-11-15 09:46:13 -08:00
Andrew FerlitschandGitHub 33d8fed6d7 fix: IS_TESTING 2021-11-15 09:32:24 -08:00
Andrew FerlitschandGitHub 6e59dec4f0 fix: IS_TESTING 2021-11-15 09:31:00 -08:00
Andrew FerlitschandGitHub fe802e118c fix: IS_TESTING 2021-11-15 09:30:06 -08:00
Andrew FerlitschandGitHub d018865a7c fix: IS_TESTING 2021-11-15 09:29:23 -08:00
Andrew FerlitschandGitHub 9c0f8fc5bf fix: IS_TESTING 2021-11-15 09:27:19 -08:00
Andrew FerlitschandGitHub bc58e05d2a fix: IS_TESTING 2021-11-15 09:26:26 -08:00
Andrew FerlitschandGitHub 977a4657fa fix: IS_TESTING 2021-11-15 09:10:46 -08:00
Andrew FerlitschandGitHub e8cbe3c5c5 fix: IS_TESTING 2021-11-15 09:09:40 -08:00
Andrew FerlitschandGitHub 8b114d3eec fix: IS_TESTING 2021-11-15 09:07:18 -08:00
Ivan CheungandGitHub 740958005a Parallel custom job notebook execution (#120)
* Initial commit

* Added parallel execution
2021-11-12 18:31:36 -05:00
Karl WeinmeisterandGitHub d65e074163 Updated doc locations for PolicyBot compliance (#149)
* Updated doc locations for policybot compliance

* Removed docs folder with duplicates
2021-11-12 16:28:02 -06:00
google-cloud-policy-bot[bot]GitHubgoogle-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
816c8f2309 chore: add SECURITY.md (#145)
Co-authored-by: google-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
2021-11-12 11:32:03 -06:00
google-cloud-policy-bot[bot]GitHubgoogle-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
a9e0b99992 chore: add CONTRIBUTING.md (#146)
Co-authored-by: google-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
2021-11-12 11:31:52 -06:00
google-cloud-policy-bot[bot]GitHubgoogle-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
a61802821d chore: add a Code of Conduct (#144)
Co-authored-by: google-cloud-policy-bot[bot] <80869356+google-cloud-policy-bot[bot]@users.noreply.github.com>
2021-11-12 11:31:39 -06:00
Alec GlassfordandGitHub b078e50cc0 Relax language re: multi-region bucket for training (#142)
I believe you *can* use a multi-region; it just might not work as well (e.g. for latency, cost) as a regional bucket where you are doing other operations. This removes in inaccurate statement.
2021-11-12 11:22:30 -06:00
Karl WeinmeisterandGitHub 3632c5b849 Temporary CI change to exempt failed notebooks (#148)
#120 is failing due to existing notebooks failing. This change will temporarily reduce the number of folders checked, to enable this PR to be merged, which enables weekly regression tests. Then, we will address the issues with the notebooks and remove these exemptions.
2021-11-12 09:11:09 -08:00
Andrew FerlitschandGitHub 5201dc9828 Update README.md 2021-11-11 16:29:56 -08:00
Andrew FerlitschandGitHub e0861b00e4 Create README.md 2021-11-11 16:25:27 -08:00
Andrew FerlitschandGitHub 2d4cff3c2e Update README.md 2021-11-11 16:21:44 -08:00
Andrew FerlitschandGitHub 428f861b9b feat: stage 3 notebooks (#147)
* feat: stage 3 notebooks

* feat: stage 3 notebooks
2021-11-11 16:21:03 -08:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
31487745d6 build(deps): bump tensorflow (#138)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.4.1 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.4.1...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 18:02:45 -06:00
Karl WeinmeisterandGitHub d1ccf37e68 Notebook fixes to work in Workbench (#141) 2021-11-10 18:01:12 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
91440922b5 build(deps): bump tensorflow (#136)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 15:23:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
e15cc7e3cd build(deps): bump tensorflow (#137)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.1 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.1...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 15:22:56 -06:00
c6e767edaf Train and deploy end-to-end sklearn text classifier (#122)
* added sklearn-example

* nb formatting

* added readme

* added endpoint to notebook

* nb formatting

* added endpoint prediction example

* nb formatting

* fixed request

* minor woring fixes in docstrings

* added codeowner and included PR feedback

Co-authored-by: Maximilian Engelhardt <maximilian.engelhardt@ing.com>
2021-11-10 15:20:57 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
176c79033d build(deps): bump tensorflow (#135)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2021-11-10 15:02:46 -06:00
Andrew FerlitschandGitHub f6685cf8aa fix: friday updates (#132)
* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* feat: friday updates

* feat: friday updates
2021-11-08 09:29:31 -08:00
Andrew FerlitschandGitHub c9cc1d1675 fix: removed cleanup line 2021-11-08 09:12:35 -08:00
Karl WeinmeisterandGitHub d3ecbe578c Updated notebook template with bucket changes (#130)
* Updated notebook template with bucket changes

* Added step to delete bucket if flag set
2021-11-08 11:10:07 -06:00
Ivan CheungandGitHub c04bab95d7 Renamed migration notebooks (#125)
* Renamed migration notebooks

* Removed 'unified' from filename

* Fixed names
2021-11-08 11:54:48 -05:00
Andrew FerlitschandGitHub 651ce325c2 fix: breaking change (#131)
* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes
2021-11-07 15:13:54 -08:00
ffbf8db52c feat: Added notebook demonstrating how to evaluate a forecasting training job. (#55)
* Add notebook for Automl Forecasting

Adding a new notebook tutorial for evaluating a forecasting training job

* Format and lint automl forecasting notebook

* Add forecasting notebook

This tutorial focuses on evaluating a forecasting training job.

* Delete automl-forecasting-evaluating-a-model.ipynb

* Format and lint automl forecasting notebook

* Use column_specs instead of column_transformations

* Fixed formatting

* Fixed formatting

* Added owner for Forecasting notebooks

Co-authored-by: Mansi Achuthan <mansiachuthan@google.com>
Co-authored-by: Hardik Vala <hardikv@google.com>
Co-authored-by: thehardikv <78449654+thehardikv@users.noreply.github.com>
2021-11-05 14:46:33 -07:00
Andrew FerlitschandGitHub 57373b6fe4 fix: remove debug code 2021-11-05 10:27:16 -07:00
Andrew FerlitschandGitHub 2b66079a68 fix: breaking changes (#128)
* fix: breaking changes

* fix: breaking changes

* fix: breaking changes

* fix: breaking changes
2021-11-04 22:49:51 -07:00
Andrew FerlitschandGitHub ec759a18c9 fix: updates for 0.1.9 (#127)
* fix: breaking changes

* fix: breaking changes
2021-11-04 21:37:05 -07:00
Karl WeinmeisterandGitHub 211aa8a822 Added links to locally test for formatting & linking (#124) 2021-11-04 19:07:22 -05:00
Ivan CheungandGitHub ae7529241f Renamed brand names (#123)
* Renamed brand names

* Fixed duplicate 'Vertex AI'

* Fixed user managed notebooks reference

* Renamed to Vertex AI AutoML Image Object Detection
2021-11-03 17:48:17 -04:00
Ivan CheungandGitHub d5d8a3de5f Update CODEOWNERS 2021-11-02 16:11:23 -04:00
tubaandGitHub 7dd784bc2c update for gsutil (#60)
Adding "/*" to the path to delete the content, otherwise the bucket is removed.
2021-11-01 09:36:32 -07:00
Karl WeinmeisterandGitHub 09795308ab Added code quality checks to contributing.md (#121) 2021-11-01 09:26:40 -07:00
b4d901d725 Rapid prototyping (with fixes) (#107)
* Notebook that walks a user through an AutoML vs BQML model competition.

* adding myself to CODEOWNERS

* Fixes notebook formatting after lint fail  and adds clean-up cell at the end of the notebook

* adding W291 to list of exception so SQL queries can pass

* saving pipeline json file on the same folder as the notebook

* After linting / formatting

* Delete run_linter.sh

* putting run_linter.sh back

* reverting run_linter.sh to repo's

* Update rapid_prototyping_bqml_automl.ipynb

- Added Colab and Github buttons at the top;
- Allow for BQ region settings;
- Tested with BQ region = EU / Vertex Region = europe-west4;
- Must set delete flag to True in order to clean up;

* Markdown format + bucket-name not hard-coded

Co-authored-by: Rafa Carvalho <rafacarv@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2021-11-01 09:23:01 -07:00
Andrew FerlitschandGitHub a9ad0f8e92 Update README.md 2021-10-29 16:22:39 -07:00
Andrew FerlitschandGitHub 6827d0b754 Update README.md 2021-10-29 16:21:42 -07:00
Andrew FerlitschandGitHub fea67b2ed0 feat: friday updates (#119)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2

* feat: start on stage2

* feat: start on stage2

* feat: get started

* feat: get started

* fix: updates

* fix: updates

* fix: updates

* fix: updates

* friday updates

* friday updates

* friday updates

* friday updates
2021-10-29 16:20:09 -07:00
Andrew FerlitschandGitHub 19f8fa549c fix job ID typo 2021-10-26 10:25:44 -07:00
Andrew FerlitschandGitHub f982fedebf fix typo in job ID 2021-10-26 09:40:56 -07:00
Andrew FerlitschandGitHub e6e49f68d3 fix job id typo 2021-10-26 09:31:00 -07:00
Andrew FerlitschandGitHub 067997b2a1 fix job ID typo in 2nd HPT job 2021-10-25 17:36:50 -07:00
Andrew FerlitschandGitHub 3e914bbf45 fix job ID typo in 2nd HPT job 2021-10-25 17:35:29 -07:00
Andrew FerlitschandGitHub 5d54485642 fix typo in job ID for second HPT job 2021-10-25 17:33:48 -07:00
Morgan DuandGitHub 30b718f8c1 Feat: use gcsfuse (#109)
* fix: add replica_count

* change to gcsfuse
2021-10-25 13:31:18 -07:00
halio-gandGitHub d585692254 Changed the vizier's SDK version from v1beta1 to v1. (#103) 2021-10-25 12:21:41 -07:00
Ivan CheungandGitHub 07f2385ea9 Create CODEOWNERS 2021-10-25 14:30:15 -04:00
Ivan CheungandGitHub 9ac6cf64d7 Update CODEOWNERS 2021-10-25 14:28:10 -04:00
Ivan CheungandGitHub b12a08642b Delete CODEOWNERS 2021-10-25 14:26:39 -04:00
Ivan CheungandGitHub 5fa713d851 Update CODEOWNERS 2021-10-25 14:26:25 -04:00
Aaron DietzandGitHub d2a8124389 Updates to fraud detection (#113) 2021-10-22 19:55:28 -04:00
Karl WeinmeisterandGitHub e5d47a3a00 Iss89 (#117)
* Fixed extra commas in renovate.json

* Change README link from tutorials to community content
2021-10-22 19:55:02 -04:00
d79efdabac Updates to recommender system (#115)
* Updates to recommender system

* Ran linter

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-22 19:53:28 -04:00
489c472b1a Updates to ads targeting notebook (#110)
* Updates to ads targeting notebook

* Ran linter

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-22 19:53:19 -04:00
77b96bf021 Updates to telecom subscriber churn (#111)
* Updates to telecom subscriber churn

* Ran linter

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-22 19:53:13 -04:00
4c9e03107b Updates to gaming churn prediction (#112)
* Updates to gaming churn prediction

* Ran linter

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-22 19:53:06 -04:00
263a03f89c Updates to demand forecasting (#114)
* Updates to demand forecasting

* Ran linter

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-22 19:52:24 -04:00
caea1ee594 Recommender systems (#98)
* added first usecase

* Changes made according to notebok template

* recommender systems added

* test commit

* telco churn and gaming churn notebooks completed

* linter ok

* moved files to official folder

* fraud detection added

* ran linter

* recommender added

* changed to comm folder

* deleted notebook_template

* changed some files

* made changes

* changes made

* added new branch for recommender systems

* feedback changes done

* ran lint

* Re=added notebook

* Renamed Recommender Systems to recommender_systems

* Added CODEOWNERS

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-21 21:08:46 -04:00
47a8fa65ff Demandforecasting usecase notebook done from Sudarshan (#93)
* added first usecase

* Changes made according to notebok template

* recommender systems added

* test commit

* telco churn and gaming churn notebooks completed

* linter ok

* moved files to official folder

* fraud detection added

* ran linter

* recommender added

* changed to comm folder

* deleted notebook_template

* changed some files

* made changes

* changes made

* notebookadded

* ran lint

* changed notebook

* removed springml folder

* changed hardcoded variables

* ran lint

* made changes

* ran lint

* Re=added notebook

* Renamed folder

* Added CODEOWNERS file

* Fixed CODEOWNERS

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-21 20:18:40 -04:00
7190e8d671 Fraud detection (#96)
* added first usecase

* Changes made according to notebok template

* recommender systems added

* test commit

* telco churn and gaming churn notebooks completed

* linter ok

* moved files to official folder

* fraud detection added

* ran linter

* recommender added

* changed to comm folder

* deleted notebook_template

* changed some files

* made changes

* changes made

* added new branch

* made changes

* made changes

* made changes

* made changes

* chnages made

* changes done

* ran lint

* changed bucket name

* ran lint

* mde changes

* Re=added notebook

* Re=added notebook

* ran lint

* Renamed file

* Ran linter

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-21 20:16:43 -04:00
Karl WeinmeisterandGitHub ba99f2a90a Removed duplicate Contributing comment in README (#106) 2021-10-21 20:16:11 -04:00
0db601f602 Gaming churn prediction (#97)
* added first usecase

* Changes made according to notebok template

* recommender systems added

* test commit

* telco churn and gaming churn notebooks completed

* linter ok

* moved files to official folder

* fraud detection added

* ran linter

* recommender added

* changed to comm folder

* deleted notebook_template

* changed some files

* made changes

* changes made

* added new branch for gaming churn

* changes made

* feedback changes done

* ran lint

* Re=added notebook

* Cleanup

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-21 20:15:36 -04:00
97c3b89c93 Subscriber churn (#99)
* added first usecase

* Changes made according to notebok template

* recommender systems added

* test commit

* telco churn and gaming churn notebooks completed

* linter ok

* moved files to official folder

* fraud detection added

* ran linter

* recommender added

* changed to comm folder

* deleted notebook_template

* changed some files

* made changes

* changes made

* added new branch for subscriber_churn

* made changes according to feedback

* made changes'

* made changes

* made changes

* changes made

* changes made

* ran lint

* Re=added notebook

* ran lint

* Cleanup and lint

* Folder move

* Moved folder

* Renamed folder

* Renamed folder

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-21 20:15:07 -04:00
89fee52de8 Adstargetting use case (#101)
* added first usecase

* Changes made according to notebok template

* recommender systems added

* test commit

* telco churn and gaming churn notebooks completed

* linter ok

* moved files to official folder

* fraud detection added

* ran linter

* recommender added

* changed to comm folder

* deleted notebook_template

* changed some files

* made changes

* changes made

* changes

* added notebook

* ran lint

* small changes

* feedback changes done

* ran lint

* Re=added notebook

* Moved folder

* Moved folder

Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2021-10-21 20:14:54 -04:00
Diem VuandGitHub 16bc01826f Update feature store sample notebook to v1 API. (#108)
* Update feature store notebook to v1 API

* Lint
2021-10-21 16:14:56 -07:00
Andrew FerlitschandGitHub c5e475a7cd Update README.md 2021-10-15 17:26:05 -07:00
Andrew FerlitschandGitHub 30f65def55 fix: updates stage 2 (#105)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2

* feat: start on stage2

* feat: start on stage2

* feat: get started

* feat: get started

* fix: updates

* fix: updates

* fix: updates

* fix: updates
2021-10-15 17:24:34 -07:00
Andrew FerlitschandGitHub 8849691f84 feat: MLOps updates (#104)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2

* feat: start on stage2

* feat: start on stage2

* feat: get started

* feat: get started

* fix: updates

* fix: updates
2021-10-15 17:18:30 -07:00
Andrew FerlitschandGitHub 3352e76a59 Update README.md 2021-10-12 14:32:42 -07:00
Andrew FerlitschandGitHub 255f0b1ca8 Update README.md 2021-10-12 14:32:06 -07:00
Andrew FerlitschandGitHub addc7c7dfc Ml ops (#100)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2

* feat: start on stage2

* feat: start on stage2

* feat: get started

* feat: get started
2021-10-12 14:26:42 -07:00
e062b15221 Rapid prototyping (#80)
* Notebook that walks a user through an AutoML vs BQML model competition.

* adding myself to CODEOWNERS

* Fixes notebook formatting after lint fail  and adds clean-up cell at the end of the notebook

* adding W291 to list of exception so SQL queries can pass

* saving pipeline json file on the same folder as the notebook

* After linting / formatting

* Delete run_linter.sh

* putting run_linter.sh back

* reverting run_linter.sh to repo's

Co-authored-by: Rafa Carvalho <rafacarv@google.com>
2021-10-11 11:42:02 -07:00
Andrew FerlitschandGitHub c551226b99 fix: typo in apache beam script 2021-10-08 12:21:23 -07:00
Andrew FerlitschandGitHub 5fedaa6b4a Update README.md 2021-10-08 10:53:11 -07:00
Andrew FerlitschandGitHub 44d24797ed Update README.md 2021-10-08 10:52:10 -07:00
Andrew FerlitschandGitHub 5277fef9fa Update README.md 2021-10-08 10:50:06 -07:00
Andrew FerlitschandGitHub ccadb5eea5 feat: friday updates (#94)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2

* feat: start on stage2

* feat: start on stage2
2021-10-08 10:48:40 -07:00
Ivan CheungandGitHub 3f72b5249e Update run_linter.sh 2021-10-07 17:35:12 -04:00
Ivan CheungandGitHub cc89c86bcb Update run_linter.sh 2021-10-07 13:07:59 -04:00
nicainandGitHub 421a96d99a fix: add authentication (#88)
Add authentication similar to https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/notebooks/official/custom/custom-tabular-bq-managed-dataset.ipynb
2021-10-05 22:48:10 +00:00
Andrew FerlitschandGitHub 97ced04adb Update README.md 2021-10-04 12:02:31 -07:00
MarcandGitHub 5d2ec2dd11 title change: s/Vertex/Vertex AI/ (#79)
as per PM request
2021-10-04 15:01:19 -04:00
MarcandGitHub 76f0353322 update title to s/Vertex/Vertex AI/ (#78)
per PM
2021-10-04 15:01:09 -04:00
Andrew FerlitschandGitHub f0920f5c3c Update README.md 2021-10-04 12:00:59 -07:00
Andrew FerlitschandGitHub b7a75605c0 feat: MLops stage 2 (#86)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1

* feat: start stage 2
2021-10-04 11:59:12 -07:00
Andrew FerlitschandGitHub bd7223f3cc Update README.md 2021-10-04 11:29:25 -07:00
Andrew FerlitschandGitHub f3dddaac83 fix: links 2021-10-04 11:01:40 -07:00
Andrew FerlitschandGitHub 38858ff0bb fix: links 2021-10-04 11:00:25 -07:00
Andrew FerlitschandGitHub ef9ea11506 fix: links 2021-10-04 10:42:32 -07:00
Andrew FerlitschandGitHub 304fabd249 feat: MLops (#85)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook

* feat: finish stage1

* feat: finish stage1
2021-10-04 10:40:31 -07:00
Andrew FerlitschandGitHub 308d467e47 fix: links 2021-10-04 10:38:53 -07:00
Andrew FerlitschandGitHub 7142744f9d fix: links 2021-10-04 10:37:21 -07:00
Andrew FerlitschandGitHub 9113e53cb3 fix: links 2021-10-04 10:26:42 -07:00
Andrew FerlitschandGitHub 7023138d51 fix: links 2021-10-04 10:17:40 -07:00
Andrew FerlitschandGitHub 01ee1c9d68 fix: links 2021-10-04 10:09:58 -07:00
Andrew FerlitschandGitHub d63cd2c0dd fix links 2021-10-04 10:08:26 -07:00
Andrew FerlitschandGitHub da8d34ef34 Update README.md 2021-09-27 13:26:17 -07:00
Andrew FerlitschandGitHub 3e80bc5479 Ml ops (#77)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook

* feat: add dataflow notebook

* feat: add dataflow notebook
2021-09-27 13:25:22 -07:00
Andrew FerlitschandGitHub b4d533c38d feat: ML Ops (#74)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook

* feat: refine notebook

* feat: refine notebook
2021-09-23 13:23:15 -07:00
Andrew FerlitschandGitHub 4c3c455ea1 Update README.md 2021-09-22 19:13:35 -07:00
Andrew FerlitschandGitHub 30d56c0c31 Update README.md 2021-09-22 19:12:15 -07:00
Andrew FerlitschandGitHub ad359977c7 Update README.md 2021-09-22 19:10:16 -07:00
Andrew FerlitschandGitHub 83a7a4a191 Update README.md 2021-09-22 19:08:58 -07:00
Andrew FerlitschandGitHub 32249afd65 feat: ML ops (#73)
* feat: new notebook

* feat: new notebook

* feat: get started notebook

* feat: get started notebook
2021-09-22 19:07:36 -07:00
Andrew FerlitschandGitHub 5387185fa2 Add files via upload 2021-09-22 17:21:20 -07:00
Andrew FerlitschandGitHub dbe978e6ab Create README.md 2021-09-22 17:18:28 -07:00
Andrew FerlitschandGitHub 04ad075381 Update README.md 2021-09-22 17:16:05 -07:00
Andrew FerlitschandGitHub eb532b0cc7 Create README.md 2021-09-22 17:13:10 -07:00
Andrew FerlitschandGitHub ee500eb782 Update CODEOWNERS 2021-09-22 12:54:20 -07:00
Andrew FerlitschandGitHub 29b4d45d67 feat: ML Ops (#72)
* feat: new notebook

* feat: new notebook
2021-09-22 12:53:30 -07:00
MarcandGitHub 6862cb8d96 fix links (#70) 2021-09-20 09:04:11 +01:00
MarcandGitHub 5fc081731c updated MM notebook w/ feature attributions (#69)
* updated MM notebook w/ feature attributions

* link fixes

* add this notebook to community CODEOWNERS

* fix open notebook links

* fixed github links

* colab fixes
2021-09-19 21:08:45 +01:00
Andrew FerlitschandGitHub 04e49a0392 feat: XAI get metadata (#67)
* feat: get_metadata

* feat: get_metadata
2021-09-17 23:53:54 -07:00
Andrew FerlitschandGitHub 02c2c97f2d feat: sdk auto-assembled unofficial cuj (#65)
* feat: auto-assembled notebooks

* feat: auto-assembled notebooks

* fix: lint

* fix: lint
2021-09-16 13:03:49 -07:00
Andrew FerlitschandGitHub 2254ce6190 Create CODEOWNERS 2021-09-16 12:30:42 -07:00
Ivan CheungandGitHub 434dbf20b8 Create delete_this_placeholder.txt 2021-09-15 11:10:34 -04:00
Andrew FerlitschandGitHub a9104b4c38 feat: SDK migration final (#62)
* fix: testing

* fix: testing

* fix: testing

* fix: testing
2021-09-14 08:47:05 -07:00
Andrew FerlitschandGitHub 4db3560501 feat: sdk migration 4 (#53)
* fix: testing

* fix: testing

* TW: review

* TW: review

* TW: review

* TW: review
2021-09-10 20:32:30 -07:00
Cheng LiandGitHub af9883d6ee Fixed project_id in bigquery client (#57)
Remove timestamp in fs id
Reduced fix_node_count to 1
Removed deprecated display_name
2021-09-09 09:53:05 -07:00
356 changed files with 223554 additions and 30031 deletions
-194
View File
@@ -1,194 +0,0 @@
# Copyright 2020 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
# We want to use LTS ubuntu from our mirror because dockerhub has a
# rate limit.
# FROM mirror.gcr.io/library/ubuntu:18.04
# However, now the above image is not working, we're using our own cache
FROM gcr.io/cloud-devrel-kokoro-resources/ubuntu:20.04
ENV DEBIAN_FRONTEND noninteractive
# Ensure local Python is preferred over distribution Python.
ENV PATH /usr/local/bin:$PATH
# http://bugs.python.org/issue19846
# At the moment, setting "LANG=C" on a Linux system fundamentally breaks
# Python 3.
ENV LANG C.UTF-8
# Install dependencies.
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
apt-transport-https \
build-essential \
ca-certificates \
curl \
dirmngr \
git \
gcc \
gpg-agent \
graphviz \
libbz2-dev \
libdb5.3-dev \
libexpat1-dev \
libffi-dev \
liblzma-dev \
libmagickwand-dev \
libmemcached-dev \
libpython3-dev \
libreadline-dev \
libsnappy-dev \
libssl-dev \
libsqlite3-dev \
portaudio19-dev \
pkg-config \
redis-server \
software-properties-common \
ssh \
sudo \
systemd \
tcl \
tcl-dev \
tk \
tk-dev \
uuid-dev \
wget \
zlib1g-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install docker
RUN curl -fsSL https://download.docker.com/linux/ubuntu/gpg | sudo apt-key add -
RUN add-apt-repository \
"deb [arch=amd64] https://download.docker.com/linux/ubuntu \
$(lsb_release -cs) \
stable"
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
docker-ce \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Bazel for compiling Tink in Cloud SQL Client Side Encryption Samples
# TODO: Delete this section once google/tink#483 is resolved
RUN apt install -y curl gpgconf gpg \
&& curl -fsSL https://bazel.build/bazel-release.pub.gpg | gpg --dearmor > bazel.gpg \
&& mv bazel.gpg /etc/apt/trusted.gpg.d/ \
&& echo "deb [arch=amd64] https://storage.googleapis.com/bazel-apt stable jdk1.8" | sudo tee /etc/apt/sources.list.d/bazel.list \
&& apt update && apt install -y bazel \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Microsoft ODBC 17 Driver and unixodbc for testing SQL Server samples
RUN curl https://packages.microsoft.com/keys/microsoft.asc | apt-key add - \
&& curl https://packages.microsoft.com/config/ubuntu/20.04/prod.list > /etc/apt/sources.list.d/mssql-release.list \
&& apt-get update \
&& ACCEPT_EULA=Y apt-get install -y --no-install-recommends \
msodbcsql17 \
unixodbc-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
COPY fetch_gpg_keys.sh /tmp
# Install the desired versions of Python.
RUN set -ex \
&& export GNUPGHOME="$(mktemp -d)" \
&& echo "disable-ipv6" >> "${GNUPGHOME}/dirmngr.conf" \
&& /tmp/fetch_gpg_keys.sh \
&& for PYTHON_VERSION in 2.7.18 3.6.13 3.7.10 3.8.8 3.9.2; do \
wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz" \
&& wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz.asc "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz.asc" \
&& gpg --batch --verify python-${PYTHON_VERSION}.tar.xz.asc python-${PYTHON_VERSION}.tar.xz \
&& rm -r python-${PYTHON_VERSION}.tar.xz.asc \
&& mkdir -p /usr/src/python-${PYTHON_VERSION} \
&& tar -xJC /usr/src/python-${PYTHON_VERSION} --strip-components=1 -f python-${PYTHON_VERSION}.tar.xz \
&& rm python-${PYTHON_VERSION}.tar.xz \
&& cd /usr/src/python-${PYTHON_VERSION} \
&& ./configure \
--enable-shared \
# This works only on Python 2.7 and throws a warning on every other
# version, but seems otherwise harmless.
--enable-unicode=ucs4 \
--with-system-ffi \
--without-ensurepip \
&& make -j$(nproc) \
&& make install \
&& ldconfig \
; done \
&& rm -rf "${GNUPGHOME}" \
&& rm -rf /usr/src/python* \
&& rm -rf ~/.cache/
# Install pip on Python 3.6 only.
# If the environment variable is called "PIP_VERSION", pip explodes with
# "ValueError: invalid truth value '<VERSION>'"
ENV PYTHON_PIP_VERSION 20.2.4
RUN wget --no-check-certificate -O /tmp/get-pip.py 'https://bootstrap.pypa.io/get-pip.py' \
&& python3.6 /tmp/get-pip.py "pip==$PYTHON_PIP_VERSION" \
# we use "--force-reinstall" for the case where the version of pip we're trying to install is the same as the version bundled with Python
# ("Requirement already up-to-date: pip==8.1.2 in /usr/local/lib/python3.6/site-packages")
# https://github.com/docker-library/python/pull/143#issuecomment-241032683
&& pip3 install --no-cache-dir --upgrade --force-reinstall "pip==$PYTHON_PIP_VERSION" \
# then we use "pip list" to ensure we don't have more than one pip version installed
# https://github.com/docker-library/python/pull/100
&& [ "$(pip list |tac|tac| awk -F '[ ()]+' '$1 == "pip" { print $2; exit }')" = "$PYTHON_PIP_VERSION" ]
# Ensure Pip for python3
RUN python3 /tmp/get-pip.py
RUN rm /tmp/get-pip.py
# Install "virtualenv", since the vast majority of users of this image
# will want it.
RUN pip install --no-cache-dir virtualenv
# Setup Cloud SDK
ENV CLOUD_SDK_VERSION 339.0.0
# Use system python for cloud sdk.
ENV CLOUDSDK_PYTHON python3.6
RUN wget https://dl.google.com/dl/cloudsdk/channels/rapid/downloads/google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN tar xzf google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN /google-cloud-sdk/install.sh
ENV PATH /google-cloud-sdk/bin:$PATH
# Enable redis-server on boot.
RUN sudo systemctl enable redis-server.service
# Create a user and allow sudo
# kbuilder uid on the default Kokoro image
ARG UID=1000
ARG USERNAME=kbuilder
# Add a new user to the container image.
# This is needed for ssh and sudo access.
# Add a new user with the caller's uid and the username.
RUN useradd -d /h -u ${UID} ${USERNAME}
# Allow nopasswd sudo
RUN echo "${USERNAME} ALL=(ALL) NOPASSWD:ALL" >> /etc/sudoers
CMD ["python3.6"]
-312
View File
@@ -1,312 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import dataclasses
import datetime
import functools
import pathlib
import os
import subprocess
from pathlib import Path
from typing import List, Optional
import concurrent
from tabulate import tabulate
import ExecuteNotebook
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
def format_timedelta(delta: datetime.timedelta) -> str:
"""Formats a timedelta duration to [N days] %H:%M:%S format"""
seconds = int(delta.total_seconds())
secs_in_a_day = 86400
secs_in_a_hour = 3600
secs_in_a_min = 60
days, seconds = divmod(seconds, secs_in_a_day)
hours, seconds = divmod(seconds, secs_in_a_hour)
minutes, seconds = divmod(seconds, secs_in_a_min)
time_fmt = f"{hours:02d}:{minutes:02d}:{seconds:02d}"
if days > 0:
suffix = "s" if days > 1 else ""
return f"{days} day{suffix} {time_fmt}"
return time_fmt
@dataclasses.dataclass
class NotebookExecutionResult:
notebook: str
duration: datetime.timedelta
is_pass: bool
error_message: Optional[str]
def execute_notebook(
artifacts_path: str,
variable_project_id: str,
variable_region: str,
should_log_output: bool,
should_use_new_kernel: bool,
notebook: str,
) -> NotebookExecutionResult:
print(f"Running notebook: {notebook}")
result = NotebookExecutionResult(
notebook=notebook,
duration=datetime.timedelta(seconds=0),
is_pass=False,
error_message=None,
)
# TODO: Handle cases where multiple notebooks have the same name
time_start = datetime.datetime.now()
try:
ExecuteNotebook.execute_notebook(
notebook_file_path=notebook,
output_file_folder=artifacts_path,
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
},
should_log_output=should_log_output,
should_use_new_kernel=should_use_new_kernel,
)
result.duration = datetime.datetime.now() - time_start
result.is_pass = True
print(f"{notebook} PASSED in {format_timedelta(result.duration)}.")
except Exception as error:
result.duration = datetime.datetime.now() - time_start
result.is_pass = False
result.error_message = str(error)
print(
f"{notebook} FAILED in {format_timedelta(result.duration)}: {result.error_message}"
)
return result
def run_changed_notebooks(
test_paths_file: str,
base_branch: Optional[str],
output_folder: str,
variable_project_id: str,
variable_region: str,
should_parallelize: bool,
should_use_separate_kernels: bool,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the output_folder.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
output_folder (str):
Required. The folder to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
should_use_separate_kernels (bool):
Note: Dependencies don't install correctly when this is set to True
See https://github.com/nteract/papermill/issues/625
Required. Should run each notebook in a separate and independent virtual environment.
"""
test_paths = []
with open(test_paths_file) as file:
lines = [line.strip() for line in file.readlines()]
lines = [line for line in lines if len(line) > 0]
test_paths = [line for line in lines]
if len(test_paths) == 0:
raise RuntimeError("No test folders found.")
print(f"Checking folders: {test_paths}")
# Find notebooks
notebooks = []
if base_branch:
print(f"Looking for notebooks that changed from branch: {base_branch}")
notebooks = subprocess.check_output(
["git", "diff", "--name-only", f"origin/{base_branch}..."] + test_paths
)
else:
print(f"Looking for all notebooks.")
notebooks = subprocess.check_output(["git", "ls-files"] + test_paths)
notebooks = notebooks.decode("utf-8").split("\n")
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if Path(notebook).exists()]
# Create paths
artifacts_path = Path(output_folder)
artifacts_path.mkdir(parents=True, exist_ok=True)
artifacts_path.joinpath("success").mkdir(parents=True, exist_ok=True)
artifacts_path.joinpath("failure").mkdir(parents=True, exist_ok=True)
notebook_execution_results: List[NotebookExecutionResult] = []
if len(notebooks) > 0:
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
if should_parallelize and len(notebooks) > 1:
print(
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
)
with concurrent.futures.ThreadPoolExecutor(max_workers=None) as executor:
notebook_execution_results = list(
executor.map(
functools.partial(
execute_notebook,
artifacts_path,
variable_project_id,
variable_region,
False,
should_use_separate_kernels,
),
notebooks,
)
)
else:
notebook_execution_results = [
execute_notebook(
artifacts_path=artifacts_path,
variable_project_id=variable_project_id,
variable_region=variable_region,
notebook=notebook,
should_log_output=True,
should_use_new_kernel=should_use_separate_kernels,
)
for notebook in notebooks
]
else:
print("No notebooks modified in this pull request.")
print("\n=== RESULTS ===\n")
notebooks_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
os.path.basename(os.path.normpath(result.notebook)),
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.error_message or "--",
]
for result in notebooks_sorted
],
headers=["file", "status", "duration", "error"],
)
)
print("\n=== END RESULTS===\n")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--output_folder",
type=pathlib.Path,
help="The path to the folder to store executed notebooks.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
# Note: Dependencies don't install correctly when this is set to True
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=False,
help="Should run notebooks in parallel.",
)
# Note: This isn't guaranteed to work correctly due to existing Papermill issue
# See https://github.com/nteract/papermill/issues/625
parser.add_argument(
"--should_use_separate_kernels",
type=str2bool,
nargs="?",
const=True,
default=False,
help="(Experimental) Should run each notebook in a separate and independent virtual environment.",
)
args = parser.parse_args()
run_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
output_folder=args.output_folder,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
should_parallelize=args.should_parallelize,
should_use_separate_kernels=args.should_use_separate_kernels,
)
-175
View File
@@ -1,175 +0,0 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import json
import sys
import nbformat
import os
import errno
from NotebookProcessors import RemoveNoExecuteCells, UpdateVariablesPreprocessor
from typing import Dict, Tuple
import papermill as pm
import shutil
import virtualenv
import uuid
from jupyter_client.kernelspecapp import KernelSpecManager
# This script is used to execute a notebook and write out the output notebook.
# The replaces calling the nbconvert via command-line, which doesn't write the output notebook correctly when there are errors during execution.
STAGING_FOLDER = "staging"
ENVIRONMENTS_PATH = "environments"
KERNELS_SPECS_PATH = "kernel_specs"
def create_and_install_kernel() -> Tuple[str, str]:
# Create environment
kernel_name = str(uuid.uuid4())
env_name = f"{ENVIRONMENTS_PATH}/{kernel_name}"
# venv.create(env_name, system_site_packages=True, with_pip=True)
virtualenv.cli_run([env_name, "--system-site-packages"])
# Create kernel spec
kernel_spec = {
"argv": [
f"{env_name}/bin/python",
"-m",
"ipykernel_launcher",
"-f",
"{connection_file}",
],
"display_name": "Python 3",
"language": "python",
}
kernel_spec_folder = os.path.join(KERNELS_SPECS_PATH, kernel_name)
kernel_spec_file = os.path.join(kernel_spec_folder, "kernel.json")
# Create kernel spec folder
if not os.path.exists(os.path.dirname(kernel_spec_file)):
try:
os.makedirs(os.path.dirname(kernel_spec_file))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
with open(kernel_spec_file, mode="w", encoding="utf-8") as f:
json.dump(kernel_spec, f)
# Install kernel
kernel_spec_manager = KernelSpecManager()
kernel_spec_manager.install_kernel_spec(
source_dir=kernel_spec_folder, kernel_name=kernel_name
)
return kernel_name, env_name
def execute_notebook(
notebook_file_path: str,
output_file_folder: str,
replacement_map: Dict[str, str],
should_log_output: bool,
should_use_new_kernel: bool,
):
# Create staging directory if it doesn't exist
staging_file_path = f"{STAGING_FOLDER}/{notebook_file_path}"
if not os.path.exists(os.path.dirname(staging_file_path)):
try:
os.makedirs(os.path.dirname(staging_file_path))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
file_name = os.path.basename(os.path.normpath(notebook_file_path))
# Create environments folder
if not os.path.exists(ENVIRONMENTS_PATH):
try:
os.makedirs(ENVIRONMENTS_PATH)
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
# Create and install kernel
kernel_name = next(
iter(KernelSpecManager().find_kernel_specs().keys()), None
) # Find first existing kernel and use as default
env_name = None
if should_use_new_kernel:
kernel_name, env_name = create_and_install_kernel()
# Read notebook
with open(notebook_file_path) as f:
nb = nbformat.read(f, as_version=4)
has_error = False
# Execute notebook
try:
# Create preprocessors
remove_no_execute_cells_preprocessor = RemoveNoExecuteCells()
update_variables_preprocessor = UpdateVariablesPreprocessor(
replacement_map=replacement_map
)
# Use no-execute preprocessor
(
nb,
resources,
) = remove_no_execute_cells_preprocessor.preprocess(nb)
(nb, resources) = update_variables_preprocessor.preprocess(nb, resources)
# print(f"Staging modified notebook to: {staging_file_path}")
with open(staging_file_path, mode="w", encoding="utf-8") as f:
nbformat.write(nb, f)
# Execute notebook
pm.execute_notebook(
input_path=staging_file_path,
output_path=staging_file_path,
kernel_name=kernel_name,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
)
except Exception:
# print(f"Error executing the notebook: {notebook_file_path}.\n\n")
has_error = True
raise
finally:
# Clear env
if env_name is not None:
shutil.rmtree(path=env_name)
# Copy execute notebook
output_file_path = os.path.join(
output_file_folder, "failure" if has_error else "success", file_name
)
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_path)):
try:
os.makedirs(os.path.dirname(output_file_path))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
# print(f"Writing output to: {output_file_path}")
shutil.move(staging_file_path, output_file_path)
+17 -10
View File
@@ -1,11 +1,14 @@
from typing import List
from ratemate import RateLimit
from resource_cleanup_manager import (
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
EndpointResourceCleanupManager,
ResourceCleanupManager,
)
rate_limit = RateLimit(max_count=25, per=60, greedy=False)
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
for manager in managers:
@@ -15,14 +18,18 @@ def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: boo
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
try:
if not manager.is_deletable(resource):
continue
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
manager.delete(resource)
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
rate_limit.wait() # wait before deleting
manager.delete(resource)
except Exception as exception:
print(exception)
print("")
@@ -36,7 +43,7 @@ if is_dry_run:
managers = [
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
ModelResourceCleanupManager(), # ModelResourceCleanupManager must follow EndpointResourceCleanupManager due to deployed models blocking model deletion.
]
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
@@ -1,8 +1,9 @@
import abc
from typing import Any, Type
from google.cloud import aiplatform
from typing import Any
from proto.datetime_helpers import DatetimeWithNanoseconds
from google.cloud.aiplatform import base
from proto.datetime_helpers import DatetimeWithNanoseconds
# If a resource was updated within this number of seconds, do not delete.
RESOURCE_UPDATE_BUFFER_IN_SECONDS = 60 * 60 * 8
@@ -40,7 +41,7 @@ class ResourceCleanupManager(abc.ABC):
# Check that it wasn't created too recently, to prevent race conditions
if time_difference <= RESOURCE_UPDATE_BUFFER_IN_SECONDS:
print(
f"Skipping '{resource}' due update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
f"Skipping '{resource}' due to update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
)
return False
@@ -50,7 +51,7 @@ class ResourceCleanupManager(abc.ABC):
class VertexAIResourceCleanupManager(ResourceCleanupManager):
@property
@abc.abstractmethod
def vertex_ai_resource(self) -> base.VertexAiResourceNounWithFutureManager:
def vertex_ai_resource(self) -> Type[base.VertexAiResourceNounWithFutureManager]:
pass
@property
@@ -60,7 +61,9 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
def list(self) -> Any:
return self.vertex_ai_resource.list()
def resource_name(self, resource: Any) -> str:
def resource_name(
self, resource: Type[base.VertexAiResourceNounWithFutureManager]
) -> str:
return resource.display_name
def delete(self, resource):
@@ -74,12 +77,33 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
class DatasetResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.datasets._Dataset
dataset_types = [
aiplatform.ImageDataset,
aiplatform.TabularDataset,
aiplatform.TextDataset,
aiplatform.TimeSeriesDataset,
aiplatform.VideoDataset,
]
def list(self) -> Any:
return [
dataset
for dataset_type in self.dataset_types
for dataset in dataset_type.list()
]
class EndpointResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.Endpoint
def delete(self, resource):
# TODO: Remove this once https://github.com/googleapis/python-aiplatform/issues/1441 is fixed
resource._sync_gca_resource()
for deployed_model_id in [
models.id for models in resource._gca_resource.deployed_models
]:
resource._undeploy(deployed_model_id=deployed_model_id)
resource.delete(force=True)
+116
View File
@@ -0,0 +1,116 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
import argparse
import pathlib
import execute_changed_notebooks_helper
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--timeout",
type=int,
help="Timeout in seconds",
default=86400,
required=False,
)
parser.add_argument(
"--private_pool_id",
type=str,
help="The private pool id.",
required=False,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
)
execute_changed_notebooks_helper.process_and_execute_notebooks(
notebooks=notebooks,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
private_pool_id=args.private_pool_id,
should_parallelize=args.should_parallelize,
timeout=args.timeout,
)
+418
View File
@@ -0,0 +1,418 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import concurrent
import dataclasses
import datetime
import functools
import git
import operator
import os
import pathlib
import re
import subprocess
from typing import List, Optional
import execute_notebook_helper
import execute_notebook_remote
import nbformat
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
from ratemate import RateLimit
from tabulate import tabulate
from utils import NotebookProcessors, util
# A buffer so that workers finish before the orchestrating job
WORKER_TIMEOUT_BUFFER_IN_SECONDS: int = 60 * 60
def format_timedelta(delta: datetime.timedelta) -> str:
"""Formats a timedelta duration to [N days] %H:%M:%S format"""
seconds = int(delta.total_seconds())
secs_in_a_day = 86400
secs_in_a_hour = 3600
secs_in_a_min = 60
days, seconds = divmod(seconds, secs_in_a_day)
hours, seconds = divmod(seconds, secs_in_a_hour)
minutes, seconds = divmod(seconds, secs_in_a_min)
time_fmt = f"{hours:02d}:{minutes:02d}:{seconds:02d}"
if days > 0:
suffix = "s" if days > 1 else ""
return f"{days} day{suffix} {time_fmt}"
return time_fmt
@dataclasses.dataclass
class NotebookExecutionResult:
name: str
duration: datetime.timedelta
is_pass: bool
log_url: str
output_uri: str
build_id: str
error_message: Optional[str]
def _process_notebook(
notebook_path: str,
variable_project_id: str,
variable_region: str,
):
# Read notebook
with open(notebook_path) as f:
nb = nbformat.read(f, as_version=4)
# Create preprocessors
remove_no_execute_cells_preprocessor = NotebookProcessors.RemoveNoExecuteCells()
update_variables_preprocessor = NotebookProcessors.UpdateVariablesPreprocessor(
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
},
)
# Use no-execute preprocessor
(
nb,
resources,
) = remove_no_execute_cells_preprocessor.preprocess(nb)
(nb, resources) = update_variables_preprocessor.preprocess(nb, resources)
with open(notebook_path, mode="w", encoding="utf-8") as new_file:
nbformat.write(nb, new_file)
def _create_tag(filepath: str) -> str:
tag = os.path.basename(os.path.normpath(filepath))
tag = re.sub("[^0-9a-zA-Z_.-]+", "-", tag)
if tag.startswith(".") or tag.startswith("-"):
tag = tag[1:]
return tag
rate_limit = RateLimit(max_count=50, per=60, greedy=True)
def process_and_execute_notebook(
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
deadline: datetime,
notebook: str,
should_get_tail_logs: bool = False,
) -> NotebookExecutionResult:
rate_limit.wait() # wait before creating the task
print(f"Running notebook: {notebook}")
# Create paths
notebook_output_uri = "/".join([artifacts_bucket, pathlib.Path(notebook).name])
# Create tag from notebook
tag = _create_tag(filepath=notebook)
result = NotebookExecutionResult(
name=tag,
duration=datetime.timedelta(seconds=0),
is_pass=False,
output_uri=notebook_output_uri,
log_url="",
build_id="",
error_message=None,
)
# TODO: Handle cases where multiple notebooks have the same name
time_start = datetime.datetime.now()
operation = None
try:
# Pre-process notebook by substituting variable names
_process_notebook(
notebook_path=notebook,
variable_project_id=variable_project_id,
variable_region=variable_region,
)
# Upload the pre-processed code to a GCS bucket
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
# Calculate timeout in seconds
timeout_in_seconds = max(
int((deadline - datetime.datetime.now()).total_seconds()), 1
)
operation = execute_notebook_remote.execute_notebook_remote(
code_archive_uri=code_archive_uri,
notebook_uri=notebook,
notebook_output_uri=notebook_output_uri,
container_uri=container_uri,
tag=tag,
private_pool_id=private_pool_id,
private_pool_region=variable_region,
timeout_in_seconds=timeout_in_seconds,
)
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
result.build_id = operation_metadata.build.id
result.log_url = operation_metadata.build.log_url
# Block and wait for the result
operation_result = operation.result()
result.duration = datetime.datetime.now() - time_start
result.is_pass = True
print(f"{notebook} PASSED in {format_timedelta(result.duration)}.")
except Exception as error:
result.error_message = str(error)
if operation and should_get_tail_logs:
# Extract the logs
logs_bucket = operation_metadata.build.logs_bucket
# Download tail end of logs file
log_file_uri = f"{logs_bucket}/log-{result.build_id}.txt"
# Use gcloud to get tail
try:
result.error_message = subprocess.check_output(
["gsutil", "cat", "-r", "-1000", log_file_uri], encoding="UTF-8"
)
except Exception as error:
result.error_message = str(error)
result.duration = datetime.datetime.now() - time_start
result.is_pass = False
print(
f"{notebook} FAILED in {format_timedelta(result.duration)}: {result.error_message}"
)
return result
def get_changed_notebooks(
test_paths_file: str,
base_branch: Optional[str] = None,
) -> List[str]:
"""
Get the notebooks that exist under the folders defined in the test_paths_file.
It only returns notebooks that have differences from the Git base_branch.
"""
test_paths = []
with open(test_paths_file) as file:
lines = [line.strip() for line in file.readlines()]
lines = [line for line in lines if len(line) > 0]
test_paths = [line for line in lines]
if len(test_paths) == 0:
raise RuntimeError("No test folders found.")
print(f"Checking folders: {test_paths}")
# Find notebooks
notebooks = []
# Instantiate GitPython objects
repo = git.Repo(os.getcwd())
index = repo.index
if base_branch:
# Get the point at which this branch branches off from main
branching_commits = repo.merge_base("HEAD", f"origin/{base_branch}")
if len(branching_commits) > 0:
branching_commit = branching_commits[0]
print(f"Looking for notebooks that changed from branch: {branching_commit}")
notebooks = [
diff.b_path
for diff in index.diff(branching_commit, paths=test_paths)
if diff.b_path is not None
]
else:
notebooks = []
else:
print(f"Looking for all notebooks.")
notebooks = subprocess.check_output(["git", "ls-files"] + test_paths)
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
if len(notebooks) > 0:
print(f"Found {len(notebooks)} notebooks:")
for notebook in notebooks:
print(f"\t{notebook}")
return notebooks
def process_and_execute_notebooks(
notebooks: List[str],
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
should_parallelize: bool,
timeout: int,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
timeout (str):
Required. Timeout string according to https://cloud.google.com/build/docs/build-config-file-schema#timeout.
"""
# Calculate deadline
deadline = datetime.datetime.now() + datetime.timedelta(
seconds=max(timeout - WORKER_TIMEOUT_BUFFER_IN_SECONDS, 0)
)
if len(notebooks) > 1:
notebook_execution_results: List[NotebookExecutionResult] = []
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
if should_parallelize and len(notebooks) > 1:
print(
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
)
with concurrent.futures.ThreadPoolExecutor(max_workers=100) as executor:
print(f"Max workers: {executor._max_workers}")
notebook_execution_results = list(
executor.map(
functools.partial(
process_and_execute_notebook,
container_uri,
staging_bucket,
artifacts_bucket,
variable_project_id,
variable_region,
private_pool_id,
deadline,
),
notebooks,
)
)
else:
notebook_execution_results = [
process_and_execute_notebook(
container_uri=container_uri,
staging_bucket=staging_bucket,
artifacts_bucket=artifacts_bucket,
variable_project_id=variable_project_id,
variable_region=variable_region,
private_pool_id=private_pool_id,
deadline=deadline,
notebook=notebook,
)
for notebook in notebooks
]
print("\n=== RESULTS ===\n")
results_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
result.name,
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.log_url,
result.output_uri,
]
for result in results_sorted
],
headers=["build_tag", "status", "duration", "log_url", "output_url"],
)
)
print("\n=== END RESULTS===\n")
total_notebook_duration = functools.reduce(
operator.add,
[datetime.timedelta(seconds=0)]
+ [result.duration for result in results_sorted],
)
print(
f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}"
)
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
elif len(notebooks) == 1:
notebook = notebooks[0]
# Pre-process notebook by substituting variable names
_process_notebook(
notebook_path=notebook,
variable_project_id=variable_project_id,
variable_region=variable_region,
)
execute_notebook_helper.execute_notebook(
notebook_source=notebook,
output_file_or_uri="/".join(
[artifacts_bucket, pathlib.Path(notebook).name]
),
should_log_output=True,
)
else:
print("No notebooks modified in this pull request.")
+41
View File
@@ -0,0 +1,41 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to download (optional) and run a single notebook locally"""
import argparse
import execute_notebook_helper
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
parser.add_argument(
"--notebook_source",
type=str,
help="Local filepath or GCS URI to notebook.",
required=True,
)
parser.add_argument(
"--output_file_or_uri",
type=str,
help="Local file or GCS URI to save executed notebook to.",
required=True,
)
args = parser.parse_args()
execute_notebook_helper.execute_notebook(
notebook_source=args.notebook_source,
output_file_or_uri=args.output_file_or_uri,
should_log_output=True,
)
+91
View File
@@ -0,0 +1,91 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook locally"""
import errno
import os
import shutil
import sys
import papermill as pm
from google.cloud.aiplatform import utils
from utils import util
# This script is used to execute a notebook and write out the output notebook.
def execute_notebook(
notebook_source: str,
output_file_or_uri: str,
should_log_output: bool,
):
"""Execute a single notebook using Papermill"""
file_name = os.path.basename(os.path.normpath(notebook_source))
# Download notebook if it's a GCS URI
if notebook_source.startswith("gs://"):
# Extract uri components
bucket_name, prefix = utils.extract_bucket_and_prefix_from_gcs_path(
notebook_source
)
# Download remote notebook to local file system
notebook_source = file_name
util.download_file(
bucket_name=bucket_name, blob_name=prefix, destination_file=notebook_source
)
execution_exception = None
# Execute notebook
try:
# Execute notebook
pm.execute_notebook(
input_path=notebook_source,
output_path=notebook_source,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
)
except Exception as exception:
execution_exception = exception
finally:
# Copy executed notebook
if output_file_or_uri.startswith("gs://"):
# Upload to GCS path
util.upload_file(notebook_source, remote_file_path=output_file_or_uri)
print("\n=== EXECUTION FINISHED ===\n")
print(
f"Please debug the executed notebook by downloading: {output_file_or_uri}"
)
print("\n======\n")
else:
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_or_uri)):
try:
os.makedirs(os.path.dirname(output_file_or_uri))
except OSError as exc: # Guard against race condition
if exc.errno != errno.EEXIST:
raise
print(f"Writing output to: {output_file_or_uri}")
shutil.move(notebook_source, output_file_or_uri)
if execution_exception:
raise execution_exception
+100
View File
@@ -0,0 +1,100 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook on Google Cloud Build"""
from re import sub
from typing import Optional
import google.auth
import yaml
from google.api_core import client_options, operation
from google.cloud.aiplatform import utils
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from google.protobuf import duration_pb2
from yaml.loader import FullLoader
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
def execute_notebook_remote(
code_archive_uri: str,
notebook_uri: str,
notebook_output_uri: str,
container_uri: str,
private_pool_id: Optional[str],
private_pool_region: Optional[str],
tag: Optional[str],
timeout_in_seconds: Optional[int] = None,
) -> operation.Operation:
"""Create and execute a single notebook on Google Cloud Build"""
# Load build steps from YAML
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
substitutions = {
"_PYTHON_IMAGE": container_uri,
"_NOTEBOOK_GCS_URI": notebook_uri,
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
}
build = cloudbuild_v1.Build()
options: Optional[client_options.ClientOptions] = None
if private_pool_id and private_pool_region:
# substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
build.options = cloudbuild_config.get("options")
build.options.pool = {"name": private_pool_id}
# Switch to the regional endpoint of the pool
options = client_options.ClientOptions(
api_endpoint=f"{private_pool_region}-{SERVICE_BASE_PATH}"
)
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
(
source_archived_file_gcs_bucket,
source_archived_file_gcs_object,
) = utils.extract_bucket_and_prefix_from_gcs_path(code_archive_uri)
build.source = Source(
storage_source=StorageSource(
bucket=source_archived_file_gcs_bucket,
object_=source_archived_file_gcs_object,
)
)
build.steps = cloudbuild_config["steps"]
build.substitutions = substitutions
build.timeout = duration_pb2.Duration(seconds=timeout_in_seconds)
build.queue_ttl = duration_pb2.Duration(seconds=timeout_in_seconds)
if tag:
build.tags = [tag]
operation = client.create_build(project_id=project_id, build=build)
# Print the in-progress operation
# print("IN PROGRESS:")
# print(operation.metadata)
# Print the completed status
# print("RESULT:", result.status)
return operation
@@ -0,0 +1,28 @@
steps:
# Show the gcloud info and check if gcloud exists
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'gcloud config list'
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 .cloud-build/CheckPythonVersion.py'
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
# Install Python dependencies and run testing script
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"'
env:
- 'IS_TESTING=1'
timeout: 86400s
@@ -11,34 +11,25 @@ steps:
args:
- -c
- 'python3 .cloud-build/CheckPythonVersion.py'
# Fetch base branch if required
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'if [ -n "${_BASE_BRANCH}" ]; then git fetch origin "${_BASE_BRANCH}":refs/remotes/origin/"${_BASE_BRANCH}"; else echo "Skipping fetch."; fi'
# Fetch full repo for diff purposes
- name: gcr.io/cloud-builders/git
args: [fetch, --unshallow]
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: pip
args: ['install', '--upgrade', '--user', '--requirement', '.cloud-build/requirements.txt']
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
# Install Python dependencies and run testing script
# TODO: Only pass in private_pool_id if it is set
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --output_folder ${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`'
env:
- 'IS_TESTING=1'
# Manually copy artifacts to GCS
- name: gcr.io/cloud-builders/gsutil
entrypoint: /bin/sh
args:
- -c
- 'if [ $(ls -pR "/workspace/${BUILD_ID}" | grep -v / | grep -v ^$ | wc -l) -ne 0 ]; then gsutil -m -q rsync -r "/workspace/${BUILD_ID}" "gs://${_GCS_ARTIFACTS_BUCKET}/test-artifacts/PR_${_PR_NUMBER}/BUILD_${BUILD_ID}/"; else echo "No artifacts to copy."; fi'
# Fail if there is anything in the failure folder
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'echo "Download executed notebooks with this command: \"mkdir -p artifacts && gsutil rsync -r gs://${_GCS_ARTIFACTS_BUCKET}/test-artifacts/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} artifacts/\"" && if [ "$(ls -A /workspace/${BUILD_ID}/failure | wc -l)" -ne 0 ]; then exit 1; else exit 0; fi'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
+12 -7
View File
@@ -1,8 +1,13 @@
ipython>=7.0
jupyter>=1.0
nbconvert>=6.0
papermill>=2.3
numpy>=1.19
pandas>=1.2
matplotlib>=3.4
ipython
numpy
jupyter
nbconvert
papermill
pandas
matplotlib
tabulate
google-cloud-aiplatform
google-cloud-storage
google-cloud-build
ratemate
GitPython
+5
View File
@@ -0,0 +1,5 @@
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/matching_engine/intro-swivel.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
@@ -13,9 +13,11 @@
# See the License for the specific language governing permissions and
# limitations under the License.
from nbconvert.preprocessors import Preprocessor
from typing import Dict
import UpdateNotebookVariables
from nbconvert.preprocessors import Preprocessor
from . import UpdateNotebookVariables as update_notebook_variables
class RemoveNoExecuteCells(Preprocessor):
@@ -41,7 +43,7 @@ class UpdateVariablesPreprocessor(Preprocessor):
# VARIABLE_NAME = '[description]'
for variable_name, variable_value in replacement_map.items():
content = UpdateNotebookVariables.get_updated_value(
content = update_notebook_variables.get_updated_value(
content=content,
variable_name=variable_name,
variable_value=variable_value,
@@ -60,4 +62,4 @@ class UpdateVariablesPreprocessor(Preprocessor):
executable_cells.append(cell)
notebook.cells = executable_cells
return notebook, resources
return notebook, resources
@@ -78,4 +78,4 @@ def test_region():
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
View File
+60
View File
@@ -0,0 +1,60 @@
import os
import subprocess
import tarfile
import uuid
from datetime import datetime
from typing import Optional
from google.auth import credentials as auth_credentials
from google.cloud import storage
from google.cloud.aiplatform import utils
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
"""Copies a remote GCS file to a local path"""
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
subprocess.check_output(
["gsutil", "cp", remote_file_path, destination_file], encoding="UTF-8"
)
return destination_file
def upload_file(
local_file_path: str,
remote_file_path: str,
) -> str:
"""Copies a local file to a GCS path"""
subprocess.check_output(
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
)
return remote_file_path
def archive_code_and_upload(staging_bucket: str):
# Archive all source in current directory
unique_id = uuid.uuid4()
source_archived_file = f"source_archived_{unique_id}.tar.gz"
git_files = subprocess.check_output(
["git", "ls-tree", "-r", "HEAD", "--name-only"], encoding="UTF-8"
).split("\n")
with tarfile.open(source_archived_file, "w:gz") as tar:
for file in git_files:
if len(file) > 0 and os.path.exists(file):
tar.add(file)
# Upload archive to GCS bucket
source_archived_file_gcs = upload_file(
local_file_path=f"{source_archived_file}",
remote_file_path="/".join(
[staging_bucket, "code_archives", source_archived_file]
),
)
print(f"Uploaded source code archive to {source_archived_file_gcs}")
return source_archived_file_gcs
+10 -9
View File
@@ -1,17 +1,18 @@
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/notebooks/notebook_template.ipynb) as a starting point.
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) folder:
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
+6 -4
View File
@@ -7,13 +7,15 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Set up Python
uses: actions/setup-python@v2
uses: actions/setup-python@v4
with:
python-version: '3.x'
- name: Fetch pull request branch
uses: actions/checkout@v2
uses: actions/checkout@v3
with:
fetch-depth: 0
- name: Fetch base master branch
run: git fetch -u "$GITHUB_SERVER_URL/$GITHUB_REPOSITORY" master:master
- name: Fetch base main branch
run: git fetch -u "$GITHUB_SERVER_URL/$GITHUB_REPOSITORY" main:main
- name: Install requirements
run: python3 -m pip install -U -r .github/workflows/linter/requirements.txt
- name: Format and lint notebooks
+6 -5
View File
@@ -2,8 +2,9 @@ git+https://github.com/tensorflow/docs
ipython
jupyter
nbconvert
black==20.8b1
pyupgrade==2.7.3
isort==5.6.4
flake8==3.9.0
nbqa==0.6.0
black==22.3.0
pyupgrade==2.34.0
isort==5.10.1
flake8==4.0.1
nbqa==1.3.1
+7 -7
View File
@@ -13,7 +13,7 @@
# See the License for the specific language governing permissions and
# limitations under the License.
# This script automatically formats and lints all notebooks that have changed from the head of the master branch.
# This script automatically formats and lints all notebooks that have changed from the head of the main branch.
#
# Options:
# -t: Test-mode. Only test if format and linting are required but make no changes to files.
@@ -52,7 +52,7 @@ echo "Test mode: $is_test"
notebooks=()
while read -r file || [ -n "$line" ]; do
notebooks+=("$file")
done < <(git diff --name-only master... | grep '\.ipynb$')
done < <(git diff --name-only main... | grep '\.ipynb$')
problematic_notebooks=()
if [ ${#notebooks[@]} -gt 0 ]; then
@@ -80,23 +80,23 @@ if [ ${#notebooks[@]} -gt 0 ]; then
python3 -m nbqa isort "$notebook" --check
ISORT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
FLAKE8_RTN=$?
else
echo "Running black..."
python3 -m nbqa black "$notebook" --nbqa-mutate
python3 -m nbqa black "$notebook"
BLACK_RTN=$?
echo "Running pyupgrade..."
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
python3 -m nbqa pyupgrade "$notebook"
PYUPGRADE_RTN=$?
echo "Running isort..."
python3 -m nbqa isort "$notebook" --nbqa-mutate
python3 -m nbqa isort "$notebook"
ISORT_RTN=$?
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
NBFMT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722 --nbqa-mutate
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
FLAKE8_RTN=$?
fi
+6
View File
@@ -0,0 +1,6 @@
# See https://help.github.com/en/articles/about-code-owners
# for more info about CODEOWNERS file.
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence.
* @GoogleCloudPlatform/vertex-ai-samples-owners
+43
View File
@@ -0,0 +1,43 @@
# Contributor Code of Conduct
As contributors and maintainers of this project,
and in the interest of fostering an open and welcoming community,
we pledge to respect all people who contribute through reporting issues,
posting feature requests, updating documentation,
submitting pull requests or patches, and other activities.
We are committed to making participation in this project
a harassment-free experience for everyone,
regardless of level of experience, gender, gender identity and expression,
sexual orientation, disability, personal appearance,
body size, race, ethnicity, age, religion, or nationality.
Examples of unacceptable behavior by participants include:
* The use of sexualized language or imagery
* Personal attacks
* Trolling or insulting/derogatory comments
* Public or private harassment
* Publishing other's private information,
such as physical or electronic
addresses, without explicit permission
* Other unethical or unprofessional conduct.
Project maintainers have the right and responsibility to remove, edit, or reject
comments, commits, code, wiki edits, issues, and other contributions
that are not aligned to this Code of Conduct.
By adopting this Code of Conduct,
project maintainers commit themselves to fairly and consistently
applying these principles to every aspect of managing this project.
Project maintainers who do not follow or enforce the Code of Conduct
may be permanently removed from the project team.
This code of conduct applies both within project spaces and in public spaces
when an individual is representing the project or its community.
Instances of abusive, harassing, or otherwise unacceptable behavior
may be reported by opening an issue
or contacting one or more of the project maintainers.
This Code of Conduct is adapted from the [Contributor Covenant](http://contributor-covenant.org), version 1.2.0,
available at [http://contributor-covenant.org/version/1/2/0/](http://contributor-covenant.org/version/1/2/0/)
+65
View File
@@ -0,0 +1,65 @@
# How to Contribute
We'd love to accept your patches and contributions to this project. There are
just a few small guidelines you need to follow.
## Contributor License Agreement
Contributions to this project must be accompanied by a Contributor License
Agreement. You (or your employer) retain the copyright to your contribution;
this simply gives us permission to use and redistribute your contributions as
part of the project. Head over to <https://cla.developers.google.com/> to see
your current agreements on file or to sign a new one.
You generally only need to submit a CLA once, so if you've already submitted one
(even if it was for a different project), you probably don't need to do it
again.
## Code Quality Checks
All notebooks in this project are checked for formatting and style, to ensure a
consistent experience. To test notebooks prior to submitting a pull request,
you can follow these steps.
From a command-line terminal (e.g. from Vertex Workbench or locally), install
the code analysis tools:
```shell
pip3 install --user -U nbqa black flake8 isort pyupgrade git+https://github.com/tensorflow/docs
```
You'll likely need to add the directory where these were installed to your PATH:
```shell
export PATH="$HOME/.local/bin:$PATH"
```
Then, set an environment variable for your notebook (or directory):
```shell
export notebook="your-notebook.ipynb"
```
Finally, run this code block to check for errors. Each step will attempt to
automatically fix any issues. If the fixes can't be performed automatically,
then you will need to manually address them before submitting your PR.
```shell
nbqa black "$notebook"
nbqa pyupgrade "$notebook"
nbqa isort "$notebook"
nbqa flake8 "$notebook" --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
```
## Code Reviews
All submissions, including submissions by project members, require review. We
use GitHub pull requests for this purpose. Consult
[GitHub Help](https://help.github.com/articles/about-pull-requests/) for more
information on using pull requests.
## Community Guidelines
This project follows [Google's Open Source Community
Guidelines](https://opensource.google/conduct/).
+19 -2
View File
@@ -6,15 +6,32 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
## Overview
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks) and [Tutorials](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/tutorials) that demonstrate how to develop and manage ML workflow using Google Cloud Vertex AI.
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
## Repository structure
```bash
├── community-content - Sample code and tutorials contributed by the community
├── notebooks
│ ├── community - Notebooks contributed by the community
│ ├── official - Notebooks demonstrating use of each Vertex AI service
│ │ ├── automl
│ │ ├── custom
│ │ ├── ...
```
## Contributing
Contributions welcome! See the [Contributing Guide](Contributions welcome! See the [Contributing Guide](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md).
Contributions welcome! See the [Contributing Guide](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/CONTRIBUTING.md).
## Getting help
Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) to provide feedback or submit a bug report.
## Disclaimer
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
## Feedback
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
+7
View File
@@ -0,0 +1,7 @@
# Security Policy
To report a security issue, please use [g.co/vulnz](https://g.co/vulnz).
The Google Security Team will respond within 5 working days of your report on g.co/vulnz.
We use g.co/vulnz for our intake, and do coordination and disclosure here using GitHub Security Advisory to privately discuss and fix the issue.
+6
View File
@@ -0,0 +1,6 @@
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/pluto_on_workbench @wkharold
@@ -0,0 +1,824 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "pc5-mbsX9PZC"
},
"source": [
"# AlphaFold On Vertex AI Workbench\n",
"\n",
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
"\n",
"## ![](https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/alphafold_on_workbench/vertexai_40.png) [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
"\n",
"**Differences to AlphaFold v2.1.0**\n",
"\n",
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
"\n",
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
"\n",
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
"\n",
"**Citing this work**\n",
"\n",
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
"\n",
"**Licenses**\n",
"\n",
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
"\n",
"\n",
"**More information**\n",
"\n",
"You can find more information about how AlphaFold works in the following papers:\n",
"\n",
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
"\n",
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b7a02613eb1a"
},
"source": [
"## Download AlphaFold Data"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "woIxeCPygt7K"
},
"outputs": [],
"source": [
"import os\n",
"import subprocess\n",
"import sys\n",
"\n",
"import alphafold.common\n",
"import tqdm.notebook\n",
"from IPython.utils import io\n",
"\n",
"TQDM_BAR_FORMAT = (\n",
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
")\n",
"\n",
"SOURCE_URL = (\n",
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
")\n",
"PARAMS_DIR = \"alphafold/data/params\"\n",
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
"\n",
"try:\n",
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" with io.capture_output() as captured:\n",
"\n",
" # Download and store stereo_chemical_props.txt\n",
" !mkdir -p ~/content/alphafold/alphafold/common\n",
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
" pbar.update(18)\n",
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
"\n",
" # Download alphafold_params_colab_2021-10-27.tar\n",
" !mkdir --parents \"{PARAMS_DIR}\"\n",
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
" pbar.update(27)\n",
"\n",
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
" # !rm \"{PARAMS_PATH}\"\n",
" pbar.update(55)\n",
"\n",
"except subprocess.CalledProcessError:\n",
" print(captured)\n",
" raise"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d8926b7d5529"
},
"source": [
"## Configure GPU Acceleration"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "VzJ5iMjTtoZw"
},
"outputs": [],
"source": [
"# Confirm accelerator configuration\n",
"import jax\n",
"\n",
"if jax.local_devices()[0].platform == \"tpu\":\n",
" raise RuntimeError(\n",
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
" )\n",
"elif jax.local_devices()[0].platform == \"cpu\":\n",
" print(\n",
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
" )\n",
"else:\n",
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
"\n",
"# Make sure all necessary environment variables are set.\n",
"import os\n",
"\n",
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "W4JpOs6oA-QS"
},
"source": [
"## Making a prediction\n",
"\n",
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
"\n",
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
"\n",
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
"\n",
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b310d44229d0"
},
"outputs": [],
"source": [
"# Input sequences (type: str)\n",
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
"sequence_2 = \"\"\n",
"sequence_3 = \"\"\n",
"sequence_4 = \"\"\n",
"sequence_5 = \"\"\n",
"sequence_6 = \"\"\n",
"sequence_7 = \"\"\n",
"sequence_8 = \"\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "rowN0bVYLe9n"
},
"outputs": [],
"source": [
"from alphafold.notebooks import notebook_utils\n",
"\n",
"input_sequences = (\n",
" sequence_1,\n",
" sequence_2,\n",
" sequence_3,\n",
" sequence_4,\n",
" sequence_5,\n",
" sequence_6,\n",
" sequence_7,\n",
" sequence_8,\n",
")\n",
"\n",
"# If folding a complex target and all the input sequences are\n",
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
"# otherwise or if the origin is unknown.\n",
"\n",
"is_prokaryote = False # @param {type:\"boolean\"}\n",
"\n",
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
"MAX_MULTIMER_LENGTH = 2500\n",
"\n",
"# Validate the input.\n",
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
" input_sequences=input_sequences,\n",
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "db551d4877ea"
},
"source": [
"## Search against genetic databases\n",
"\n",
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "2tTeTTsLKPjB"
},
"outputs": [],
"source": [
"import collections\n",
"import copy\n",
"import random\n",
"from concurrent import futures\n",
"from urllib import request\n",
"\n",
"import matplotlib.pyplot as plt\n",
"import numpy as np\n",
"import py3Dmol\n",
"from alphafold.common import protein\n",
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
" pipeline_multimer)\n",
"from alphafold.data.tools import jackhmmer\n",
"from alphafold.model import config, data, model\n",
"from alphafold.relax import relax, utils\n",
"from IPython import display\n",
"from ipywidgets import GridspecLayout, Output\n",
"\n",
"# Color bands for visualizing plddt\n",
"PLDDT_BANDS = [\n",
" (0, 50, \"#FF7D45\"),\n",
" (50, 70, \"#FFDB13\"),\n",
" (70, 90, \"#65CBF3\"),\n",
" (90, 100, \"#0053D6\"),\n",
"]\n",
"\n",
"# --- Find the closest source ---\n",
"test_url_pattern = (\n",
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
")\n",
"ex = futures.ThreadPoolExecutor(3)\n",
"\n",
"\n",
"def fetch(source):\n",
" request.urlretrieve(test_url_pattern.format(source))\n",
" return source\n",
"\n",
"\n",
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
"source = None\n",
"for f in futures.as_completed(fs):\n",
" source = f.result()\n",
" ex.shutdown()\n",
" break\n",
"\n",
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
"# The z_value is the number of sequences in a database.\n",
"MSA_DATABASES = [\n",
" {\n",
" \"db_name\": \"uniref90\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 59,\n",
" \"z_value\": 135_301_051,\n",
" },\n",
" {\n",
" \"db_name\": \"smallbfd\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
" \"num_streamed_chunks\": 17,\n",
" \"z_value\": 65_984_053,\n",
" },\n",
" {\n",
" \"db_name\": \"mgnify\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
" \"num_streamed_chunks\": 71,\n",
" \"z_value\": 304_820_129,\n",
" },\n",
"]\n",
"\n",
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
" MSA_DATABASES.extend(\n",
" [\n",
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
" {\n",
" \"db_name\": \"uniprot\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 98,\n",
" \"z_value\": 219_174_961 + 565_254,\n",
" },\n",
" ]\n",
" )\n",
"\n",
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
"\n",
"MAX_HITS = {\n",
" \"uniref90\": 10_000,\n",
" \"smallbfd\": 5_000,\n",
" \"mgnify\": 501,\n",
" \"uniprot\": 50_000,\n",
"}\n",
"\n",
"\n",
"def get_msa(fasta_path):\n",
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
"\n",
" # Run the search against chunks of genetic databases.\n",
" raw_msa_results = collections.defaultdict(list)\n",
" with tqdm.notebook.tqdm(\n",
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
" ) as pbar:\n",
"\n",
" def jackhmmer_chunk_callback(i):\n",
" pbar.update(n=1)\n",
"\n",
" for db_config in MSA_DATABASES:\n",
" db_name = db_config[\"db_name\"]\n",
" pbar.set_description(f\"Searching {db_name}\")\n",
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
" binary_path=JACKHMMER_BINARY_PATH,\n",
" database_path=db_config[\"db_path\"],\n",
" get_tblout=True,\n",
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
" streaming_callback=jackhmmer_chunk_callback,\n",
" z_value=db_config[\"z_value\"],\n",
" )\n",
" # Group the results by database name.\n",
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
"\n",
" return raw_msa_results\n",
"\n",
"\n",
"features_for_chain = {}\n",
"raw_msa_results_for_sequence = {}\n",
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
"\n",
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
" with open(fasta_path, \"wt\") as f:\n",
" f.write(f\">query\\n{sequence}\")\n",
"\n",
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
" if sequence not in raw_msa_results_for_sequence:\n",
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
" else:\n",
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
"\n",
" # Extract the MSAs from the Stockholm files.\n",
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
" single_chain_msas = []\n",
" uniprot_msa = None\n",
" for db_name, db_results in raw_msa_results.items():\n",
" merged_msa = notebook_utils.merge_chunked_msa(\n",
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
" )\n",
" if merged_msa.sequences and db_name != \"uniprot\":\n",
" single_chain_msas.append(merged_msa)\n",
" msa_size = len(set(merged_msa.sequences))\n",
" print(\n",
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
" )\n",
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
" uniprot_msa = merged_msa\n",
"\n",
" notebook_utils.show_msa_info(\n",
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
" )\n",
"\n",
" # Turn the raw data into model features.\n",
" feature_dict = {}\n",
" feature_dict.update(\n",
" pipeline.make_sequence_features(\n",
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
" )\n",
" )\n",
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
" feature_dict.update(\n",
" notebook_utils.empty_placeholder_template_features(\n",
" num_templates=0, num_res=len(sequence)\n",
" )\n",
" )\n",
"\n",
" # Construct the all_seq features only for heteromers, not homomers.\n",
" if (\n",
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
" and len(set(sequences)) > 1\n",
" ):\n",
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
" \"msa_uniprot_accession_identifiers\",\n",
" \"msa_species_identifiers\",\n",
" )\n",
" all_seq_features = {\n",
" f\"{k}_all_seq\": v\n",
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
" if k in valid_feats\n",
" }\n",
" feature_dict.update(all_seq_features)\n",
"\n",
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
"\n",
"\n",
"# Do further feature post-processing depending on the model type.\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
"\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" all_chain_features = {}\n",
" for chain_id, chain_features in features_for_chain.items():\n",
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
" chain_features, chain_id\n",
" )\n",
"\n",
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
"\n",
" np_example = feature_processing.pair_and_merge(\n",
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
" )\n",
"\n",
" # Pad MSA to avoid zero-sized extra_msa.\n",
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9640643486bd"
},
"source": [
"## Run AlphaFold\n",
"\n",
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "XUo6foMQxwS2"
},
"outputs": [],
"source": [
"run_relax = True\n",
"\n",
"# --- Run the model ---\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
"\n",
"output_dir = \"prediction\"\n",
"os.makedirs(output_dir, exist_ok=True)\n",
"\n",
"plddts = {}\n",
"ranking_confidences = {}\n",
"pae_outputs = {}\n",
"unrelaxed_proteins = {}\n",
"\n",
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" for model_name in model_names:\n",
" pbar.set_description(f\"Running {model_name}\")\n",
"\n",
" cfg = config.model_config(model_name)\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" cfg.data.eval.num_ensemble = 1\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" cfg.model.num_ensemble_eval = 1\n",
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
" model_runner = model.RunModel(cfg, params)\n",
" processed_feature_dict = model_runner.process_features(\n",
" np_example, random_seed=0\n",
" )\n",
" prediction = model_runner.predict(\n",
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
" )\n",
"\n",
" mean_plddt = prediction[\"plddt\"].mean()\n",
"\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" if \"predicted_aligned_error\" in prediction:\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
" else:\n",
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
" # should never get selected.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" # Multimer models are sorted by pTM+ipTM.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
"\n",
" # Set the b-factors to the per-residue plddt.\n",
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
" unrelaxed_protein = protein.from_prediction(\n",
" processed_feature_dict,\n",
" prediction,\n",
" b_factors=b_factors,\n",
" remove_leading_feature_dimension=(\n",
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
" ),\n",
" )\n",
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
"\n",
" # Delete unused outputs to save memory.\n",
" del model_runner\n",
" del params\n",
" del prediction\n",
" pbar.update(n=1)\n",
"\n",
" # --- AMBER relax the best model ---\n",
"\n",
" # Find the best model according to the mean pLDDT.\n",
" best_model_name = max(\n",
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
" )\n",
"\n",
" if run_relax:\n",
" pbar.set_description(\"AMBER relaxation\")\n",
" amber_relaxer = relax.AmberRelaxation(\n",
" max_iterations=0,\n",
" tolerance=2.39,\n",
" stiffness=10.0,\n",
" exclude_residues=[],\n",
" max_outer_iterations=3,\n",
" )\n",
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
" prot=unrelaxed_proteins[best_model_name]\n",
" )\n",
" else:\n",
" print(\"Warning: Running without the relaxation stage.\")\n",
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
" pbar.update(n=1) # Finished AMBER relax.\n",
"\n",
"# Construct multiclass b-factors to indicate confidence bands\n",
"# 0=very low, 1=low, 2=confident, 3=very high\n",
"banded_b_factors = []\n",
"for plddt in plddts[best_model_name]:\n",
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
" if plddt >= min_val and plddt <= max_val:\n",
" banded_b_factors.append(idx)\n",
" break\n",
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
"\n",
"\n",
"# Write out the prediction\n",
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
"with open(pred_output_path, \"w\") as f:\n",
" f.write(relaxed_pdb)\n",
"\n",
"\n",
"# --- Visualise the prediction & confidence ---\n",
"show_sidechains = True\n",
"\n",
"\n",
"def plot_plddt_legend():\n",
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
" thresh = [\n",
" \"Very low (pLDDT < 50)\",\n",
" \"Low (70 > pLDDT > 50)\",\n",
" \"Confident (90 > pLDDT > 70)\",\n",
" \"Very high (pLDDT > 90)\",\n",
" ]\n",
"\n",
" colors = [x[2] for x in PLDDT_BANDS]\n",
"\n",
" plt.figure(figsize=(2, 2))\n",
" for c in colors:\n",
" plt.bar(0, 0, color=c)\n",
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
" plt.xticks([])\n",
" plt.yticks([])\n",
" ax = plt.gca()\n",
" ax.spines[\"right\"].set_visible(False)\n",
" ax.spines[\"top\"].set_visible(False)\n",
" ax.spines[\"left\"].set_visible(False)\n",
" ax.spines[\"bottom\"].set_visible(False)\n",
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
" return plt\n",
"\n",
"\n",
"# Show the structure coloured by chain if the multimer model has been used.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" multichain_view = py3Dmol.view(width=800, height=600)\n",
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
" multichain_view.zoomTo()\n",
" multichain_view.show()\n",
"\n",
"# Color the structure by per-residue pLDDT\n",
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
"view = py3Dmol.view(width=800, height=600)\n",
"view.addModelsAsFrames(to_visualize_pdb)\n",
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
"if show_sidechains:\n",
" style[\"stick\"] = {}\n",
"view.setStyle({\"model\": -1}, style)\n",
"view.zoomTo()\n",
"\n",
"grid = GridspecLayout(1, 2)\n",
"out = Output()\n",
"with out:\n",
" view.show()\n",
"grid[0, 0] = out\n",
"\n",
"out = Output()\n",
"with out:\n",
" plot_plddt_legend().show()\n",
"grid[0, 1] = out\n",
"\n",
"display.display(grid)\n",
"\n",
"# Display pLDDT and predicted aligned error (if output by the model).\n",
"if pae_outputs:\n",
" num_plots = 2\n",
"else:\n",
" num_plots = 1\n",
"\n",
"plt.figure(figsize=[8 * num_plots, 6])\n",
"plt.subplot(1, num_plots, 1)\n",
"plt.plot(plddts[best_model_name])\n",
"plt.title(\"Predicted LDDT\")\n",
"plt.xlabel(\"Residue\")\n",
"plt.ylabel(\"pLDDT\")\n",
"\n",
"if num_plots == 2:\n",
" plt.subplot(1, 2, 2)\n",
" pae, max_pae = list(pae_outputs.values())[0]\n",
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
" plt.colorbar(fraction=0.046, pad=0.04)\n",
"\n",
" # Display lines at chain boundaries.\n",
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
" chain_ids = best_unrelaxed_prot.chain_index\n",
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
" if chain_boundary.size:\n",
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
"\n",
" plt.title(\"Predicted Aligned Error\")\n",
" plt.xlabel(\"Scored residue\")\n",
" plt.ylabel(\"Aligned residue\")\n",
"\n",
"# Save the predicted aligned error (if it exists).\n",
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
"if pae_outputs:\n",
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
" with open(pae_output_path, \"w\") as f:\n",
" f.write(pae_data)\n",
"\n",
"!zip -q -r {output_dir}.zip {output_dir}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lUQAn5LYC5n4"
},
"source": [
"### Interpreting the prediction\n",
"\n",
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
"\n",
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jeb2z8DIA4om"
},
"source": [
"## FAQ & Troubleshooting\n",
"\n",
"\n",
"* How do I get a predicted protein structure for my protein?\n",
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
"* How long will this take?\n",
" * The search against genetic databases can take minutes to hours.\n",
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
"* My notebook no longer seems to be doing anything, what should I do?\n",
" * Some steps may take minutes to hours to complete.\n",
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
"* How does this compare to the open-source version of AlphaFold?\n",
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
"* Does this tool install anything on my computer?\n",
" * No, everything happens in the VM instance within your Google Cloud project.\n",
"* How should I share feedback and bug reports?\n",
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
"\n",
"\n",
"## Related work\n",
"\n",
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
"\n",
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "YfPhvYgKC81B"
},
"source": [
"# License and Disclaimer\n",
"\n",
"This is not an officially-supported Google product.\n",
"\n",
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
"\n",
"Copyright 2021 DeepMind Technologies Limited.\n",
"\n",
"\n",
"## AlphaFold Code License\n",
"\n",
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
"\n",
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
"\n",
"## Model Parameters License\n",
"\n",
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
"\n",
"\n",
"## Third-party software\n",
"\n",
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
"\n",
"\n",
"## Mirrored Databases\n",
"\n",
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
]
}
],
"metadata": {
"accelerator": "GPU",
"colab": {
"collapsed_sections": [],
"name": "AlphaFold.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,82 @@
# Copyright 2022 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
ARG CUDA_MAJOR=11
ARG CUDA_MINOR=0
FROM gcr.io/deeplearning-platform-release/base-cu110
ARG CUDA_MAJOR
ARG CUDA_MINOR
SHELL ["/bin/bash", "-c"]
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
build-essential \
cmake \
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
git \
hmmer \
kalign \
tzdata \
wget \
&& rm -rf /var/lib/apt/lists/*
# Compile HHsuite from source.
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
&& mkdir /tmp/hh-suite/build \
&& pushd /tmp/hh-suite/build \
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
&& make -j 4 && make install \
&& ln -s /opt/hhsuite/bin/* /usr/bin \
&& popd \
&& rm -rf /tmp/hh-suite
ENV PATH="/opt/conda/bin:$PATH"
RUN conda update -qy conda \
&& conda install -y -c conda-forge \
openmm=7.5.1 \
cudatoolkit==${CUDA_VERSION} \
pdbfixer \
pip \
python=3.7
COPY . /app/alphafold
# Install pip packages.
RUN pip3 install --upgrade pip \
&& pip3 install -r /app/alphafold/requirements.txt \
&& pip3 install py3Dmol tqdm \
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
https://storage.googleapis.com/jax-releases/jax_releases.html
# Install alphafold.
WORKDIR /app/alphafold
RUN python setup.py install
# Apply OpenMM patch.
WORKDIR /opt/conda/lib/python3.7/site-packages
RUN patch -p0 < /app/alphafold/docker/openmm.patch
# Creating a tmp location for jackhmmr; not mounting through to host though.
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
# details.
# ENTRYPOINT does not support easily running multiple commands, so instead we
# write a shell script to wrap them up.
WORKDIR /home/jupyter
RUN echo '#!/bin/bash\nldconfig\n\'
+20
View File
@@ -0,0 +1,20 @@
#!/usr/bin/env bash
set -e
# Prod (Publicly viewable)
PROJECT=cloud-devrel-public-resources
REPOSITORY=alphafold
LOCAL_IMAGE=alphafold-on-gcp
REMOTE_IMAGE=${LOCAL_IMAGE?}
TAG=latest
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
git clone https://github.com/deepmind/alphafold.git
cp Dockerfile alphafold/docker/Dockerfile
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
sudo docker push ${REGISTRY?}
Binary file not shown.

After

Width:  |  Height:  |  Size: 3.1 KiB

@@ -0,0 +1,52 @@
# Overview
*Pluto* is a programming environment for Julia, designed to be interactive and helpful. It provides a familiar notebook interface but it is not a Jupyter notebook. The biggest difference is that Pluto notebooks are reactive, changing a variable or function in one cell causes the cells that depend on that variable or function to be reevaluated. Pluto also provides useful interaction mechanisms that allow users to dynamically interact with the notebooks computation state.
The JuliaCon 2020 presentation: [Interactive notebooks ~ Pluto.jl]() provides a good introduction to Pluto. The source is at [fonsp/Pluto.jl]()
# Install Pluto
## Create a Vertex AI JupyterLab Instance
1. From the [GCP console](https://console.cloud.google.com) "hamburger menu"
select Vertex AI > Workbench
2. Click NEW NOTEBOOK
* Choose Python 3 if you won't be using a GPU
* Choose Python 3 (CUDA Toolkit xx.y) if you do want use a GPU
3. Give the notebook an appropriate name
4. Edit Notebook properties if you have special requirements otherwise accept the defaults and click CREATE
5. When the notebook instance is ready click OPEN JUPYTERLAB
## Configure JupyterLab
1. Open a terminal by clicking the Terminal icon.
1. Install the plutoserver
pip3 install git+https://github.com/fonsp/pluto-on-jupyterlab.git
1. In a browser go to [julialang.org/downloads](https://julialang.org/downloads/)
1. In the Current stable release right click on the `Generic Linux on x86 / 64-bit (glibc)` link
Select copy link address
1. Back in the terminal switch to root via
sudo -i
1. Download the release to /opt and install julia in /usr/local/bin
```bash
cd /opt
wget <paste the release link address>
tar xf <name of the downloaded tar file>
ln -s /opt/<julia-x.y.z>/bin/julia /usr/local/bin
^d
```
1. Add the Pluto package to Julia
```bash
julia
julia> ]add Pluto
julia> bksp
julia> using Pluto
julia> ^d
```
1. From the JupyterLab menu bar select File > Shut Down
# Start Pluto
1. Click OPEN JUPYTERLAB in the Workbench
1. In the Notebook section of the Launcher click Pluto.jl
1. The welcome to Pluto.jl screen should appear
@@ -1,391 +1,347 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "20a5ea0081d0"
},
"source": [
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8752d4a255fb"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b5ae674177e"
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "19a9b3bdd553"
},
"outputs": [],
"source": [
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5307fe28b633"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "46cb58c7fbf9"
},
"source": [
"### Built Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "97e66e9f9bab"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ae9b29c4773f"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "dc1e84d5dec2"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6964be27b98e"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "594a91f438f2"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "93134273261e"
},
"outputs": [],
"source": [
"content_name = content_name + \"-gpu\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c2bd82dbcd9b"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ebc593c6472e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "0769e8e34c2f"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "023f33ece826"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 1\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"args = [\n",
" \"--backend\",\n",
" \"nccl\",\n",
" \"--batch-size\",\n",
" \"128\",\n",
" \"--epochs\",\n",
" \"25\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d4b599e726ef"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "81321e3bdf7f"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" accelerator_count=accelerator_count,\n",
" accelerator_type=accelerator_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "5100712c2c4c"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f9b77676e5a6"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0e171ce95ace"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cf1b74a12b87"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a0b15089c341"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
}
},
{
"cell_type": "markdown",
"source": [
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
],
"metadata": {
"colab": {
"name": "multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Built Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri=f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
},
"execution_count": null,
"outputs": []
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = content_name + \"-gpu\"\n",
"\n",
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"args = [\n",
" '--backend', 'nccl',\n",
" '--batch-size', '128',\n",
" '--epochs', '25',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
},
"execution_count": null,
"outputs": []
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_count=accelerator_count,\n",
" accelerator_type=accelerator_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
"nbformat": 4,
"nbformat_minor": 0
}
@@ -19,7 +19,7 @@ Adapted from: https://github.com/narumiruna/pytorch-distributed-example
import argparse
import os
import tempfile
import shutil
import torch
from torch import distributed
@@ -29,8 +29,6 @@ from torch.utils.tensorboard import SummaryWriter
from torchvision import datasets, transforms
import utils
def parse_args():
parser = argparse.ArgumentParser()
@@ -43,6 +41,9 @@ def parse_args():
parser.add_argument(
'--tensorboard-log-dir', default=os.getenv('AIP_TENSORBOARD_LOG_DIR'), type=str,
help='a Cloud Storage URI of a directory intended for saving TensorBoard')
parser.add_argument(
'--checkpoint-dir', default=os.getenv('AIP_CHECKPOINT_DIR'), type=str,
help='a Cloud Storage URI of a directory intended for saving checkpoints')
parser.add_argument(
'--backend', type=str, default='gloo',
@@ -68,7 +69,6 @@ def parse_args():
'-lr', '--learning-rate', type=float, default=1e-3)
parser.add_argument(
'--batch-size', type=int, default=128)
parser.add_argument(
'--local-mode', action='store_true', help='use local mode when running on your local machine')
@@ -76,6 +76,12 @@ def parse_args():
return args
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def distributed_is_initialized():
if distributed.is_available():
if distributed.is_initialized():
@@ -176,7 +182,7 @@ class Trainer(object):
for epoch in range(1, epochs + 1):
print("Epoch: {}, Training ...".format(epoch))
print('Epoch: {}, Training ...'.format(epoch))
train_loss, train_acc = self.train()
if is_chief:
@@ -242,16 +248,30 @@ def main():
local_data_dir = './tmp/data'
local_model_dir = './tmp/model'
local_tensorboard_log_dir = './tmp/logs'
local_checkpoint_dir = './tmp/checkpoints'
#TODO: update when gcsfuse ready
gcsfuse_ready = False
model_dir = (gcsfuse_ready and args.model_dir) or local_model_dir
tensorboard_log_dir = (gcsfuse_ready and
args.tensorboard_log_dir) or local_tensorboard_log_dir
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
checkpoint_dir = args.checkpoint_dir or local_checkpoint_dir
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
if checkpoint_dir and checkpoint_dir.startswith(gs_prefix):
checkpoint_dir = checkpoint_dir.replace(gs_prefix, gcsfuse_prefix)
writer = SummaryWriter(tensorboard_log_dir)
is_chief = args.rank == 0
if is_chief:
makedirs(checkpoint_dir)
print(f'Checkpoints will be saved to {checkpoint_dir}')
checkpoint_path = os.path.join(checkpoint_dir, 'checkpoint.pt')
print(f'checkpoint_path is {checkpoint_path}')
if args.world_size > 1:
print('Initializing distributed backend with {} nodes'.format(args.world_size))
@@ -261,36 +281,38 @@ def main():
world_size=args.world_size,
rank=args.rank,
)
print(f"[{os.getpid()}]: "
f"world_size = {distributed.get_world_size()}, "
f"rank = {distributed.get_rank()}, "
f"backend={distributed.get_backend()} \n", end='')
print(f'[{os.getpid()}]: '
f'world_size = {distributed.get_world_size()}, '
f'rank = {distributed.get_rank()}, '
f'backend={distributed.get_backend()} \n', end='')
if torch.cuda.is_available() and not args.no_cuda:
device = torch.device("cuda:{}".format(args.rank))
device = torch.device('cuda:{}'.format(args.rank))
else:
device = torch.device("cpu")
device = torch.device('cpu')
model = Net(device=device)
if distributed_is_initialized():
model.to(device)
model = DistributedDataParallel(model)
checkpoint_path = tempfile.gettempdir() + "/model.checkpoint"
if is_chief:
# All processes should see same parameters as they all start from same
# random parameters and gradients are synchronized in backward passes.
# Therefore, saving it in one process is sufficient.
torch.save(model.state_dict(), checkpoint_path)
print(f'Initial chief checkpoint is saved to {checkpoint_path}')
# Use a barrier() to make sure that process 1 loads the model after process
# 0 saves it.
if distributed_is_initialized():
distributed.barrier()
# configure map_location properly
map_location = {'cuda:%d' % 0: 'cuda:%d' % args.rank}
model.load_state_dict(torch.load(checkpoint_path, map_location=map_location))
model.load_state_dict(torch.load(checkpoint_path, map_location=device))
print(f'Initial chief checkpoint is saved to {checkpoint_path} with map_location {device}')
else:
model.load_state_dict(torch.load(checkpoint_path))
print(f'Initial chief checkpoint is loaded from {checkpoint_path}')
optimizer = torch.optim.Adam(model.parameters(), lr=args.learning_rate)
@@ -310,29 +332,12 @@ def main():
)
trainer.fit(args.epochs, is_chief, writer)
if is_chief and model_dir == local_model_dir:
utils.makedirs(model_dir)
if model_dir == local_model_dir:
makedirs(model_dir)
trainer.save(model_dir)
print(f'Model is saved to {model_dir}')
if is_chief and not args.local_mode:
utils.gcs_upload(
dir=model_dir,
local_dir=local_model_dir,
gcs_dir=args.model_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode,
)
print(f'Tensorboard logs are saved to: {tensorboard_log_dir}')
if is_chief and not args.local_mode:
utils.gcs_upload(
dir=tensorboard_log_dir,
local_dir=local_tensorboard_log_dir,
gcs_dir=args.tensorboard_log_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode,
)
writer.close()
@@ -1,31 +0,0 @@
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the \"License\");
# you may not use this file except in compliance with the License.\n",
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an \"AS IS\" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import os
import shutil
import subprocess
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def gcs_upload(dir, local_dir, gcs_dir, gcsfuse_ready, local_mode):
if not local_mode and dir == local_dir and not gcsfuse_ready:
subprocess.run(['gsutil', 'cp', '-r',
local_dir,
os.path.dirname(gcs_dir)])
print(f'{local_dir} is uploaded to {gcs_dir}')
return
@@ -16,6 +16,7 @@ import argparse
import copy
import os
import pathlib
import shutil
import time
import torch
@@ -24,8 +25,6 @@ from torch.utils.tensorboard import SummaryWriter
from torchvision import datasets, models, transforms
import utils
def parse_args():
parser = argparse.ArgumentParser()
@@ -62,6 +61,12 @@ def parse_args():
return args
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def download_data(data_dir):
dataset_url = 'https://download.pytorch.org/tutorial/hymenoptera_data.zip'
@@ -207,13 +212,17 @@ def main():
local_model_dir = './tmp/model'
local_tensorboard_log_dir = './tmp/logs'
#TODO: update when gcsfuse ready
gcsfuse_ready = False
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
model_dir = (gcsfuse_ready and args.model_dir) or local_model_dir
tensorboard_log_dir = (gcsfuse_ready and
args.tensorboard_log_dir) or local_tensorboard_log_dir
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
makedirs(model_dir)
writer = SummaryWriter(tensorboard_log_dir)
device = torch.device("cuda:0" if torch.cuda.is_available() else "cpu")
@@ -225,9 +234,6 @@ def main():
dataset_sizes = {x: len(image_datasets[x]) for x in ['train', 'val']}
print(f'Dataset sizes: {dataset_sizes}')
if model_dir == local_model_dir:
utils.makedirs(model_dir)
dataloaders = {
x: torch.utils.data.DataLoader(
image_datasets[x],
@@ -266,22 +272,8 @@ def main():
torch.save(model.state_dict(), model_path)
print(f'Model is saved to {model_dir}')
utils.gcs_upload(
dir=model_dir,
local_dir=local_model_dir,
gcs_dir=args.model_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode
)
print(f'Tensorboard logs are saved to: {tensorboard_log_dir}')
utils.gcs_upload(
dir=tensorboard_log_dir,
local_dir=local_tensorboard_log_dir,
gcs_dir=args.tensorboard_log_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode
)
writer.close()
@@ -1,31 +0,0 @@
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the \"License\");
# you may not use this file except in compliance with the License.\n",
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an \"AS IS\" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import os
import shutil
import subprocess
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def gcs_upload(dir, local_dir, gcs_dir, gcsfuse_ready, local_mode):
if not local_mode and dir == local_dir and not gcsfuse_ready:
subprocess.run(['gsutil', 'cp', '-r',
local_dir,
os.path.dirname(gcs_dir)])
print(f'{local_dir} is uploaded to {gcs_dir}')
return
@@ -1,507 +1,431 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d229c51d7335"
},
"source": [
"# PyTorch Image Classification Single GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "08b6ccb2de0f"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_single_gpu_with_vertex_sdk_and_torchserve/vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "410ef4707617"
},
"outputs": [],
"source": [
"content_name = \"pt-img-cls-gpu-cust-cont-torchserve\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ed102448ae75"
},
"source": [
"## Local Training"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "47dfe4e1dfe6"
},
"outputs": [],
"source": [
"! ls trainer"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "be6fcb587414"
},
"outputs": [],
"source": [
"! cat trainer/requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "060178a8ad71"
},
"outputs": [],
"source": [
"! pip install -r trainer/requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4421e56c4ee3"
},
"outputs": [],
"source": [
"! cat trainer/task.py"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4bb2f6fc75cc"
},
"outputs": [],
"source": [
"%run trainer/task.py --epochs 5 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cb748af8f2b8"
},
"outputs": [],
"source": [
"! ls ./tmp"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2ca1626c5dbd"
},
"outputs": [],
"source": [
"! rm -rf ./tmp"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "4eb55916219c"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "e61fc5c1b9e0"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c70a580cc6d4"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name_train = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri_train = f\"{hostname}/{PROJECT_ID}/{image_name_train}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e58c75158872"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri_train -f Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bde55966086a"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri_train --epochs 5 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f4a3cdb78045"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri_train"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "526115eabf35"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f026b57d265e"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "19c02e9e9b8d"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a0deece1086e"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1ec68e279ed1"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d945f0e32b02"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cb13cc82acc5"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d04453c214d2"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4b5b5dea03c8"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" \"--batch-size\",\n",
" \"256\",\n",
" \"--epochs\",\n",
" \"100\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b2073fb5824e"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri_train,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d442a02878d1"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "29b14f2289f3"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3ab127e5f2b2"
},
"source": [
"### Training Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8e0c74a00dee"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
}
}
},
{
"cell_type": "markdown",
"source": [
"# PyTorch Image Classification Single GPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_single_gpu_with_vertex_sdk_and_torchserve/vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
],
"metadata": {
"colab": {
"name": "vertex_training_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"pt-img-cls-gpu-cust-cont-torchserve\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Local Training"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! ls trainer"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cat trainer/requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r trainer/requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cat trainer/task.py"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"%run trainer/task.py --epochs 5 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! ls ./tmp"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! rm -rf ./tmp"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Build Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name_train = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri_train=f\"{hostname}/{PROJECT_ID}/{image_name_train}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri_train -f Dockerfile ."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri_train --epochs 5 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri_train"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" '--batch-size', '256',\n",
" '--epochs', '100',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri_train,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix\n"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,6 +1,6 @@
# PyTorch on Google Cloud: Text Classification
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
@@ -9,6 +9,7 @@ This tutorial on text classification shows how to train a PyTorch based text cla
| <h4>Notebook</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
## Folders
@@ -1,6 +1,7 @@
# Use pytorch GPU base image
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
# set working directory
WORKDIR /app
@@ -22,15 +22,18 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
# BUCKET_NAME: Change to your bucket name.
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# JOB_NAME: the name of your job running on AI Platform.
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# This can be a GCS location to a zipped and uploaded package
PACKAGE_PATH=./trainer
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
# or use the default '`us-central1`'. The region is where the job will be run.
REGION="us-central1"
@@ -41,11 +44,8 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
# IMAGE_TAG: an easily identifiable tag for your docker image
IMAGE_TAG=latest
# IMAGE_URI: the complete URI location for Cloud Container Registry
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
# Build the docker image
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
@@ -53,11 +53,19 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
# Deploy the docker image to Cloud Container Registry
docker push ${CUSTOM_TRAIN_IMAGE_URI}
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
Binary file not shown.

After

Width:  |  Height:  |  Size: 45 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 37 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 248 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 38 KiB

@@ -2,10 +2,13 @@
FROM pytorch/torchserve:latest-cpu
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
USER model-server
# copy model artifacts, custom handler and other dependencies
COPY ./custom_text_handler.py /home/model-server/
COPY ./custom_handler.py /home/model-server/
COPY ./index_to_name.json /home/model-server/
COPY ./model/finetuned-bert-classifier/ /home/model-server/
@@ -21,7 +24,7 @@ EXPOSE 7080
EXPOSE 7081
# create model archive file packaging model artifacts and dependencies
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
# run Torchserve HTTP serve to respond to prediction requests
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
@@ -0,0 +1,37 @@
FROM pytorch/torchserve:latest-cpu
USER root
# run and update some basic packages software packages, including security libs
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
# Install gcloud tools for gsutil as well as debugging
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
USER model-server
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
ARG MODEL_NAME=finetuned-bert-classifier
ENV MODEL_NAME="${MODEL_NAME}"
# health and prediction listener ports
ARG AIP_HTTP_PORT=7080
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
ARG MODEL_MGMT_PORT=7081
# expose health and prediction listener ports from the image
EXPOSE "${AIP_HTTP_PORT}"
EXPOSE "${MODEL_MGMT_PORT}"
EXPOSE 8080 8081 8082 7070 7071
# create torchserve configuration file
USER root
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
USER model-server
# run Torchserve HTTP serve to respond to prediction requests
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
@@ -52,7 +52,8 @@ class TransformersClassifierHandler(BaseHandler):
with open(mapping_file_path) as f:
self.mapping = json.load(f)
else:
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
logger.warning('Missing the index_to_name.json file. Inference output will default.')
self.mapping = {"0": "Negative", "1": "Positive"}
self.initialized = True
@@ -88,4 +89,3 @@ class TransformersClassifierHandler(BaseHandler):
def postprocess(self, inference_output):
return inference_output
@@ -19,13 +19,19 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
# BUCKET_NAME: Change to your bucket name
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# The PyTorch image provided by Vertex AI Training.
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
# JOB_NAME: the name of your job running on Vertex AI.
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
@@ -35,19 +41,21 @@ REGION="us-central1"
# JOB_DIR: Where to store prepared package and upload output model.
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
executor-image-uri=${IMAGE_URI},\
python-module=trainer.task,\
local-package-path=../python_package/"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--python-package-uris=${PACKAGE_PATH} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
@@ -122,6 +122,9 @@ def run(args):
# Train / Test the model
trainer = train(args, text_classifier, train_dataset, test_dataset)
metrics = trainer.evaluate(eval_dataset=test_dataset)
trainer.save_metrics("all", metrics)
# Export the trained model
trainer.save_model(os.path.join("/tmp", args.model_name))
@@ -63,20 +63,20 @@
"- [Training](#Training)\n",
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
"- [Tuning](#Hyperparameter-Tuning) \n",
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
"- [Deploying](#Deploying)\n",
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
"\n",
"### Costs \n",
"\n",
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
"\n",
"* [Notebooks](https://cloud.google.com/notebooks)\n",
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Cloud Storage](https://cloud.google.com/storage)\n",
"* [Container Registry](https://cloud.google.com/container-registry)\n",
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
@@ -202,9 +202,9 @@
"id": "e0c1dcadc2c8"
},
"source": [
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"\n",
"#### Install Vertex SDK for Python"
"#### Install Vertex AI SDK for Python"
]
},
{
@@ -1199,7 +1199,7 @@
"source": [
"### Run predictions locally with sample examples\n",
"\n",
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
]
},
{
@@ -1382,7 +1382,7 @@
"id": "f7466d414a0e"
},
"source": [
"### Run Custom Job on Vertex Training with a pre-built container"
"### Run Custom Job on Vertex AI Training with a pre-built container"
]
},
{
@@ -1395,7 +1395,7 @@
"\n",
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
"\n",
"![Training with Prebuilt Containers on Vertex Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
"![Training with Prebuilt Containers on Vertex AI Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
]
},
{
@@ -1569,7 +1569,7 @@
"source": [
"#### **Run custom training job on Vertex AI**\n",
"\n",
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
]
},
{
@@ -1578,7 +1578,7 @@
"id": "5d2957ef04fd"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1598,7 +1598,7 @@
"id": "6b0fed34b728"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**"
"##### **Configure and submit Custom Job to Vertex AI Training service**"
]
},
{
@@ -1609,7 +1609,7 @@
"source": [
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
]
},
{
@@ -1686,7 +1686,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job.png)"
]
},
{
@@ -1798,7 +1798,7 @@
"id": "c170d386492b"
},
"source": [
"### Run Custom Job on Vertex Training with custom container"
"### Run Custom Job on Vertex AI Training with custom container"
]
},
{
@@ -1807,7 +1807,7 @@
"id": "035227b6e581"
},
"source": [
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
"\n",
"![Training with custom containers on Vertex AI](./images/training-with-custom-containers-on-vertex-training.png)"
]
@@ -1834,7 +1834,7 @@
"%%writefile ./custom_container/Dockerfile\n",
"\n",
"# Use pytorch GPU base image\n",
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
"\n",
"# set working directory\n",
"WORKDIR /app\n",
@@ -1968,7 +1968,7 @@
"id": "a23e5e34bea9"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1988,11 +1988,11 @@
"id": "abf1fa4085cb"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**\n",
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
"\n",
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
]
},
{
@@ -2044,7 +2044,7 @@
},
"outputs": [],
"source": [
"# submit the custom job to Vertex training service\n",
"# submit the custom job to Vertex AI training service\n",
"model = job.run(\n",
" replica_count=1,\n",
" machine_type=\"n1-standard-8\",\n",
@@ -2065,7 +2065,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job-container.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job-container.png)"
]
},
{
@@ -2148,11 +2148,11 @@
"id": "ba6122f929e3"
},
"source": [
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
"\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"\n",
"![Hyperparameter Tuning with Custom Containers on Vertex Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
"![Hyperparameter Tuning with Custom Containers on Vertex AI Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
]
},
{
@@ -2163,7 +2163,7 @@
"source": [
"### How hyperparameter tuning works in Vertex AI?\n",
"\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
"\n",
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
@@ -2297,7 +2297,7 @@
"source": [
"### Run Hyperparameter Tuning Job on Vertex AI\n",
"\n",
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
]
},
{
@@ -2326,7 +2326,7 @@
"id": "f60fab07d67c"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -2346,7 +2346,7 @@
"id": "6652aa63ddff"
},
"source": [
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
"\n",
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
"\n",
@@ -2374,7 +2374,7 @@
"id": "9d46db3a8b23"
},
"source": [
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
]
},
{
@@ -2548,7 +2548,7 @@
"\n",
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor hyperparameter tuning job progress in Vertex Training](./images/vertex-training-monitor-hptuning-job-container.png)"
"![Monitor hyperparameter tuning job progress in Vertex AI Training](./images/vertex-training-monitor-hptuning-job-container.png)"
]
},
{
@@ -2557,7 +2557,7 @@
"id": "ba934b434f03"
},
"source": [
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
]
},
{
@@ -2612,7 +2612,7 @@
"id": "5dbccb2b7d32"
},
"source": [
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
]
},
{
@@ -2701,8 +2701,8 @@
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
"\n",
"# BUCKET_NAME: Change to your bucket name\n",
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
"# BUCKET_NAME is a required parameter to run the cell.\n",
"BUCKET_NAME=$1\n",
"\n",
"# APP_NAME: get application name\n",
"APP_NAME=$2\n",
@@ -2711,7 +2711,7 @@
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
"\n",
"# custom container image URI\n",
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"\n",
"# ========================================================\n",
"# create hyperparameter tuning configuration file\n",
@@ -2772,20 +2772,20 @@
"source": [
"## Deploying\n",
"\n",
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
"\n",
"### Deploying model on Vertex Predictions with custom container\n",
"### Deploying model on Vertex AI Predictions with custom container\n",
"\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
"\n",
"![Serving with Custom Containers on Vertex Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"![Serving with Custom Containers on Vertex AI Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"\n",
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
"\n",
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
]
},
{
@@ -2815,7 +2815,7 @@
},
"outputs": [],
"source": [
"%%writefile predictor/custom_text_handler.py\n",
"%%writefile predictor/custom_handler.py\n",
"\n",
"import os\n",
"import json\n",
@@ -2870,7 +2870,8 @@
" with open(mapping_file_path) as f:\n",
" self.mapping = json.load(f)\n",
" else:\n",
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
"\n",
" self.initialized = True\n",
"\n",
@@ -3047,10 +3048,13 @@
"FROM pytorch/torchserve:latest-cpu\n",
"\n",
"# install dependencies\n",
"RUN python3 -m pip install --upgrade pip\n",
"RUN pip3 install transformers\n",
"\n",
"USER model-server\n",
"\n",
"# copy model artifacts, custom handler and other dependencies\n",
"COPY ./custom_text_handler.py /home/model-server/\n",
"COPY ./custom_handler.py /home/model-server/\n",
"COPY ./index_to_name.json /home/model-server/\n",
"COPY ./model/$APP_NAME/ /home/model-server/\n",
"\n",
@@ -3070,7 +3074,7 @@
" --model-name=$APP_NAME \\\n",
" --version=1.0 \\\n",
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
" --handler=/home/model-server/custom_text_handler.py \\\n",
" --handler=/home/model-server/custom_handler.py \\\n",
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
" --export-path=/home/model-server/model-store\n",
"\n",
@@ -3129,7 +3133,7 @@
"source": [
"#### **Run the container locally** ***[Optional]***\n",
"\n",
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
]
},
{
@@ -3267,9 +3271,9 @@
"id": "69477b3a00c0"
},
"source": [
"#### **Deploying the serving container to Vertex Predictions**\n",
"#### **Deploying the serving container to Vertex AI Predictions**\n",
"\n",
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
]
},
{
@@ -3300,7 +3304,7 @@
"id": "a3da91e19af4"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -3437,7 +3441,7 @@
"id": "bc4673478269"
},
"source": [
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
]
},
{
@@ -3487,7 +3491,7 @@
"source": [
"##### **Formatting input for online prediction**\n",
"\n",
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
"\n",
"```\n",
"[\n",
@@ -3560,9 +3564,9 @@
},
"source": [
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"\n",
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
]
},
{
@@ -3653,12 +3657,12 @@
},
"outputs": [],
"source": [
"delete_custom_job = True\n",
"delete_hp_tuning_job = True\n",
"delete_custom_job = False\n",
"delete_hp_tuning_job = False\n",
"delete_endpoint = True\n",
"delete_model = True\n",
"delete_bucket = True\n",
"delete_image = True"
"delete_model = False\n",
"delete_bucket = False\n",
"delete_image = False"
]
},
{
@@ -3686,7 +3690,7 @@
"\n",
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
"\n",
"# Initialize Vertex SDK\n",
"# Initialize Vertex AI SDK\n",
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
]
},
@@ -3924,7 +3928,7 @@
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" print(\n",
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
" )\n",
@@ -3932,7 +3936,7 @@
" # uncomment below line to delete contents of the bucket\n",
" # ! gsutil rm -r $BUCKET_NAME\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" if float(shell_output[0].split()[0]) > 0:\n",
" print(\n",
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
@@ -0,0 +1,28 @@
# Train and deploy a scikit-learn model with Vertex AI
This repository shows how to train and deploy a text classifier using scikit-learn and Vertex AI.
The main used Vertex AI features are:
- Vertex AI Custom Training
- Vertex AI Model
- Vertex AI Endpoint
Further used GCP services are:
- Google Cloud Logging
- Google Cloud Storage
## Repository
├── README.md
├── create_job.ipynb # <-- creates the training job and deploys the model
├── requirements.txt # <-- requirements for deploying the job
└── task.py # <-- contains the training application
## Training job overview
The training job performs the following steps:
1. Downloads the `NewsAggregator` dataset from the UCI Machine Learning Repository
2. Trains and evaluates a classifier using scikit-learn
3. Exports model and evaluation artifacts to GCS
4. Deploys the model as a `Vertex AI Endpoint`
@@ -0,0 +1,290 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "72b875d67303"
},
"source": [
"# Create and run a custom Vertex AI Training Job from a local script"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "398b976f501e"
},
"source": [
"## Install Vertex AI Python Client"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2162adc1d8fe"
},
"outputs": [],
"source": [
"!pip install -r requirements.txt --upgrade"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d4bf4ab70e65"
},
"source": [
"## GCP authentication"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "41084de2e96a"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"os.environ[\n",
" \"GOOGLE_APPLICATION_CREDENTIALS\"\n",
"] = \"\" # TODO: path to credentials .json file"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1ce7efb99a95"
},
"source": [
"## Create the custom Vertex AI Training Job\n",
"\n",
"1. Define the custom job parameters\n",
"2. Submit the job to create a `Vertex AI Model`"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c04b9efb5eb3"
},
"outputs": [],
"source": [
"# Import the Vertex AI SDK (Python Client)\n",
"from google.cloud import aiplatform"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b56f5fdcefd6"
},
"outputs": [],
"source": [
"# Project meta data\n",
"PROJECT_ID = \"\" # TODO\n",
"REGION = \"\" # TODO e.g. europe\n",
"ZONE = \"\" # TODO e.g. west4\n",
"LOCATION = f\"{REGION}-{ZONE}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4af8cfb1e1a1"
},
"outputs": [],
"source": [
"aiplatform.init(project=PROJECT_ID, location=LOCATION)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e23d0161b489"
},
"outputs": [],
"source": [
"# Variables for specifying the job\n",
"DISPLAY_NAME = (\n",
" \"news-classifier-training\" # TODO: How the job is displayed on Vertex AI GUI\n",
")\n",
"SCRIPT_PATH = \"./task.py\" # Path to local training script\n",
"STAGING_BUCKET = (\n",
" \"\" # TODO GCS URI where meta data and artifacts are stored for this job\n",
")\n",
"MODEL_TRAINING_IMAGE = f\"{REGION}-docker.pkg.dev/vertex-ai/training/scikit-learn-cpu.0-23:latest\" # Pre-built training image\n",
"REQUIREMENTS = [\"wget\"] # Additional requirements not already part of the base image\n",
"# !Required if the Training Pipeline produces a managed Vertex AI Model!\n",
"MODEL_SERVING_IMAGE = f\"{REGION}-docker.pkg.dev/vertex-ai/prediction/sklearn-cpu.0-23:latest\" # Pre-built serving image"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "61565ec3e6de"
},
"outputs": [],
"source": [
"# Job definition\n",
"custom_training_job = aiplatform.CustomTrainingJob(\n",
" project=PROJECT_ID,\n",
" location=LOCATION,\n",
" display_name=DISPLAY_NAME,\n",
" script_path=SCRIPT_PATH,\n",
" staging_bucket=STAGING_BUCKET,\n",
" container_uri=MODEL_TRAINING_IMAGE,\n",
" requirements=REQUIREMENTS,\n",
" model_serving_container_image_uri=MODEL_SERVING_IMAGE,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8c8d4bd78688"
},
"outputs": [],
"source": [
"# Variables for running the job\n",
"MACHINE_TYPE = \"n1-standard-4\" # Standard VM with 4 CPUs\n",
"# !Required if the Training Pipeline produces a managed Vertex AI Model!\n",
"MODEL_DISPLAY_NAME = (\n",
" \"news-classifier-model\" # TODO: Name for the resulting managed Vertex AI Model.\n",
")\n",
"# Note that a single job may produce multiple models (e.g. one per run).\n",
"# The url to download the training data from.\n",
"DATASET_URL = \"https://archive.ics.uci.edu/ml/machine-learning-databases/00359/NewsAggregatorDataset.zip\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "13d31a7d0bb5"
},
"outputs": [],
"source": [
"# Run the job\n",
"model = custom_training_job.run(\n",
" machine_type=MACHINE_TYPE,\n",
" model_display_name=MODEL_DISPLAY_NAME,\n",
" args=[f\"--dataset_url={DATASET_URL}\", f\"--project_id={PROJECT_ID}\"],\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8026ac119722"
},
"outputs": [],
"source": [
"MODEL_RESOURCE_NAME = model.resource_name"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2d985fca37f3"
},
"source": [
"## Deploy model to Vertex AI Endpoint\n",
"\n",
"1. Retrieve the registered `Vertex AI Model`\n",
"2. Deploy the model to a new `Vertex AI Endpoint`\n",
"3. Get some test predictions from the endpoint"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "58c08631f94c"
},
"outputs": [],
"source": [
"ENDPOINT_DISPLAY_NAME = \"news-classifier-endpoint\" # TODO\n",
"MACHINE_TYPE_SERVING = \"n1-standard-2\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b54867240880"
},
"outputs": [],
"source": [
"endpoint = aiplatform.Endpoint.create(\n",
" display_name=ENDPOINT_DISPLAY_NAME,\n",
" location=LOCATION,\n",
" project=PROJECT_ID,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a76e7c721b88"
},
"outputs": [],
"source": [
"model = aiplatform.Model(model_name=MODEL_RESOURCE_NAME)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d06714302f81"
},
"outputs": [],
"source": [
"model.deploy(\n",
" endpoint=endpoint,\n",
" deployed_model_display_name=MODEL_DISPLAY_NAME,\n",
" machine_type=MACHINE_TYPE,\n",
" traffic_percentage=100,\n",
" min_replica_count=1,\n",
" max_replica_count=1,\n",
" accelerator_type=None,\n",
" accelerator_count=None,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "5b7eca31d80e"
},
"outputs": [],
"source": [
"endpoint.predict(instances={\"instances\": [\"A news headline to be classified\"]})"
]
}
],
"metadata": {
"colab": {
"name": "create_job.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,2 @@
google-cloud-aiplatform
ipykernel
@@ -0,0 +1,167 @@
import argparse
import logging
import os
import pickle
import zipfile
from typing import List, Tuple
import pandas as pd
import wget
from google.cloud import storage
from google.cloud.logging import Client as LogClient
from sklearn.feature_extraction.text import CountVectorizer, TfidfTransformer
from sklearn.model_selection import train_test_split
from sklearn.naive_bayes import MultinomialNB
from sklearn.pipeline import Pipeline
def download_dataset_from_url(url: str) -> pd.DataFrame:
"""Downloads and unzips the dataset from `url` and reads it with pandas.
Args:
url (str, optional): URL to the dataset.
"""
zip_filepath = wget.download(url, out=".")
with zipfile.ZipFile(zip_filepath, "r") as zf:
zf.extract(path=".", member="newsCorpora.csv")
COLUMN_NAMES = ["id", "title", "url", "publisher",
"category", "story", "hostname", "timestamp"]
return pd.read_csv(
"newsCorpora.csv", delimiter="\t", names=COLUMN_NAMES, index_col=0
)
def get_train_test_data(dataframe: pd.DataFrame, test_size: float = 0.2
) -> Tuple[List, List, List, List]:
"""Splits the news dataset into train and test features and labels.
Args:
news (pd.DataFrame): The dataset as pandas DataFrame.
test_size (float): The size in percent of the test data.
Returns:
Tuple[List, List, List, List]: Tuple with train and test data
"""
train, test = train_test_split(dataframe, test_size=test_size)
x_train, y_train = train["title"].values, train["category"].values
x_test, y_test = test["title"].values, test["category"].values
return x_train, y_train, x_test, y_test
def export_model_to_gcs(fitted_pipeline: Pipeline, gcs_uri: str) -> str:
"""Exports trained pipeline to GCS
Parameters:
fitted_pipeline (sklearn.pipelines.Pipeline): the Pipeline object
with data already fitted (trained pipeline object).
gcs_uri (str): GCS path to store the trained pipeline
i.e gs://example_bucket/training-job.
Returns:
export_path (str): Model GCS location
"""
artifact_filename = 'model.pkl'
# Save model artifact to local filesystem (doesn't persist)
local_path = artifact_filename
with open(local_path, 'wb') as model_file:
pickle.dump(fitted_pipeline, model_file)
# Upload model artifact to Cloud Storage
storage_path = os.path.join(gcs_uri, artifact_filename)
blob = storage.blob.Blob.from_string(storage_path, client=storage.Client())
blob.upload_from_filename(local_path)
def export_evaluation_report_to_gcs(report: str, gcs_uri: str) -> None:
"""
Exports training job report to GCS
Parameters:
report (str): Full report in text to sent to GCS
gcs_uri (str): GCS path to store the report
i.e gs://example_bucket/training-job
"""
artifact_filename = 'report.txt'
# Upload model artifact to Cloud Storage
storage_path = os.path.join(gcs_uri, artifact_filename)
blob = storage.blob.Blob.from_string(storage_path, client=storage.Client())
blob.upload_from_string(report)
def train_and_score(X_train: List, y_train: List, X_test: List, y_test: List
) -> Tuple[Pipeline, float]:
"""Trains and cross-validates a text classifier pipeline.
Args:
X_train (List): Train features as list of strings.
y_train (List): Train labels as list of strings.
X_test (List): Test labels as list of strings.
y_test (List): Test labels as list of strings.
Returns:
Tuple[Pipeline, float]: Fitted pipeline and mean accuracy.
"""
pipeline = Pipeline([
("vectorizer", CountVectorizer()),
("tfidf", TfidfTransformer()),
("naivebayes", MultinomialNB()),
])
pipeline.fit(X_train, y_train)
score = pipeline.score(X_test, y_test)
return pipeline, score
# Define all the command line arguments your model can accept for training
if __name__ == "__main__":
parser = argparse.ArgumentParser()
parser.add_argument(
"--dataset_url",
help="Download url for the training data.",
type=str
)
parser.add_argument(
"--project_id",
help="GCP project id for cloud logging.",
type=str
)
args = parser.parse_args()
arguments = args.__dict__
# set up the GCP logger
client = LogClient(project=arguments["project_id"])
client.setup_logging(log_level=logging.INFO)
logging.info("Starting custom training job.")
# download the data from url
logging.info("Downloading training data from: {}".format(arguments["dataset_url"]))
dataframe = download_dataset_from_url(arguments["dataset_url"])
train_test_data = get_train_test_data(dataframe)
# train and cross validate
logging.info("Training started ...")
model, score = train_and_score(*train_test_data)
logging.info(f"Training completed with model score: {score}")
# export model to gcs
_gcs_uri = os.environ["AIP_MODEL_DIR"]
logging.info("Exporting model artifacts ...")
export_model_to_gcs(model, _gcs_uri)
export_evaluation_report_to_gcs(str(score), _gcs_uri)
logging.info(f"Exported model artifacts to GCS bucket: {_gcs_uri}")
@@ -188,11 +188,14 @@
},
"outputs": [],
"source": [
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
"! pip3 install {USER_FLAG} --upgrade kfp\n",
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow"
"! pip3 install {USER_FLAG} numpy\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
"! pip3 install {USER_FLAG} --upgrade pillow\n",
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
"! pip3 install {USER_FLAG} --upgrade fastapi"
]
},
{
@@ -287,7 +290,7 @@
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
@@ -518,6 +521,7 @@
"import os\n",
"import sys\n",
"\n",
"from google.cloud import aiplatform\n",
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"from kfp.v2 import compiler, dsl\n",
"from kfp.v2.google.client import AIPlatformClient"
@@ -561,13 +565,34 @@
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
"id": "895ac243c125"
},
"outputs": [],
"source": [
"# Dataset parameters\n",
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
"\n",
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "62bfb9a820f6"
},
"outputs": [],
"source": [
"# Download the sample data into your RAW_DATA_PATH\n",
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
},
"outputs": [],
"source": [
"# Pipeline parameters\n",
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
@@ -635,7 +660,7 @@
"source": [
"#### Run unit tests on the Generator component\n",
"\n",
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
]
},
{
@@ -713,12 +738,12 @@
"TRAINING_ARTIFACTS_DIR = (\n",
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
")\n",
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
"TRAINING_MACHINE_TYPE = (\n",
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
")\n",
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -769,8 +794,12 @@
"TRAINED_POLICY_DISPLAY_NAME = (\n",
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
")\n",
"TRAFFIC_SPLIT = {\"0\": 100}\n",
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -900,16 +929,17 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
"from kfp.components import load_component_from_url\n",
"\n",
"generate_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
")\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -978,7 +1008,7 @@
" bigquery_location=bigquery_location,\n",
" bigquery_table_id=bigquery_table_id,\n",
" )\n",
"\n",
" \n",
" # Run the Ingester component.\n",
" ingest_task = ingest_op(\n",
" project_id=project_id,\n",
@@ -988,7 +1018,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -996,28 +1035,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1034,11 +1055,14 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" traffic_split=TRAFFIC_SPLIT,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -1053,12 +1077,11 @@
"# Compile the authored pipeline.\n",
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
"\n",
"# Createa Vertex AI client.\n",
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
"\n",
"# Create a pipeline run job.\n",
"response = api_client.create_run_from_job_spec(\n",
" job_spec_path=PIPELINE_SPEC_PATH,\n",
"job = aiplatform.PipelineJob(\n",
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
" template_path=PIPELINE_SPEC_PATH,\n",
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" # Pipeline configs\n",
" \"project_id\": PROJECT_ID,\n",
@@ -1070,7 +1093,9 @@
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
" },\n",
" enable_caching=ENABLE_CACHING,\n",
")"
")\n",
"\n",
"job.run()"
]
},
{
@@ -1111,7 +1136,11 @@
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
")"
")\n",
"# TF-Agents RL configs\n",
"BATCH_SIZE = 8\n",
"RANK_K = 20\n",
"NUM_ACTIONS = 20"
]
},
{
@@ -1221,7 +1250,7 @@
},
"outputs": [],
"source": [
"endpoints = ! gcloud beta ai endpoints list \\\n",
"endpoints = ! gcloud ai endpoints list \\\n",
" --region=$REGION \\\n",
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
"print(\"\\n\".join(endpoints), \"\\n\")\n",
@@ -1424,13 +1453,11 @@
},
"outputs": [],
"source": [
"from kfp.components import load_component_from_url\n",
"\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -1481,7 +1508,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -1489,28 +1525,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1527,11 +1545,13 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -39,14 +39,15 @@ outputs:
- {name: bigquery_table_id, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
- sh
- -ec
- |
@@ -296,7 +297,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -20,7 +20,7 @@ outputs:
- {name: tfrecord_file, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
@@ -187,7 +187,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -1,3 +1,4 @@
google-cloud-bigquery==2.20.0
tensorflow==2.5.0
tensorflow==2.7.2
pillow==9.0.1
tf-agents==0.8.0
@@ -1,2 +1,4 @@
google-cloud-pubsub==2.5.0
pillow==9.0.1
tf-agents==0.8.0
tensorflow==2.5.0
tensorflow==2.7.2
@@ -0,0 +1,5 @@
dataclasses==0.6
google-cloud-aiplatform==1.8.1
tensorflow==2.7.2
pillow==9.0.1
tf-agents==0.8.0
@@ -27,14 +27,14 @@ outputs:
- {name: training_artifacts_dir, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
- sh
- -ec
- |
@@ -270,7 +270,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -22,13 +22,13 @@ from src.training import task
# Paths and configurations
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
"[your-file-name].json") # FILL IN
"result.json") # FILL IN
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
# Hyperparameters
@@ -1,423 +1,363 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ac14831de120"
},
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on CPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1f2615ea7930"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_cpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b9b9229d7bc4"
},
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-cpu-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "070e602ded80"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "99b9c8546a46"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f5196e294db6"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "723478af31e6"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f cpu.Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "66ac893a871b"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d131ee61bfca"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bc5682081ee8"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8b9c18d51ddf"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cfee2f165779"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b542a33f1782"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a0f25261a58c"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "abacc13094c9"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77ca3177b71e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f1733451a790"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0d5e38fade0a"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"\n",
"container_args = [\n",
" \"--epochs\",\n",
" \"50\",\n",
" \"--batch-size\",\n",
" \"32\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "23ceccc746f5"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "469599f8b676"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e35aa8a39a11"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "40118a4bb0de"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6d414dfc4585"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77cd165390f9"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "9b73b8cb646d"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
}
},
{
"cell_type": "markdown",
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on CPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_cpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
],
"metadata": {
"colab": {
"name": "multi_worker_vertex_training_on_cpu_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-cpu-cust-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Build Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri=f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f cpu.Dockerfile ."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"\n",
"container_args = [\n",
" '--epochs', '50',\n",
" '--batch-size', '32',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,427 +1,367 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "e8fc31cbf9f6"
},
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5825c076e0f8"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_gpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a5f0c3700b8e"
},
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-gpu-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "070e602ded80"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "99b9c8546a46"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f5196e294db6"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c24b9a97df06"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f gpu.Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "66ac893a871b"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d131ee61bfca"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bc5682081ee8"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8b9c18d51ddf"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cfee2f165779"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b542a33f1782"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a0f25261a58c"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "abacc13094c9"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77ca3177b71e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f1733451a790"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3e29b50a65d3"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" \"--epochs\",\n",
" \"50\",\n",
" \"--batch-size\",\n",
" \"32\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "23ceccc746f5"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "239e58fe141d"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e35aa8a39a11"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "40118a4bb0de"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6d414dfc4585"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77cd165390f9"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "9b73b8cb646d"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
}
},
{
"cell_type": "markdown",
"source": [
"# TF-Keras Image Classification Distributed Multi-Worker Training on GPU using Vertex Training with Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_image_classification_distributed_multi_worker_with_vertex_sdk/multi_worker_vertex_training_on_gpu_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
],
"metadata": {
"colab": {
"name": "multi_worker_vertex_training_on_gpu_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"tf-keras-img-cls-dist-multi-worker-gpu-cust-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Build Custom Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri=f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f gpu.Dockerfile ."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 2 --local-mode"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%% md\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 1\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"container_args = [\n",
" '--epochs', '50',\n",
" '--batch-size', '32',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=container_args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1 +1 @@
tensorflow==2.4.1
tensorflow==2.7.2
@@ -123,7 +123,16 @@ def main():
model_dir = args.model_dir or local_model_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
checkpoint_dir = local_checkpoint_dir
checkpoint_dir = args.checkpoint_dir or local_checkpoint_dir
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
if checkpoint_dir and checkpoint_dir.startswith(gs_prefix):
checkpoint_dir = checkpoint_dir.replace(gs_prefix, gcsfuse_prefix)
num_worker, task_type, task_id = distribution_utils.setup()
print(f'task_type: {task_type}, '
@@ -21,7 +21,6 @@ from tensorflow.keras import layers, losses
from tensorflow.keras.layers.experimental.preprocessing import TextVectorization
import distribution_utils
import utils
VOCAB_SIZE = 10000
MAX_SEQUENCE_LENGTH = 250
@@ -175,13 +174,18 @@ def main():
local_checkpoint_dir = './tmp/checkpoints'
local_tensorboard_log_dir = './tmp/logs'
#TODO: update when gcsfuse ready
gcsfuse_ready = False
model_dir = args.model_dir or local_model_dir
checkpoint_dir = (gcsfuse_ready and
args.checkpoint_dir) or local_checkpoint_dir
tensorboard_log_dir = args.tensorboard_log_dir or local_tensorboard_log_dir
checkpoint_dir = args.checkpoint_dir or local_checkpoint_dir
gs_prefix = 'gs://'
gcsfuse_prefix = '/gcs/'
if model_dir and model_dir.startswith(gs_prefix):
model_dir = model_dir.replace(gs_prefix, gcsfuse_prefix)
if tensorboard_log_dir and tensorboard_log_dir.startswith(gs_prefix):
tensorboard_log_dir = tensorboard_log_dir.replace(gs_prefix, gcsfuse_prefix)
if checkpoint_dir and checkpoint_dir.startswith(gs_prefix):
checkpoint_dir = checkpoint_dir.replace(gs_prefix, gcsfuse_prefix)
class_names = ['csharp', 'java', 'javascript', 'python']
class_indices = dict(zip(class_names, range(len(class_names))))
@@ -278,13 +282,6 @@ def main():
print(f'Tensorboard logs are saved to: {tensorboard_log_dir}')
print(f'Checkpoints are saved to: {checkpoint_dir}')
utils.gcs_upload(
dir=checkpoint_dir,
local_dir=local_checkpoint_dir,
gcs_dir=args.checkpoint_dir,
gcsfuse_ready=gcsfuse_ready,
local_mode=args.local_mode
)
return
@@ -1,31 +0,0 @@
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# https://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import os
import shutil
import subprocess
def makedirs(model_dir):
if os.path.exists(model_dir) and os.path.isdir(model_dir):
shutil.rmtree(model_dir)
os.makedirs(model_dir)
return
def gcs_upload(dir, local_dir, gcs_dir, gcsfuse_ready, local_mode):
if not local_mode and dir == local_dir and not gcsfuse_ready:
subprocess.run(['gsutil', 'cp', '-r',
local_dir,
os.path.dirname(gcs_dir)])
print(f'{local_dir} is uploaded to {gcs_dir}')
return
@@ -1,437 +1,380 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "745ff8aea147"
},
"source": [
"# TF-Keras Text Classification Distributed Single Worker GPUs using Vertex Training with Local Mode Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a20c6440f341"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_text_classification_distributed_single_worker_gpus_with_gcloud_local_run_and_vertex_sdk/vertex_training_with_local_mode_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "1c71d07625f5"
},
"outputs": [],
"source": [
"content_name = \"tf-keras-txt-cls-dist-single-worker-gpus-local-mode-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "378392e0adb9"
},
"source": [
"## Local Training with Vertex Local Mode and Auto Packaging"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "05f8e4885312"
},
"outputs": [],
"source": [
"BASE_IMAGE_URI = \"us-docker.pkg.dev/vertex-ai/training/tf-gpu.2-5:latest\"\n",
"SCRIPT_PATH = \"trainer/task.py\"\n",
"OUTPUT_IMAGE_NAME = \"gcr.io/{}/{}:latest\".format(PROJECT_ID, content_name)\n",
"ARGS = \"--epochs 5 --batch-size 16 --local-mode\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b45a98212ef5"
},
"outputs": [],
"source": [
"! gcloud ai custom-jobs local-run \\\n",
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
" $ARGS"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cbd77cb4193c"
},
"source": [
"## Vertex Training using Vertex SDK and Vertex Local Mode Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "c8b69c5e3dd4"
},
"source": [
"### Container Built by Vertex Local Mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4869e0d1657b"
},
"outputs": [],
"source": [
"custom_container_image_uri = OUTPUT_IMAGE_NAME"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d53296526bde"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "eb193581654a"
},
"outputs": [],
"source": [
"! gcloud container images list --repository \"gcr.io\"/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f5b907c91ea6"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fbfec07eaea4"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8fcf24c75bcd"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b68b79268025"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "7577c86757ab"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2a327cb1722d"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2e1069a8f7e2"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d7f0043d3e9b"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-8\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_P100\"\n",
"\n",
"args = [\n",
" \"--epochs\",\n",
" \"100\",\n",
" \"--batch-size\",\n",
" \"128\",\n",
" \"--num-gpus\",\n",
" f\"{accelerator_count}\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "69c88c73bb5d"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "947dd755cdc8"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "703e297f83fe"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d459452eca40"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d02a5890a4af"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "545fe0dbe7c4"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b86c0fe8028e"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
}
},
{
"cell_type": "markdown",
"source": [
"# TF-Keras Text Classification Distributed Single Worker GPUs using Vertex Training with Local Mode Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/tf_keras_text_classification_distributed_single_worker_gpus_with_gcloud_local_run_and_vertex_sdk/vertex_training_with_local_mode_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"## Setup"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
],
"metadata": {
"colab": {
"name": "vertex_training_with_local_mode_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"content_name = \"tf-keras-txt-cls-dist-single-worker-gpus-local-mode-cont\""
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Local Training with Vertex Local Mode and Auto Packaging"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"BASE_IMAGE_URI = 'us-docker.pkg.dev/vertex-ai/training/tf-gpu.2-5:latest'\n",
"SCRIPT_PATH = 'trainer/task.py'\n",
"OUTPUT_IMAGE_NAME = 'gcr.io/{}/{}:latest'.format(PROJECT_ID, content_name)\n",
"ARGS = '--epochs 5 --batch-size 16 --local-mode'"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud beta ai custom-jobs local-run \\\n",
" --base-image=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
" $ARGS"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Vertex Training using Vertex SDK and Vertex Local Mode Container"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Container Built by Vertex Local Mode"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_image_uri = OUTPUT_IMAGE_NAME"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gcloud container images list --repository \"gcr.io\"/$PROJECT_ID"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Initialize Vertex SDK"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! pip install -r requirements.txt"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Create a Vertex Tensorboard Instance"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "markdown",
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"machine_type = \"n1-standard-8\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_P100\"\n",
"\n",
"args = [\n",
" '--epochs', '100',\n",
" '--batch-size', '128',\n",
" '--num-gpus', f'{accelerator_count}',\n",
"]"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" machine_type=machine_type,\n",
" accelerator_type=accelerator_type,\n",
" accelerator_count=accelerator_count,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"print(f'Custom Training Job Name: {custom_container_training_job.resource_name}')\n",
"print(f'GCS Output URI Prefix: {gcs_output_uri_prefix}')"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"### Training Output Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
},
{
"cell_type": "markdown",
"source": [
"## Clean Up Artifact"
],
"metadata": {
"collapsed": false
}
},
{
"cell_type": "code",
"execution_count": null,
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
],
"metadata": {
"collapsed": false,
"pycharm": {
"name": "#%%\n"
}
}
}
],
"metadata": {
"kernelspec": {
"display_name": "Python 3",
"language": "python",
"name": "python3"
},
"language_info": {
"codemirror_mode": {
"name": "ipython",
"version": 2
},
"file_extension": ".py",
"mimetype": "text/x-python",
"name": "python",
"nbconvert_exporter": "python",
"pygments_lexer": "ipython2",
"version": "2.7.6"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
"nbformat": 4,
"nbformat_minor": 0
}
-28
View File
@@ -1,28 +0,0 @@
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence,
# Our Global Owners: @andrewferlitsch @aribray @dizcology @ivanmkc @morgandu @telpirion @vinnysenthil
* @GoogleCloudPlatform/cloudml-samples-owners
# Notebooks
/notebooks @ivanmkc
# Official Notebooks
notebooks/official/model_monitoring/model_monitoring.ipynb @mco-gh
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-custom-jobs.ipynb @jialuzh
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb @jialuzh
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb @halio-g
notebooks/official/feature_store/gapic-feature-store.ipynb @protorganizer
# Community Notebooks
/notebooks/community/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
# Community Content
/community-content @morgandu
/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/community-content/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
# Official Community Content
-93
View File
@@ -1,93 +0,0 @@
# Code of Conduct
## Our Pledge
In the interest of fostering an open and welcoming environment, we as
contributors and maintainers pledge to making participation in our project and
our community a harassment-free experience for everyone, regardless of age, body
size, disability, ethnicity, gender identity and expression, level of
experience, education, socio-economic status, nationality, personal appearance,
race, religion, or sexual identity and orientation.
## Our Standards
Examples of behavior that contributes to creating a positive environment
include:
* Using welcoming and inclusive language
* Being respectful of differing viewpoints and experiences
* Gracefully accepting constructive criticism
* Focusing on what is best for the community
* Showing empathy towards other community members
Examples of unacceptable behavior by participants include:
* The use of sexualized language or imagery and unwelcome sexual attention or
advances
* Trolling, insulting/derogatory comments, and personal or political attacks
* Public or private harassment
* Publishing others' private information, such as a physical or electronic
address, without explicit permission
* Other conduct which could reasonably be considered inappropriate in a
professional setting
## Our Responsibilities
Project maintainers are responsible for clarifying the standards of acceptable
behavior and are expected to take appropriate and fair corrective action in
response to any instances of unacceptable behavior.
Project maintainers have the right and responsibility to remove, edit, or reject
comments, commits, code, wiki edits, issues, and other contributions that are
not aligned to this Code of Conduct, or to ban temporarily or permanently any
contributor for other behaviors that they deem inappropriate, threatening,
offensive, or harmful.
## Scope
This Code of Conduct applies both within project spaces and in public spaces
when an individual is representing the project or its community. Examples of
representing a project or community include using an official project e-mail
address, posting via an official social media account, or acting as an appointed
representative at an online or offline event. Representation of a project may be
further defined and clarified by project maintainers.
This Code of Conduct also applies outside the project spaces when the Project
Steward has a reasonable belief that an individual's behavior may have a
negative impact on the project or its community.
## Conflict Resolution
We do not believe that all conflict is bad; healthy debate and disagreement
often yield positive results. However, it is never okay to be disrespectful or
to engage in behavior that violates the project’s code of conduct.
If you see someone violating the code of conduct, you are encouraged to address
the behavior directly with those involved. Many issues can be resolved quickly
and easily, and this gives people more control over the outcome of their
dispute. If you are unable to resolve the matter for any reason, or if the
behavior is threatening or harassing, report it. We are dedicated to providing
an environment where participants feel welcome and safe.
Reports should be directed to *[PROJECT STEWARD NAME(s) AND EMAIL(s)]*, the
Project Steward(s) for *[PROJECT NAME]*. It is the Project Steward’s duty to
receive and address reported violations of the code of conduct. They will then
work with a committee consisting of representatives from the Open Source
Programs Office and the Google Open Source Strategy team. If for any reason you
are uncomfortable reaching out to the Project Steward, please email
opensource@google.com.
We will investigate every complaint, but you may not receive a direct response.
We will use our discretion in determining when and how to follow up on reported
incidents, which may range from not taking action to permanent expulsion from
the project and project-sponsored spaces. We will notify the accused of the
report and provide them an opportunity to discuss it before any action is taken.
The identity of the reporter will be omitted from the details of the report
supplied to the accused. In potentially harmful situations, such as ongoing
harassment or threats to anyone's safety, we may take action without notice.
## Attribution
This Code of Conduct is adapted from the Contributor Covenant, version 1.4,
available at
https://www.contributor-covenant.org/version/1/4/code-of-conduct.html
-28
View File
@@ -1,28 +0,0 @@
# How to Contribute
We'd love to accept your patches and contributions to this project. There are
just a few small guidelines you need to follow.
## Contributor License Agreement
Contributions to this project must be accompanied by a Contributor License
Agreement. You (or your employer) retain the copyright to your contribution;
this simply gives us permission to use and redistribute your contributions as
part of the project. Head over to <https://cla.developers.google.com/> to see
your current agreements on file or to sign a new one.
You generally only need to submit a CLA once, so if you've already submitted one
(even if it was for a different project), you probably don't need to do it
again.
## Code Reviews
All submissions, including submissions by project members, require review. We
use GitHub pull requests for this purpose. Consult
[GitHub Help](https://help.github.com/articles/about-pull-requests/) for more
information on using pull requests.
## Community Guidelines
This project follows [Google's Open Source Community
Guidelines](https://opensource.google/conduct/).
+5
View File
@@ -0,0 +1,5 @@
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product. These are tested weekly and maintained by Google.
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that may be created by Google or external contributors. They are not necessary maintained.
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
+24
View File
@@ -0,0 +1,24 @@
# These owners will be the default owners for everything in
# the repo. Unless a later match takes precedence,
# @global-owner1 and @global-owner2 will be requested for
# review when someone opens a pull request.
/sdk/sdk_* @andrewferlitsch
/gapic @andrewferlitsch
/ml_ops @andrewferlitsch
/model_monitoring/* @mco-gh
/structured_data/rapid_prototyping_* @rafael-carvalho
/managed_notebooks/
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
/explainable_ai/SDK_Custom_Container_XAI.ipynb @brianchunkang
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
/tensorboard @yfang1
/feature_store @nayaknishant @morgandu
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
/vertex_endpoints/optimized_tensorflow_runtime @vlasenkoalexey
/notebooks/community/ml_ops/stage2/get_started_with_visionapi_and_automl.ipynb @mansari
File diff suppressed because it is too large Load Diff
Binary file not shown.

After

Width:  |  Height:  |  Size: 83 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 141 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 230 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 140 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 140 KiB

File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -480,8 +480,7 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -1496,9 +1495,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1518,8 +1516,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -505,8 +505,7 @@
"\n",
"import google.cloud.aiplatform_v1beta1 as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -1521,9 +1520,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`).\n",
"\n",
@@ -1552,8 +1550,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -482,8 +482,7 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -1498,9 +1497,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1520,8 +1518,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -483,8 +483,7 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -1710,7 +1709,7 @@
"outputs": [],
"source": [
"import tensorflow as tf\n",
"from tensorflow.keras import Input, Model\n",
"from tensorflow.keras import Model\n",
"from tensorflow.keras.layers import Lambda\n",
"\n",
"softmax = model_A.outputs[0]\n",
@@ -1761,9 +1760,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1783,8 +1781,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -1824,16 +1821,15 @@
"CONCRETE_INPUT = \"numpy_inputs\"\n",
"\n",
"\n",
"def _preprocess(bytes_input):\n",
"def _preprocess(bytes_input): # noqa: 811\n",
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
"def preprocess_fn(bytes_inputs):\n",
"def preprocess_fn(bytes_inputs): # noqa: 811\n",
" decoded_images = tf.map_fn(\n",
" _preprocess, bytes_inputs, dtype=tf.float32, back_prop=False\n",
" )\n",
@@ -482,8 +482,7 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -1600,9 +1599,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -1622,8 +1620,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -507,8 +507,7 @@
"\n",
"import google.cloud.aiplatform_v1beta1 as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -1523,9 +1522,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`).\n",
"\n",
@@ -1554,8 +1552,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(32, 32))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",
@@ -484,8 +484,7 @@
"\n",
"from google.cloud.aiplatform import gapic as aip\n",
"from google.protobuf import json_format\n",
"from google.protobuf.json_format import MessageToJson, ParseDict\n",
"from google.protobuf.struct_pb2 import Struct, Value"
"from google.protobuf.struct_pb2 import Value"
]
},
{
@@ -2103,9 +2102,8 @@
"\n",
"When you send a prediction or explanation request, the content of the request is base 64 decoded into a Tensorflow string (`tf.string`), which is passed to the serving function (`serving_fn`). The serving function preprocesses the `tf.string` into raw (uncompressed) numpy bytes (`preprocess_fn`) to match the input requirements of the model:\n",
"- `io.decode_jpeg`- Decompresses the JPG image which is returned as a Tensorflow tensor with three channels (RGB).\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32.\n",
"- `image.convert_image_dtype` - Changes integer pixel values to float 32, and rescales pixel data between 0 and 1.\n",
"- `image.resize` - Resizes the image to match the input shape for the model.\n",
"- `resized / 255.0` - Rescales (normalization) the pixel data between 0 and 1.\n",
"\n",
"At this point, the data can be passed to the model (`m_call`)."
]
@@ -2125,8 +2123,7 @@
" decoded = tf.io.decode_jpeg(bytes_input, channels=3)\n",
" decoded = tf.image.convert_image_dtype(decoded, tf.float32)\n",
" resized = tf.image.resize(decoded, size=(128, 128))\n",
" rescale = tf.cast(resized / 255.0, tf.float32)\n",
" return rescale\n",
" return resized\n",
"\n",
"\n",
"@tf.function(input_signature=[tf.TensorSpec([None], tf.string)])\n",

Some files were not shown because too many files have changed in this diff Show More