Compare commits

..
Author SHA1 Message Date
nayaknishantandGitHub af1ba880e4 docs: fixing CODEOWNERS and instructions hyperlinks
When opening a PR, the CODEOWNERS and instructions hyperlinks throw a 404 error because they point to a URL that has been changed. Fixing these hyperlinks.
2022-05-19 16:05:02 -04:00
Andrew FerlitschandGitHub 119273ae7e Ml.googleapis fix (#579)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:42:55 -07:00
Andrew FerlitschandGitHub 95bc39a685 fix: enable APIs stage5 (#578)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:30:11 -07:00
Andrew FerlitschandGitHub b054104851 fix: enable APIs stage4 (#577)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:23:49 -07:00
Andrew FerlitschandGitHub e0e0cf849a fix: enable APIs stage3 (#576)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:15:29 -07:00
Andrew FerlitschandGitHub c95b3d7088 fix : enable APIs stage2 (#575)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 11:51:49 -07:00
Andrew FerlitschandGitHub 19c2bdb008 fix: enable APIs stage1 (#574)
* fix: enable apis

* fix: enable apis
2022-05-19 11:36:12 -07:00
Andrew FerlitschandGitHub 3c815f3888 update: new template edition (#572)
* fix: new template review updates

* fix: new template review updates

* mport -> import

* fix: dummy code sample required an import

dummy code samples (not otherwise part of template) -- should be self contained since they will be deleted by the template user.

* fix: added install for self-contained code passes ingestion test

* fix: example code (not otherwise part of template) not self-contained.

* fix: continue update so code example is self-contained

* update: numpy already installed in test env
2022-05-19 11:24:19 -07:00
cfcd9b29fd Malansari automl vision api notebook (#573)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-19 11:14:17 -07:00
Ivan CheungandGitHub 4fca7d98b2 Increases notebook concurrency and linted CI files (#512)
* Fixed private pool issues

* Ran linter

* Added worker timeouts

* Tweaked timeout

* Removed gcloud requirement

* Removed unneeded file
2022-05-18 18:58:54 -04:00
Andrew FerlitschandGitHub dea950bcb6 fix: DPE styling (#570)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:32:30 -07:00
Andrew FerlitschandGitHub 4c43755fb6 Mlops 8v3 (#569)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:11:31 -07:00
Andrew FerlitschandGitHub 374942a9e9 fix: DPE-style tuning (#568) 2022-05-18 14:01:13 -07:00
Andrew FerlitschandGitHub 8add418428 Mlops 8v2 (#567)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:46:24 -07:00
Andrew FerlitschandGitHub 9d73cc4574 fix: DPE style tuning (#566)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:29:45 -07:00
Andrew FerlitschandGitHub 5edb4bb1bf fix: DPE-styling (#565)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 12:29:01 -07:00
Andrew FerlitschandGitHub 0e811868d3 fix: links 2022-05-18 11:33:56 -07:00
Andrew FerlitschandGitHub 9efcfa25e8 fix: links 2022-05-18 11:27:11 -07:00
48036cf581 vision api notebook - updated link to open in Vertex AI Workbench (#562)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-18 11:20:39 -07:00
Andrew FerlitschandGitHub 79fd9b4049 Update README.md 2022-05-17 11:05:54 -07:00
Andrew FerlitschandGitHub 46b2181a4e fix: typos in two towers (#563)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers
2022-05-17 11:04:01 -07:00
Andrew FerlitschandGitHub d04f25a8bd Update README.md 2022-05-16 15:13:45 -07:00
Andrew FerlitschandGitHub 9f341c350c fix: two towers (#561)
* fix: two towers

* fix: two towers
2022-05-16 15:11:44 -07:00
Ivan CheungandGitHub f22f97f680 fix: Updated matching engine dependency and fixed cases (#557)
* fix: Updated dependency and fixed cases

* Ran linter

* Renamed to Vertex AI Workbench notebook

* Additional text fixes
2022-05-16 13:06:04 -04:00
Andrew FerlitschandGitHub fe75745d44 feat: WIP: twotowers+matching engine (#560)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine

* feat: wip: twotowers

* feat: wip: twotowers
2022-05-13 14:03:43 -07:00
Andrew FerlitschandGitHub bbc9f1337e Update README.md 2022-05-13 08:56:39 -07:00
Andrew FerlitschandGitHub eb1fa9213a feat: add notebook for matching engine (#559)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine
2022-05-12 15:55:21 -07:00
Mohammad Al-AnsariandGitHub a7033a6527 Updates to visionapi notebook (#556)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting
2022-05-11 11:23:50 -07:00
Andrew FerlitschandGitHub 7e6c2d69c8 update: ModelEval as SDK (#555)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK
2022-05-10 15:33:52 -07:00
Andrew FerlitschandGitHub 1a21b81804 fix: stage5 DPE style (#554)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 14:11:31 -07:00
Andrew FerlitschandGitHub 2bbd520613 fix: stage4 DPE styling (#553)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 13:58:44 -07:00
Andrew FerlitschandGitHub 8285e4ebd1 Mlops 8 (#552)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:56:43 -07:00
Andrew FerlitschandGitHub 859849894e fix: stage3 workbench (#551)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:38:52 -07:00
Andrew FerlitschandGitHub e74dd48ae0 fix: 2nd round workbench (#550)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:12:27 -07:00
Andrew FerlitschandGitHub a14eb71210 fix: check for workbench (#549)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench
2022-05-10 11:37:44 -07:00
Mohammad Al-AnsariandGitHub 0b6a9718ff Added author / reviewer informationAdded sample files (#544)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference
2022-05-09 13:59:59 -07:00
Andrew FerlitschandGitHub 6ac0d8a029 Update README.md 2022-05-09 13:48:00 -07:00
Andrew FerlitschandGitHub 2ee013bcab Delete get_started_nvidia_triton_serving.ipynb 2022-05-09 13:47:18 -07:00
Andrew FerlitschandGitHub 1ebb3f5714 Mlops 8 (#547)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server
2022-05-09 13:46:35 -07:00
Andrew FerlitschandGitHub 11c5134961 Update README.md 2022-05-09 13:40:51 -07:00
Andrew FerlitschandGitHub e328b7268f feat: triton server (#546)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server
2022-05-09 13:38:37 -07:00
Andrew FerlitschandGitHub d297e99e5a Update get_started_with_machine_management.ipynb 2022-05-09 12:20:03 -07:00
Andrew FerlitschandGitHub 48c7a4c82e fix: spelling 2022-05-09 12:15:07 -07:00
Andrew FerlitschandGitHub eb3b52f863 Update README.md 2022-05-09 12:10:40 -07:00
Andrew FerlitschandGitHub 4e58cca127 Update get_started_with_machine_management.ipynb 2022-05-09 12:09:07 -07:00
Andrew FerlitschandGitHub 182a98768f feat: machine resource settings (#545)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings
2022-05-09 12:06:56 -07:00
Andrew FerlitschandGitHub f483447235 Update README.md 2022-05-06 19:07:16 -07:00
Andrew FerlitschandGitHub c59050608b feat: vision api and automl (#543)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data
2022-05-06 19:04:43 -07:00
Andrew FerlitschandGitHub 3b9844f92c update: add co-author (#542)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth

* update: add co-author

* update: add co-author
2022-05-06 15:27:05 -07:00
Andrew FerlitschandGitHub ee301a22f6 clean: remove BLAH 2022-05-06 12:38:30 -07:00
Andrew FerlitschandGitHub b7d16f66aa fix: workbench auth (#541)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth
2022-05-06 10:18:06 -07:00
Andrew FerlitschandGitHub 57aad5b802 fix: compat issue with Vertex AI and TFX Transform (#540)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility
2022-05-05 19:04:13 -07:00
Andrew FerlitschandGitHub 9e311433ba fix: mistakes in tfx notebook (#539)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes
2022-05-05 14:58:04 -07:00
Andrew FerlitschandGitHub 04b310927a Update README.md 2022-05-05 13:36:36 -07:00
Andrew FerlitschandGitHub 2fed3ad014 feat: add TFX pipeline (#538)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX
2022-05-05 13:34:22 -07:00
Andrew FerlitschandGitHub 0ec94e0af6 fix: IS_COLAB (#535)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA
2022-05-04 13:55:11 -07:00
9470be0900 adds the updated service-account code to mlops/stage3/get_started_with_dataproc_serverless_pipeline_components notebook (#529)
* adds the updated service-account setting code to notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:55 -07:00
479a0c6271 adds the updated service-account code to mlops/stage3/get_started_with_automl_pipeline_components notebook (#528)
* adds the updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:13 -07:00
053f9c397f adds the updated service-account code to mlops/stage3/get_started_with_kubeflow_pipelines notebook (#527)
* adds updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:03:39 -07:00
Andrew FerlitschandGitHub 2c82469756 fix: service account 2022-05-03 08:33:17 -07:00
Andrew FerlitschandGitHub fdfc7009d0 fix: correct IS_COLAB (#531)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB
2022-05-02 14:25:08 -07:00
Andrew FerlitschandGitHub 59fcfe137d fix: typo in stage 2022-05-02 14:00:16 -07:00
Andrew FerlitschandGitHub 9b434b32bc feat: more eval examples (#530)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work
2022-05-02 13:19:07 -07:00
fc27cd8628 Added service account fetch code for colab in get_started_with_rapid_prototyping_bqml_automl file (#520)
* made changes

* ran linter test

* added minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:45 -07:00
a62f03c396 Added service account fetch code for colab in get_started_with_custom_training_pipeline_components file (#519)
* made changes

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:08 -07:00
a270439814 Added service account fetch code for colab in get_started_with_bqml_pipeline_components file (#518)
* changes made

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:20:18 -07:00
sudarshan-SpringMLandGitHub a97af4a078 Added service account fetch code for colab in get_started_with_bq_tfdv_pipeline_components file (#517)
* added service account code for colab

* ran linter test

* made changes

* ran linter test
2022-05-02 09:19:29 -07:00
Andrew FerlitschandGitHub d7127cc22f fix: IS_COLAB (#526)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:25:49 -07:00
Andrew FerlitschandGitHub 802ab4edd8 fix: DPE-styling (#525)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:10:19 -07:00
Andrew FerlitschandGitHub ae7f28fb31 fix: DPE-styling updates (#524)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 14:06:59 -07:00
f63e3e6e4c Added colab link and made changes in the code in such a way that docker commands can run on colab environment for the file get_started_vertex_training_pytorch (#508)
* Added colab in the notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-29 11:55:51 -07:00
Andrew FerlitschandGitHub b9bb497ebc fix: IS_COLAB (#523)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 11:54:21 -07:00
Andrew FerlitschandGitHub 4368b9e7f8 feat: GAPIC->SDK for private endpoint (#516)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints
2022-04-28 09:59:49 -07:00
2e9cb5d2cf minor change for 'Get started with dataflow pipeline components' (#500)
* Add minor changes to get_started_with_dataflow_pipeline_components

* minor changes and tested

* remove variable dataflow_wait_op, since not used in other places.

* remove variable dataflow_wait_op, since not used in other places

* removed unused import

* Run linter test

* Add gcloud project set when using colab

* Run linter

* correct anem toColab logo Run in Colab

* run linter

* correct the list of items to remove

* Run linter

* Run liinter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 16:45:20 -07:00
9ec8a93e05 Minor changes has been done to pipelines_intro_kfp (#494)
* minor changes done

* ran linter test

* chnanged the as per review coments

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:42:34 -07:00
3ed8778656 Made few changes to sdk-feature-store (#486)
* Added vertexai notebook

* Ran the linter test

* Made the required changes based on the comments

* Ran linter test again

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:39:03 -07:00
Andrew FerlitschandGitHub bf5e3cf870 fix: delete tmp BQ model (#510)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model
2022-04-27 09:30:35 -07:00
c23215893d minor changes on stage1 ml ops - Get started vertex datasets (#474)
* Add minor changes to get_started_vertex_datasets notebook

* run linter

* Run Linter test

* Add google authentication cell for colab execution

* run linter

* correct the project id definition

* Run linter

* Add project id cell

* run liner

* Added imports that are required

* run linter test

* Add gcloud project set

* Run linter

* add linter run

* Running linter test

* run linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-25 10:11:27 -07:00
Andrew FerlitschandGitHub 1c96f7ca71 fix: notebook run in colab (#505)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker
2022-04-22 18:50:29 -07:00
Andrew FerlitschandGitHub 0d5661835b feat: add docker support in Colab (#504)
* feat: add colab code for docker

* feat: add colab code for docker
2022-04-22 13:54:29 -07:00
fe1a3c0bc9 Adds Colab part and minor changes to ml_ops/stage2/get_started_bqml_training notebook (#491)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

* adds colab part and minor changes

* ran linter test

* retains the newly added code lost in conflicts

* ran linter test

* converts vertex to vertex ai

* ran linter test

* moves deletion of temporary BQ table outside delete_storage condition

* ran linter test

* adds bigquery-storage dependency to the notebook tested on Colab

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 11:09:49 -07:00
82bffb87f1 Made some minor changes to sdk-metric-parameter-tracking-for-locally-trained-models (#480)
* Added to correct path

* Ran linter test

* Made some changes

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 00:05:57 -07:00
sudarshan-SpringMLandGitHub 741c6732f1 Made minor changes to sdk-metric-parameter-tracking-for-custom-jobs file (#479)
* modified file

* modified file

* ran linter test

* deleted file in community folder

* ran linter test

* changed folder name in links

* ran linter test

* resolved comments

* ran linter test

* modified file

* ran linter test
2022-04-22 00:05:07 -07:00
9d8caf7888 Added markup text mentioning the role provided to service account used by notebook instance & provided key-version value while destroying it in notebook get_started_with_cmek_training (#495)
* Changes made to notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 23:37:19 -07:00
e63d354413 Made minor changes to rapid_prototyping_bqml_automl file and moved file from community to official (#496)
* added file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:44:18 -07:00
831c515477 Adding official version for Fraud detection notebook (#321)
* deleted file in community folder

* modified notebook

* ran linter test

* renamed managed_notebooks folder to workbench

* ran linter

* resolved comments

* ran linter test

* pulled new version of branch

* ran linter again

* resolved comments

* ran linter test

* removed %%time and added --user flag to all pip installs

* ran linter test

* added debug statements

* ran linter test

* added verbose

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:07:58 -07:00
Andrew FerlitschandGitHub 06ba5d6804 fix: SaraRob installation updates (#501)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-21 11:37:44 -07:00
0137cd106e adds Colab part and minor changes to ml_ops/stage2/get_started_vertex_experiments notebook in community folder (#493)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:20:29 -07:00
8b3b63d714 Adds Colab part and minor changes to ml_ops/stage2/get_started_automl_training notebook (#492)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-21 09:19:34 -07:00
bf79916f29 Adds Colab part to ml_ops/stage1/get_started_bq_datasets notebook (#490)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

* adds Colab part and minor changes

* ran linter test

* updates the enable apis step in setup project section

* ran linter test

* changes vertex to vertex ai

* ran linter test

* moves temporary BQ table deletion outside the delete_storage condition

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:17:49 -07:00
6bf462f79d Notebook fix to handle GCS outputs and resolve (AutoML Tabular Forecasting notebook error: no row field 'name' #453) (#477)
* notebook fix to handle gcs output

* linter test

* minor bug fix and markup added

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:13:52 -07:00
Andrew FerlitschandGitHub 106cdee495 feat: update model eval metrics for comparison (#498)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-20 19:21:23 -07:00
dfb7301733 Inardini - feature store demo blog review (#484)
* review for blog

* linter code passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:17:17 -07:00
da707b2cbc Made minor changes to custom-tabular-bq-managed-dataset file (#473)
* modified notebook

* modified file

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:07:07 -07:00
873ba9dde9 Made minor changes to get_started_with_rapid_prototyping_bqml_automl file (#459)
* modified file

* made linter changes

* made changes

* linter test issues resolved

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:06:27 -07:00
Andrew FerlitschandGitHub 15c452f39d fix: Issue 451, add db-dtypes to requirements (#458)
* fix: issue 451

* fix: issue 451
2022-04-18 12:14:56 -07:00
Andrew FerlitschandGitHub be7111815b fix: getting SERVICE ACCOUNT 2022-04-18 10:59:44 -07:00
17db1a952b Tabnet - Add serving (#482)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

* Add deployment in Vertex AI

* Add delete the resource

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 12:51:55 -07:00
Andrew FerlitschandGitHub 455143d0f0 Update README.md 2022-04-15 12:26:06 -07:00
Andrew FerlitschandGitHub f0892852cb Update README.md 2022-04-15 12:24:39 -07:00
Andrew FerlitschandGitHub ca48556d0c feat: add tabnet notebook (#483)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example

* feat: add tabnet notebook

* feat: add tabnet notebook
2022-04-15 12:21:51 -07:00
Aleksey VlasenkoandGitHub f961aa3174 Minor updates basing on team feedback (#481) 2022-04-15 10:56:46 -07:00
64c8eca7df Refresh of Distributed Hyperparameter Tuning for Colab (#461)
* notebook refresh from vertex ai sdk project

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 08:49:36 -07:00
b3332c1742 minro changes to get_started_with_hpt_pipeline_components (#465)
* minor changes made to notebook

* ran lintertest

* added coment

* ran lintertest

* made changes sujjested in git review

* ran linter test

* changes done as per review

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-14 17:02:23 -07:00
Aleksey VlasenkoandGitHub b35f697a75 Adding samples for Vertex AI Prediction optimized TensorFlow runtime (#475)
* adding Vertex AI optimized TensorFlow runtime samples

* updated URLs, added code to import benchmark.py

* fixed 'Open in Vertex AI Workbench' links

* final cleanup

* added @vlasesnkoalexey as an owner of notebooks/community/vertex_endpoints/optimized_tensorflow_runtime

* rerun linter
2022-04-14 10:14:27 -07:00
3bc32a1d48 Adds Colab part to the ml_ops/stage3/get_started_with_automl_pipelines notebook (#472)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

* adds Colab part to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:52:06 -07:00
d66f851554 Adds Colab part to the ml_ops/stage3/get_started_with_kubeflow_pipelines notebook (#471)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

* adds colab changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:34 -07:00
d733f107e1 Made minor changes to get_started_with_custom_training_pipeline_components file (#470)
* added colab related content

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:01 -07:00
805e2e1c83 Made minor changes to get_started_with_bqml_pipeline_components file (#469)
* made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:50:18 -07:00
03dc17d9d7 updates ml_ops/stage3/get_started_with_dataproc_serverless_pipelines notebook (adds delete-batch code + adds colab part + updates textual content) in community folder (#464)
* updates: adds delete-batch code  + adds colab part + updates textual content

* sets delete_bucket to False as default

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:49:26 -07:00
a4909f823e Adds changes for Colab support to the ml_ops/stage2/get-started-with-vertex-featstore notebook (#462)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

* adds the colab changes and minor textual changes

* ran linter test

* adds the colab changes to the notebook and minor textual changes

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:48:58 -07:00
e91b259595 Made minor changes to file get_started_vertex_training_xgboost.ipynb (#436)
* modified file

* run linter test

* run in colab

* added coment

* run lintertest

* changed as per review coments

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:08:04 -07:00
14284046e4 Made minor changes to get_started_vertex_tensorboard (#437)
* Adding a notebook

* Ran linter test

* Added Colab

* Ran the linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:07:24 -07:00
59a9a5e6ba Notebook Refresh E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Distributed Training (#434)
* notebook refresh from vertex ai sdk project

* update with linter test changes

* linter fix

* linter issue

* notebook colab workbench links

* linter test

* linter fix

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:06:01 -07:00
Andrew FerlitschandGitHub f3b0a9e0c0 Update README.md 2022-04-11 18:56:52 -07:00
Andrew FerlitschandGitHub 92b572a364 feat: add raw predict example (#468)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example
2022-04-11 18:53:45 -07:00
014be9b530 Made minor changes to get_started_with_data_labeling_2 (#463)
* added colab link and made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:07:13 -07:00
fa675e0082 inardini real time churn feature store demo fixes (#455)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

* name fixes. linter code done. passed.

* fix project id and region

* test done

* format

* linter test done.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:01:27 -07:00
Andrew FerlitschandGitHub 113cbb9709 Update README.md 2022-04-11 14:54:27 -07:00
Andrew FerlitschandGitHub b72bdc8112 Update README.md 2022-04-11 12:31:03 -07:00
Andrew FerlitschandGitHub 0842fa8354 Update README.md 2022-04-11 12:30:38 -07:00
Andrew FerlitschandGitHub 4e4f3f4095 Ml ops 7v6 (#467)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed
2022-04-11 12:16:47 -07:00
Andrew FerlitschandGitHub d014febeb9 Update README.md 2022-04-11 11:37:42 -07:00
Andrew FerlitschandGitHub a3264df643 feat: add BQML + MR example (#466)
* feat: add BQML+MR example

* feat: add BQML+MR example
2022-04-11 11:36:50 -07:00
f0208e3e37 Made minor changes to get_started_with_custom_training_pipeline_components (#456)
* modified file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:37 -07:00
f84e1b9cbc Updates ml_ops/stage3/get-started-kubeflow-pipeline-notebook in the community folder (#449)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:05 -07:00
16b2086031 Made minor changes to get_started_with_bqml_pipeline_components (#444)
* modified notebook

* linter modifications made

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:30:20 -07:00
0e24ba565d Updates ml_ops/stage3/get-started-automl-pipeline-notebook in the community folder (#440)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:37 -07:00
49718b02a5 Made minor changes to get_started_with_bq_tfdv_pipeline_components (#439)
* modified notebook

* linter test issues resolved

* ran linter test

* added colab option

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:03 -07:00
63031ed364 Updates ml_ops/stage2/get_started_vertex_featurestore notebook in community folder. (#426)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:26:57 -07:00
9fd325e25b Made minor changes to file get_started_with_data_labeling (#425)
* modified notebook

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:22:12 -07:00
93af43419c Updates Mlops/stage2/get-started-automl-training notebook in the community folder (#409)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 13:03:29 -07:00
c8f0cdb74a Refresh of Distributed Hyperparameter Tuning Notebook (#454)
* notebook refresh

* linter test

* notebook refresh added corrected cleanup

* linter test

* notebook refresh added corrected cleanup

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 14:07:47 -05:00
19368fe5cc inardini google cloud pipelines dataproc tabular (#445)
* add dataproc components tabular notebook

* add src package

* add codeowner

* linter test done. almost ok except for the flake8 E231. need to follow up with andy

* fix typos based on andy review

* linter test done. review with andy

* hyperparameter_tuning_op fix

* project name

* add delete repo

* fix image

* linter test done

* fix image reference

* fix typo image reference

* minor fixes

* karl fixes

* karl fixes on links

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:10:33 -07:00
6a05e0eb6c inardini real time churn feature store demo (#448)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:21:22 -05:00
40d643f11c Change bq://bigquery-public-data:iowa_liquor_sales_forecasting.2021_sales_predict for PREDICTION_DATASET_BQ_PATH (#423)
Co-authored-by: Jungwoon Lee <jungwoonlee@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 09:10:10 -05:00
Andrew FerlitschandGitHub 72009cd21b fix: misspelling of BigQuery 2022-04-06 20:15:07 -07:00
Andrew FerlitschandGitHub cc9a50f40b Update get_started_with_vertex_private_endpoints.ipynb 2022-04-06 19:56:51 -07:00
Andrew FerlitschandGitHub e3135e8875 Update README.md 2022-04-06 17:42:45 -07:00
Andrew FerlitschandGitHub 59eb297151 feat: add notebook for private endpoints (#450)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: notebook for private endpoints

* feat: notebook for private endpoints
2022-04-06 17:41:10 -07:00
32b0c1c89e Mco mvmm (#420) - move model monitoring notebook from community to official
* license tweak

* remove unused import json

* fixed a missing import

* add sleep(300) to test my theory

* add missing newline

* put sleep behind a conditional

* revert new notebook name to previous name for compatibility with extant links

* fix quoting syntax error

* reformatted due to relint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-06 22:37:53 +01:00
3328a8190d Adding sample to use (auto) scaling config for Feature Store online store (#367)
* Add example using auto scale

* Format with nbqa

* Complete sentence

* Give the sample for CreateFeaturestoreRequest only, instead of actual call to create FS to avoid duplicate resource or extra cleanup.

* Remove unused import

* Remove version pinning

* Add try block to avoid error when test was not cleanup properly.

* Lint

* Fix import

* Merge print lro result with the call in the same try block

* Fix typo

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-04-05 17:02:49 -07:00
7aa6acdca6 fix UnboundLocalError in TF-Agents Bandits Guide (#446)
In "Step by Step Guide to Building Reinforcement Learning Applications using Vertex AI", the replay_buffer was unbound if training_data_spec_transformation_fn was provided to the train() function

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-05 16:30:40 -05:00
Andrew FerlitschandGitHub 7926ff1264 Update README.md 2022-04-05 11:10:12 -07:00
Andrew FerlitschandGitHub 67b926dfb4 feat: add notebook for FastAPI server (#447)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server
2022-04-05 11:08:09 -07:00
327f9e7a4b Fix typo in notebook heading. (#443)
* Fix typo in notebook heading.

* Fix linting issues.

Co-authored-by: Win Woo <wwoo@google.com>
2022-04-05 08:43:47 -05:00
Andrew FerlitschandGitHub 8be220d089 fix missing + 2022-04-04 14:40:27 -07:00
Andrew FerlitschandGitHub 2dad40f49f bucket setting fine-tuning 2022-04-04 14:39:45 -07:00
Andrew FerlitschandGitHub 99b724028f Update README.md 2022-04-04 13:51:43 -07:00
Andrew FerlitschandGitHub 909fbcb0d4 feat: notebook for TF Serving binary (#442)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions

* feat: notebook for TF Serving

* feat: notebook for TF Serving
2022-04-04 13:49:39 -07:00
Andrew FerlitschandGitHub 351fc3e4d3 fix: remove unused print_op 2022-04-04 09:05:33 -07:00
252b3d31a3 Inardini bqml components pipeline official blog (#416)
* bqml pipeline notebook for official blog

* add notebook to CODEOWNERS

* add author name

* requirements commenting fix

* linter test done

* unpin the maintenance version for kfp

* fix: install conflicts

* Update google_cloud_pipeline_components_bqml_text.ipynb

* add karl fix

* lint test done

* add andy fixes

* linter test done

* flip order of the special METADATA fix

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
2022-04-04 09:00:17 -07:00
Andrew FerlitschandGitHub bfdfaab38c Update README.md 2022-04-01 16:11:28 -07:00
Andrew FerlitschandGitHub 21a5963f84 feat: notebook for tf serving functions (#438)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions
2022-04-01 16:09:39 -07:00
9452249dce Added a new section called "Grant Dataproc roles to the Service Account" (#433)
* Ml ops 7v2 (#429)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* Update README.md

* Add files via upload

* Update README.md

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* feat: new notebook on endpoints (#430)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* wrong location

* Create README.md

* Update README.md

* Update README.md

* Update README.md

* Update README.md

* fix: links

* fix: title

* fix: example for reconfiguring the traffic split (#431)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* Add section on granting Dataproc IAM roles.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Win Woo <wwoo@google.com>
2022-03-31 20:14:16 -07:00
Andrew FerlitschandGitHub 49a9df058f fix: example for reconfiguring the traffic split (#431)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint
2022-03-31 15:27:27 -07:00
Andrew FerlitschandGitHub f99b7e5d17 fix: title 2022-03-31 12:28:15 -07:00
Andrew FerlitschandGitHub ac03c57a94 fix: links 2022-03-31 12:27:47 -07:00
Andrew FerlitschandGitHub 2e4cf648c5 Update README.md 2022-03-31 12:27:01 -07:00
Andrew FerlitschandGitHub f000baa328 Update README.md 2022-03-31 12:26:35 -07:00
Andrew FerlitschandGitHub 113f89604a Update README.md 2022-03-31 12:26:01 -07:00
Andrew FerlitschandGitHub 5019a004ce Update README.md 2022-03-31 12:25:42 -07:00
Andrew FerlitschandGitHub a577f3844a Create README.md 2022-03-31 12:25:31 -07:00
Andrew FerlitschandGitHub 88c7f0f690 wrong location 2022-03-31 12:24:20 -07:00
Andrew FerlitschandGitHub a18792499a feat: new notebook on endpoints (#430)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue
2022-03-31 12:23:22 -07:00
Andrew FerlitschandGitHub 0b5fc8bb3c Delete stage6b.png 2022-03-30 19:34:52 -07:00
Andrew FerlitschandGitHub 1f77410fda Add files via upload 2022-03-30 19:34:31 -07:00
Andrew FerlitschandGitHub 45fb57f29c Delete stage6c.png 2022-03-30 19:34:11 -07:00
Andrew FerlitschandGitHub 3380b394eb Delete stage6b.png 2022-03-30 19:34:03 -07:00
Andrew FerlitschandGitHub 1286cc5044 Add files via upload 2022-03-30 19:33:20 -07:00
Andrew FerlitschandGitHub 1ce1af791c Delete stage6c.png 2022-03-30 19:31:24 -07:00
Andrew FerlitschandGitHub 2587e329ee Delete stage6b.png 2022-03-30 19:31:15 -07:00
Andrew FerlitschandGitHub 37d4816051 Update README.md 2022-03-30 19:30:19 -07:00
Andrew FerlitschandGitHub d9dff882b8 Add files via upload 2022-03-30 19:29:41 -07:00
Andrew FerlitschandGitHub 26cc2c5278 Update README.md 2022-03-30 19:21:49 -07:00
Andrew FerlitschandGitHub 69aff1bdc4 Ml ops 7v2 (#429)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:20:41 -07:00
Andrew FerlitschandGitHub 567994f2b1 fix: add missing details to objective in endpoint notebooks (#428)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:16:02 -07:00
Andrew FerlitschandGitHub e316c7b8aa Update README.md 2022-03-30 17:31:59 -07:00
Andrew FerlitschandGitHub c07a059a8b Update README.md 2022-03-30 17:30:46 -07:00
Andrew FerlitschandGitHub 7b4bbffc41 feat: add endpoint notebook (#427)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example

* feat: add endpoint notebook

* feat: add endpoint notebook
2022-03-30 15:44:54 -07:00
bdc011ef34 Made some minor changes to get_started_vertex_training_pytorch (#406)
* Added notebook

* Ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-30 08:21:22 -05:00
Andrew FerlitschandGitHub 44ea0d7c61 Update README.md 2022-03-28 17:00:01 -07:00
Andrew FerlitschandGitHub aa950e5ee4 feat: add TFHub model example (#422)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example
2022-03-28 16:57:04 -07:00
Andrew FerlitschandGitHub 247906e50e fix: WORKDIR in Dockerfile 2022-03-28 15:52:28 -07:00
81b2493a44 Made minor changes to get_started_vertex_training_r (#417)
* addd file

* modified file

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-28 13:26:54 -07:00
WhiteSource RenovateandGitHub 97b0edb222 chore(deps): update dependency black to v22.3.0 (#421) 2022-03-28 14:23:25 -05:00
sudarshan-SpringMLandGitHub f0a9e4b9fe added mlops folder to tested_folders file (#418) 2022-03-28 10:37:21 -05:00
Andrew FerlitschandGitHub f35bbcaec5 update: details on dsl.Condition (#415)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition
2022-03-26 09:51:01 -07:00
Andrew FerlitschandGitHub 2822061dc9 Update README.md 2022-03-25 16:00:46 -07:00
Andrew FerlitschandGitHub be481c8d17 feat: add data labeling notebook (#414)
* feat: add data labeling notebook

* feat: add data labeling notebook
2022-03-25 15:56:22 -07:00
Andrew FerlitschandGitHub 605a972122 fix: testing issues (#413)
* fix: testing issues

* fix: testing issues
2022-03-25 13:26:53 -07:00
Andrew FerlitschandGitHub 66d98d9fe7 fix: testing issues (#412)
* fix: test failures

* fix: test failures
2022-03-25 10:58:39 -07:00
Krishna Chaitanya MovvaandGitHub 6445ed37c9 Updates the Mlops/stage2/ get-started-vertex-experiments notebook in the community folder (#410)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test
2022-03-25 10:52:21 -05:00
Andrew FerlitschandGitHub ca745aeee8 fix: better cleanup (#407)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook

* fix: better cleanup

* fix: better cleanup
2022-03-24 18:58:43 -07:00
f806b4927b Adds updated Mlops/stage1/get-started-bq notebook to the community folder (#392)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:51 -05:00
2942eb5d7f minor changes on Sdk automl tabular regression online bq1 (#369)
* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* Fix Bucket name variable

* run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:30 -05:00
2a5d6650ee Adds updated Mlops/stage2/get-started-bqml-training notebook to the community folder (#397)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:11:01 -05:00
Andrew FerlitschandGitHub 43e971f57a Update README.md 2022-03-24 11:38:17 -07:00
Andrew FerlitschandGitHub 785779613b feat: add dataproc notebook (#405)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook
2022-03-23 15:43:53 -07:00
Andrew FerlitschandGitHub 481193f0ca cleanup: delete created resources in the pipeline (#404)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline
2022-03-23 14:06:58 -07:00
Karl WeinmeisterandGitHub 2cb3cccd14 Fix: Linting issues in two tower notebook (#402) 2022-03-22 16:08:12 -05:00
7c16766994 minor changes in sdk automl image object detection batch (#370)
* Add minor changes to automl image object detection

* run linter

* Correct the milli nodes hours

* fix errors

* fix getenv

* Run linter

* remove tabular notebook, wrongly added

* Correct the bucket varible and minor changes to text

* Run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-22 13:18:27 -07:00
Andrew FerlitschandGitHub 448d18deca update: for official (#401)
* update: for official

* update: for official
2022-03-22 09:26:34 -07:00
97022b0733 Feat: Add Pluto on Workbench tutorial (#399)
* Initial commit

* Undo master commit

* Initial commit

* Update CODEOWNERS

* Add links to resolve PR comments

Co-authored-by: Ward K Harold <wkh@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 10:10:46 -05:00
c2a3e2d4cd deprecate: gapic XAI notebooks replaced by SDK notebooks (#394)
* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 09:46:47 -05:00
manuelamunateguiandGitHub b2dfcf17c8 E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Training for Scikit-Learn (#398)
* notebook refresh

* linter test after refresh
2022-03-22 09:37:09 -05:00
Andrew FerlitschandGitHub d061f09281 fix: replace os.environ with os.getenv - 2nd batch (#396)
* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv
2022-03-19 12:02:47 -05:00
daa64efd40 fix: replace os.environ with os.getenv (#393)
* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-18 16:44:34 -05:00
Andrew FerlitschandGitHub a37deabe27 Update README.md 2022-03-18 13:15:34 -07:00
Andrew FerlitschandGitHub 6009ef0def Update README.md 2022-03-18 13:14:34 -07:00
Andrew FerlitschandGitHub edc644b0d0 Update README.md 2022-03-18 13:13:15 -07:00
Andrew FerlitschandGitHub 1297af8baf Create README.md 2022-03-18 13:11:38 -07:00
Andrew FerlitschandGitHub b8b1b6675b Update README.md 2022-03-18 13:09:51 -07:00
Andrew FerlitschandGitHub 7d3b7abc44 fix: review updates (#395)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl

* review: edits per Erwin review

* review: edits per Erwin review
2022-03-18 12:09:53 -07:00
Rajesh ThallamandGitHub 9a572f298e [community-content] Notebook to demo NVIDIA Triton Inference Server on Vertex AI Prediction (#391)
* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Fixes based on feedback to NVIDIA Triton on Vertex AI Prediction community notebook
2022-03-18 11:31:01 -05:00
b53ca9e678 Tabnet (#375)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-17 17:20:01 -05:00
Andrew FerlitschandGitHub 9aceec161a Update README.md 2022-03-17 14:50:24 -07:00
Andrew FerlitschandGitHub 98b186ed55 feat: notebook for bqml+automl combined (#390)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl
2022-03-17 14:46:29 -07:00
sudarshan-SpringMLandGitHub f23ee1b5a8 Made small changes to Get started vertex vizier notebook (#389)
* modified notebook

* ran linter test

* modified notebook changed copyright licence year

* ran linter test
2022-03-17 10:03:19 -05:00
c6d779f1fc Featurestore colab update (#387)
* update featurestore colab comment

* delete some changes

* delete some changes 2

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-16 21:31:22 -05:00
Andrew FerlitschandGitHub 8908b27b08 feat: finish CPR notebook (#388)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook
2022-03-16 14:00:03 -07:00
Andrew FerlitschandGitHub 8947c9b116 feat: more CPR (#385)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook
2022-03-15 11:56:29 -07:00
Andrew FerlitschandGitHub 9464caac6e Update README.md 2022-03-14 17:40:15 -07:00
Andrew FerlitschandGitHub 98ce91c575 feat: add CPR notebook (#384)
* feat: add CPR notebook

* feat: add CPR notebook
2022-03-14 17:38:47 -07:00
Andrew FerlitschandGitHub 07f8feda3d Update README.md 2022-03-14 11:19:31 -07:00
Andrew FerlitschandGitHub a4e0496ff5 feat: CMEK training (#383)
* feat: add FS from panda

* feat: add FS from panda

* feat: add CMEK example

* feat: add CMEK example
2022-03-14 11:15:35 -07:00
cf162c02c8 chore(deps): update dependency pyupgrade to v2.31.1 (#381)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:34:58 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
831aae94df build(deps): bump pillow (#378)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:33:36 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
3fd9f28778 build(deps): bump pillow (#379)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:32:20 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a656e8e2a8 build(deps): bump pillow (#380)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-03-14 09:30:19 -05:00
Morgan DuandGitHub 2f02152703 fix: pip install google-cloud-aiplatform (#376) 2022-03-10 12:00:08 -06:00
9d08f8ce67 Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components (#372)
* Using BQML 1st-party components and 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML components and upgrade to 1.0.0 of GCPC

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:34:12 -06:00
ec6d508793 adds automl-text-sentiment-analysis-online notebook (#293)
* adds automl-text-sentiment-analysis-online notebook

* adds the cleaned up automl-text-sentiment-analysis notebook after running linter test

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* deletes the source file from the community/sdk folder

* updates the colab, git & workbench links in the notebook

* ran linter test

* updates the license year to 2022 and simplifies the clean-up step for bucket-deletion

* ran linter test

* adds TESTING env condition while deleting the buckets

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:09:10 -06:00
WhiteSource RenovateandGitHub 772e35ea75 chore(deps): update dependency nbqa to v1.3.1 (#374) 2022-03-09 08:24:16 -06:00
Andrew FerlitschandGitHub 1d28f886c8 feat: add example of FS values from dataframe (#373)
* feat: add FS from panda

* feat: add FS from panda
2022-03-08 17:44:59 -08:00
Andrew FerlitschandGitHub d3dc8aeb9a fix: missing create dataset schema (#371)
* fix: missing dataset create

* fix: missing dataset create
2022-03-07 11:53:39 -08:00
WhiteSource RenovateandGitHub a07d762934 chore(deps): update dependency nbqa to v1.3.0 (#368) 2022-03-07 09:53:42 -06:00
Andrew FerlitschandGitHub 85ac9e127d update: v1 (#366)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* update: v1

* update: v1
2022-03-04 17:47:56 -08:00
Gal ZahaviandGitHub 011c2823ff Update CODEOWNERS (#361) 2022-03-04 22:43:10 +02:00
Karl WeinmeisterandGitHub f28a94f03f docs: Add visualization of repo structure to README.md (#364) 2022-03-04 12:46:26 -06:00
5ecfc80cb9 Adds minor changes(license year and clean-up step) to Sdk automl video action recognition batch notebook (#355)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

* updates the license year to 2022 and simplifies the lean-up step for bucket created

* ran linter test

* removes the file from the community folder

* adds the TESTING env condition while deleting the buckets

* ran linter test successfully

* adds TESTING env condition while deleting the bucket

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-04 12:44:39 -06:00
Andrew FerlitschandGitHub e5e36ba050 fix: upgrades to v1 (#360)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 20:05:36 -08:00
Andrew FerlitschandGitHub 0ad9116d6a fix: v1 upgrades (#359)
* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 17:49:45 -08:00
0516032443 Update CODEOWNERS (#354)
* Update CODEOWNERS

* Update CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:23:19 -06:00
95d211c90f Fixing minor issues in sdk_automl_text_entity_extraction_online.ipynb (#329)
* modified colab,github,vertexAI links and added vertex logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:17:48 -06:00
12d6a75ef7 Fixing minor issues in sdk_automl_video_object_tracking_batch.ipynb (#328)
* changed master to main for links and added vertex AI logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:07:50 -06:00
Andrew FerlitschandGitHub 06153dc373 Update README.md 2022-03-02 11:45:01 -08:00
Andrew FerlitschandGitHub 02afa91fc3 Ml ops 6v3 (#352)
* fix: eval comp improvement

* fix: eval comp improvement

* feat: add to KFP get started
2022-03-02 10:38:42 -08:00
Karl WeinmeisterandGitHub c8b212789f Revert "ci: Apply filter to format_and_lint_job (#348)" (#351)
This reverts commit 95256d3fcf.
2022-03-02 09:44:03 -06:00
Karl WeinmeisterandGitHub 95256d3fcf ci: Apply filter to format_and_lint_job (#348)
* ci: Apply filter to format_and_lint_job

Only run when PR contains a notebook file

* Minor fix
2022-03-02 09:29:38 -06:00
Karl WeinmeisterandGitHub 8a6d174c99 Create README.md for notebooks folder 2022-03-01 19:44:41 -06:00
WhiteSource RenovateandGitHub d36cf7f662 chore(deps): update actions/setup-python action to v3 (#337) 2022-03-01 19:04:32 -06:00
WhiteSource RenovateandGitHub 1b02a542c8 chore(deps): update actions/checkout action to v3 (#347) 2022-03-01 19:02:39 -06:00
Ivan CheungandGitHub 45430bb010 Fixed minor issues (#345) 2022-03-01 14:56:50 -06:00
Ivan CheungandGitHub be2a139ade Delete notebooks/community/feature_store/assets directory 2022-02-28 20:21:17 -05:00
70d77b24f6 feature store e2e with assets (#343)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)

* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>

* Added files in their old folder

* Deleted unneeded file

* Ran linter

* Fixed CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-28 19:23:15 -05:00
Ivan CheungandGitHub 50c25d6d7b Revert "A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)" (#338)
This reverts commit 5bcdc0bc64.
2022-02-28 11:01:39 -05:00
5bcdc0bc64 A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-28 07:47:26 -08:00
eff0f95b58 Automl links fix (#330)
* fixing links to open notebook - main and images

* linter test changes

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:57:25 -06:00
50b53d31bd Jfacevedo endpoints tfhub obj detect (#319)
* Deploying TF Hub object detection model using Vertex endpoints

* Add user to codeowners

* fix path in CODEOWNERS

* clear all outputs

* run linter

* manual lint fix

* fix more linting errors

* order imports in alphabetical order

* run linter

* made changes requested on feedback

* automate fetching endpoint model id

* fix hardcoded value in bash command

* generalize region endpoint and project in bash cell

* retrieve endpoint and model ids programatically

* fix formatting

* run linter

* Remove pipfile

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:55:54 -06:00
Andrew FerlitschandGitHub b5a56852f3 fix: automl eval component improvement (#333)
* fix: eval comp improvement

* fix: eval comp improvement
2022-02-25 12:07:06 -08:00
b7486e34ad Sdk automl video action recognition batch (#310)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 11:31:19 -06:00
3edc5f1425 Notebook template (#326)
* modified vertex AI link

* minor change

* changed master to main and added vertex logo

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 10:16:34 -06:00
65b4b73cb5 Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook (#288)
* Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook.ipynb

* format with linter

* add import for tensorflow when in the testing environment

* linter

* fix dependency issues for testing env

* address comments

* eval component  does not output gcp_resources yet, still in experimental

* added location to aip.init

* add deletion for model and batch prediction jobs

* typo, missed a comma.

* linter

* Remove tensorflow import + use gsutil to check if artifacts exist.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 15:36:35 -08:00
Ivan CheungandGitHub 186c08e8c3 Update sdk_matching_engine_for_indexing.ipynb 2022-02-24 17:47:53 -05:00
Ivan CheungandGitHub 7721aa0def Added matching engine with SDK notebook (#327)
* Matching engine

* Added notebook

* Updated CODEOWNERS

* Fixed links

* Added logo

* Renamed Workbench
2022-02-24 14:57:16 -05:00
4987c60e03 updating gcloud usage because a flag was renamed (#320)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 09:33:33 -06:00
Andrew FerlitschandGitHub cd845f7fdd feat: start on model eval notebook (#325)
* fix: bqml export format

* fix: bqml export format

* feat: start on custom model eval

* feat: start on custom model eval
2022-02-23 12:56:01 -08:00
Andrew FerlitschandGitHub 9e84d9e782 fix: bqml doc for exporting model (#324)
* fix: bqml export format

* fix: bqml export format
2022-02-23 12:44:43 -08:00
nayaknishantandGitHub 23c7fcc97f fix: changed bucket URL from pantheon to console (#323)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console
2022-02-23 13:17:12 -06:00
e4024efbc7 feat: add community notebook for Vertex AI SDK Feature Store with Pandas (#311)
* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* fix: lint

* fix: addressed feedback

* fix: format

* fix: lint

* Linted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-23 10:22:28 -08:00
Ivan CheungandGitHub c4d53108af Matching Engine: Updated location for data (#322)
Switched to gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5
2022-02-23 12:03:48 -05:00
be8fe3564d Sdk automl video classification batch (#295)
* notebook refresh from vertex ai sdk project batch 1

* successfully ran linter test

* removed global variable import file

* update with linter test changes

* removing community version of dk_automl_video_classification_batch.ipynb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:11:42 -08:00
1f95775057 Sdk automl text entity extraction online (#283)
* added notebook

* ran linter

* fix aip not defined error

* ran lint

* resolved git comments

* ran linter

* deleted file in community folder and removed globals

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:07:55 -08:00
f2a4dd875e Sdk automl video object tracking batch (#281)
* added notebook

* changed folder

* reinstalled linter

* ran linter

* pulled new changes and merged

* resolved comments

* resolved comments

* ran linter

* deleted file in community folder and removed globals in file

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-22 21:06:52 -08:00
Aaron DietzandGitHub 67dd2300c8 updating text (#309) 2022-02-22 17:17:00 -05:00
Aaron DietzandGitHub b5391b06b4 Pricing optimization update (#308)
* updating text

* rename

* rename
2022-02-22 17:13:16 -05:00
Aaron DietzandGitHub 54f2c71c13 updating text (#307) 2022-02-22 16:51:54 -05:00
Aaron DietzandGitHub 6697900126 updating text (#306) 2022-02-22 16:39:46 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
9ff3400b44 build(deps): bump tensorflow (#316)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 13:01:06 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
3ff0726ebf build(deps): bump tensorflow (#315)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 08:54:19 -06:00
Amy WuandGitHub c96c939dfe Fix RL samples (#270)
* Update step_by_step sample

* Update mlops sample and fix worker_pool_specs issue for thr trainer component

* Fix lint

* Fix lint

* Fix lint

* Fix import order

* Fix nbfmt

* Update component.yaml

* Format notebook

* Update component.yaml url

* Lint
2022-02-17 16:37:52 -08:00
719cf280c9 Updating markdown text to meet higher standard (#305)
* Updating markdown text to meet higher standard

* formatted nb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-17 17:45:15 -06:00
4ec6e2df04 [community-content] PyTorch on Google Cloud Vertex AI - Fixes based on feedback (#290)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

* PyTorch on Vertex - fixes based on review

* PyTorch on Vertex - linter fixes

* PyTorch on Vertex - fixes based on feedback

* PyTorch on Vertex - fixes based on feedback

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 17:41:48 -06:00
031a9190c3 automl-tabular-classification.ipynb: Added missing code and removed unneeded text (#255)
* Added missing code and removed unneeded text

* Ran linter

* Ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 08:03:16 -08:00
5204dcf327 update training and batch predict notebook with importer (#303)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:56 -08:00
cad623ef84 update hp tuning sample to use importer (#302)
* update hp tuning sample to use importer

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:23 -08:00
a59f58f8b6 Use importer for the bqml (#299)
* Use importer for the bqml

* Update get_started_with_bqml_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:00:44 -08:00
nayaknishantandGitHub d89c613f5d moving REGION up (#300)
* moving REGION up

* moving REGION up and csv file name
2022-02-16 17:11:46 -08:00
Andrew FerlitschandGitHub fa265ddb2f feat: fix for sklearn XAI (#301)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1

* fix: XAI for sklearn

* fix: XAI for sklearn
2022-02-16 17:00:16 -08:00
ec3dd04935 SDK Featurestore notebook (#284)
* SDK Featurestore notebook

* fixed issues, tried to make notebook more readable, style

* removed previous notebook

* moved sdk-feature-store to community (for now)

* made fixes

* moved BQ output table cells down

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-02-16 16:04:43 -08:00
Andrew FerlitschandGitHub 0c83e81410 fix: 0.3.0 breaking change 2022-02-16 14:13:57 -08:00
Andrew FerlitschandGitHub 7808a843cc fix: breaking 0.3.0 change 2022-02-16 14:02:36 -08:00
Andrew FerlitschandGitHub 615d7706af fix: breaking change in 0.3.0 2022-02-16 13:53:35 -08:00
Ivan CheungandGitHub f05ca4d06a Added project to BQ client instantiation (#285) 2022-02-16 16:27:08 -05:00
Andrew FerlitschandGitHub cb4145e2b6 test: fix for testing (#298)
* test: fixes for testing

* test: fixes for testing
2022-02-16 11:23:45 -08:00
6917c9aa7b adding initial sample notebook for Tensorboard (#286)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 09:45:01 -08:00
Andrew FerlitschandGitHub c1d2451656 feat: update to v1 (#294)
* feat: update to v1

* feat: update to v1

* feat: update to v1

* feat: update to v1
2022-02-16 09:35:41 -08:00
Ivan CheungandGitHub c41ec1fabd Cleaned up cleanup section (#291) 2022-02-16 10:28:42 -05:00
Ivan CheungandGitHub 273c91882e Delete setup_env.md 2022-02-15 20:45:06 -05:00
Ivan CheungandGitHub ad6b5e5830 Update test_notebook_vm.txt 2022-02-15 18:17:11 -05:00
Ivan CheungandGitHub d441eb9d7a Update test_notebook_vm.txt 2022-02-15 18:14:37 -05:00
Andrew FerlitschandGitHub 139d805c9f feat: update to v1 (#292)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1
2022-02-15 11:20:22 -08:00
Andrew FerlitschandGitHub 783347fc8e feat: update FS notebook to use SDK (#287)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK
2022-02-14 13:21:28 -08:00
6d722d081d Fix links (#274)
* Fixes and renames link to launch automl-text-classification.pynb in Vertex AI Workbench

* Fixes and renames link to launch sdk_automl_tabular_forecasting_batch.pynb in Vertex AI Workbench

* Fixes links for launching notebook in Vertex AI Workbench for Explainable AI samples

* Fixes link for launching notebook in Vertex AI Workbench for model monitoring sample

* Fixes links to launch pipelines notebook samples

* Fixed lint problem in automl-text-classification.ipynb

* Autofixed lint errors

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-14 11:48:41 -05:00
Andrew FerlitschandGitHub 33a8c6ca0e feat: add create component example (#279)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example
2022-02-10 14:23:22 -08:00
Karl WeinmeisterandGitHub ae043400f5 Add survey to README.md (#272) 2022-02-10 14:52:33 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
e41f96b31f build(deps): bump tensorflow (#275)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:37:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
7220f15158 build(deps): bump tensorflow (#276)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:33:59 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
b8d7eaa767 build(deps): bump tensorflow (#278)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:31:20 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a612b463a8 build(deps): bump tensorflow (#277)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-10 09:16:10 -06:00
Andrew FerlitschandGitHub 493e7e81b5 Update README.md 2022-02-09 10:19:58 -08:00
Andrew FerlitschandGitHub b6cf0dbefd feat: XAI with sklearn (#273)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn
2022-02-09 10:17:16 -08:00
Brian KangandGitHub 5d5c08f9e7 Pytorch lightning sdk example - Missed Notebook added (#269)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Revert "Adjust Tensorboard to TensorBoard"

This reverts commit 9aac52e358b4ccc27a9a5a9e3bc5ef3305553462.

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard and and run lint
2022-02-08 16:36:30 -08:00
Andrew FerlitschandGitHub bfdfac0f81 feat: XAI notebook (#271)
* feat: get started XAI

* feat: get started XAI
2022-02-08 14:13:05 -08:00
Andrew FerlitschandGitHub 9c72b7e3e7 Update README.md 2022-02-08 12:57:22 -08:00
Andrew FerlitschandGitHub 46519e5c64 Update README.md 2022-02-08 12:26:57 -08:00
Brian KangandGitHub 0ff961e203 Pytorch lightning sdk example (#268)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model
2022-02-07 17:36:40 -08:00
Andrew FerlitschandGitHub cbc17c6832 feat: use gcsfuse (#265)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU

* feat: use gcsfuse

* feat: use gcsfuse
2022-02-04 11:17:51 -08:00
Andrew FerlitschandGitHub 93e5b15cba Update README.md 2022-02-04 11:09:31 -08:00
Andrew FerlitschandGitHub 081e65d076 Update README.md 2022-02-04 10:09:45 -08:00
Ivan CheungandGitHub 4ab2cfb713 feat: Added test_notebook_vm.txt to only test fast-running notebooks. Also fix private_pool not being used for tests. (#248)
* feat: Added test_notebook_vm.txt

* Propagate private pool to child builds

* Fixed workerpool issue

* Removed private pool requirement

* Added default pool

* Fixed private pool region issue

* Added comment

* Made private_pool_id arg optionally present

* Fixed when private pool is optional

* Fix regional issue bug

* Fixed pandas requirement

* Removed flaky notebook
2022-02-03 15:48:40 -05:00
Andrew FerlitschandGitHub a73335c0af feat: add batch and TPU (#262)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU
2022-02-02 17:45:31 -08:00
0f3e257773 Pricingoptimization (#249)
* added notebook

* ran lint

* updated main

* ran lint

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-02 13:25:41 -05:00
Andrew FerlitschandGitHub 57d734d84f fix: spelling (#260)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling
2022-02-01 17:07:10 -08:00
Andrew FerlitschandGitHub 07f2e9c999 Update README.md 2022-02-01 12:15:31 -08:00
Andrew FerlitschandGitHub 401883cae3 feat: add R notebook (#259)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook
2022-02-01 12:11:26 -08:00
7bc92e1e3c Update google_cloud_pipeline_components_automl_images.ipynb (#252)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-02-01 13:33:22 -06:00
de5f8b0653 Removed unneeded lines in linter (#257)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-01 12:19:19 -05:00
cfa73ed53b chore(deps): update dependency black to v22 (#254)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-31 13:50:57 -06:00
Andrew FerlitschandGitHub 67370bb1c7 Update README.md 2022-01-31 10:39:28 -08:00
Andrew FerlitschandGitHub f60593255a feat: add Pytorch notebook (#256)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook
2022-01-31 10:38:28 -08:00
Andrew FerlitschandGitHub c6f9b97615 test: rm caching of components (#247)
* fix: testing

* fix: testing

* fix: not installing pandas
2022-01-31 13:33:18 -05:00
Andrew FerlitschandGitHub 6161a394c2 fix: predict on exported BQML model (#250)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML
2022-01-27 10:35:20 -08:00
ivanmkc b35cd42015 Added exception check for deletion method 2022-01-27 11:54:29 -05:00
Ivan CheungandGitHub 5e323993db [WIP] Relax requirements for DLVM's (#238)
* Update requirements.txt

* Relax all CI requirements
2022-01-26 16:47:09 -05:00
Andrew FerlitschandGitHub f1623e419e Update README.md 2022-01-26 12:10:16 -08:00
Andrew FerlitschandGitHub a3047fb1bb feat: xgboost notebook (#246)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training
2022-01-26 12:09:07 -08:00
Karl WeinmeisterandGitHub b4d02f486e Update CODEOWNERS with new community blog post (#244) 2022-01-26 09:16:48 -08:00
9e24893b9b feat: Add sentiment analysis notebook (#195)
* added notebook

* ran lint

* resolved comments

* ran lint

* resolved comments

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-26 08:56:40 -06:00
47dec6ecef chore(deps): update dependency pyupgrade to v2.31.0 (#241)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:53:32 -06:00
059fea672c chore(deps): update dependency nbqa to v1.2.3 (#240)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:49:47 -06:00
389e804426 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#236)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:46:09 -06:00
Andrew FerlitschandGitHub 087a638c18 Update README.md 2022-01-25 22:16:55 -08:00
Andrew FerlitschandGitHub 97757c74ca feat: sklearn training (#243)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn
2022-01-25 22:15:51 -08:00
Andrew FerlitschandGitHub 08f3ad583b feat: finish hpt components notebook (#239)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook
2022-01-25 10:02:28 -08:00
Karl WeinmeisterandGitHub 16f01d31d3 chore: Update notebook template license date to 2022 (#237)
* chore: Update notebook template license date to 2022

* chore: Add extra space to address lint error
2022-01-25 11:20:00 -06:00
e0f6c66351 chore(deps): update dependency pandas to v1.4.0 (#233)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-24 13:58:50 -06:00
Ivan CheungandGitHub 3733b28772 Updated requirements (#235) 2022-01-24 14:54:31 -05:00
24f8912134 feat: Add inventory prediction notebook (#216)
* made changes

* made changes

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-24 14:07:42 -05:00
WhiteSource RenovateandGitHub cdc8847f9b chore(deps): update dependency papermill to v2.3.4 (#234) 2022-01-24 10:46:31 -06:00
Andrew FerlitschandGitHub 25bd4b9eb5 Update README.md 2022-01-21 19:05:35 -08:00
Andrew FerlitschandGitHub d476191252 feat: add notebooks (#232)
* feat: friday update

* feat: friday update
2022-01-21 17:14:31 -08:00
nicainandGitHub bf35d6a07c Add metadata to hide cells (#226) 2022-01-21 14:57:24 -08:00
5378d38a05 chore(deps): update dependency ipython to v8.0.1 (#222)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-21 11:15:14 -06:00
Ivan CheungandGitHub 85984f1173 Fixed broken Colab link 2022-01-20 17:52:56 -05:00
Ivan CheungandGitHub 92bb40349f Cleaned up cloud build by renaming files and moving methods around (#219)
* Cleaned up cloud build

* Fixed bug

* More renaming and comment cleanup

* Added helper file

* Fixed missing return
2022-01-20 15:55:38 -05:00
Rajesh ThallamandGitHub fcee9bf738 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#227)
* PyTorch on Vertex - Adding pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook, clearing outputs

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - reverting serving Dockerfile changes

* PyTorch on Vertex - linting fixes

* PyTorch on Vertex - updates to README

* PyTorch on Vertex - linter related fixes
2022-01-20 13:20:00 -06:00
nicainandGitHub cc2f3408ad Update Run After --> Run Selected Cell and All Below (#228) 2022-01-20 08:07:31 -06:00
nicainandGitHub 89fb218041 Alphafold on gcp tutorial (#221)
* Original alphafold Dockerfile and notebook as a starting point

* Migrate dependencies from notebook into Dockerfile

* adding build_docker.sh script for building docker image

* remove cell, and replace with accelerator configuration cell. Also remove dependency on google.colab

* dockerfile remove redundant

* Changing text in launch button

* add vertexai.png

* update notebook, including permalink to vertexai.png

* updating notebook markdown and correcting the vertexai.png image display

* add div brackets and fix broken launch link

* table instead of div

* width=40

* resizing vertexai image

* updated FAQ

* updated Licence

* add back in the output_file zip

* launch button at top of notebook

* default workdir aligned with JuptyerLab home directory

* intro paragraph

* update CPU instructions

* exchange notebook title and launch header

* Dockerfile license

* collapsing cells

* splitting out sequences into un-collapsed cell

* Update licence

* update download instructions text

* Remove "double-click" text

* hide cells

* Increasing indent to pass linting for alphafold_on_gcp (#224)

* increasing indent to pass linting

* more linting

* wild

* AMBER relaxation f-string

* hidden cells

* wild commit

* move links to main
2022-01-19 18:47:21 -08:00
Andrew FerlitschandGitHub 4d0c3781e5 Update README.md 2022-01-19 12:30:01 -08:00
Andrew FerlitschandGitHub e2e319ac7f Update README.md 2022-01-19 11:08:55 -08:00
Andrew FerlitschandGitHub 63508cad3f feat: add ml metadata notebook (#223)
* weekly updates

* weekly updates

* feat: add metadata notebook

* feat: add metadata notebook
2022-01-19 10:58:03 -08:00
0b6eb6eed1 Updates to automl tabular beans pipeline (#220)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-18 15:34:57 -06:00
Polong LinandGitHub a41cfdeba5 Fix typo: Wikepedia --> Wikipedia (#217) 2022-01-18 08:28:04 -06:00
7a6763ca33 chore(deps): update dependency numpy to v1.22.1 (#214)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 17:10:52 -06:00
Sara RobinsonandGitHub 2a6e19e4f9 Update MLMD notebook to use pipeline submit() method (#215) 2022-01-14 17:09:45 -06:00
9f9526b722 Delete Dockerfile (#198)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 14:28:30 -05:00
Ivan CheungandGitHub 267684b7c3 Added private pool to cloud build config (#211) 2022-01-14 14:27:34 -05:00
Andrew FerlitschandGitHub b74dd3d576 Update README.md 2022-01-13 16:22:14 -08:00
Andrew FerlitschandGitHub 278ae48842 Update README.md 2022-01-13 16:21:28 -08:00
Andrew FerlitschandGitHub 189ca12627 Update README.md 2022-01-13 16:20:39 -08:00
Andrew FerlitschandGitHub 5108f57ba8 feat: weekly updates (#212)
* weekly updates

* weekly updates
2022-01-13 16:19:21 -08:00
212 changed files with 93699 additions and 19370 deletions
+9 -7
View File
@@ -1,10 +1,9 @@
from typing import List
from resource_cleanup_manager import (
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
)
from resource_cleanup_manager import (DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
ResourceCleanupManager)
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
@@ -22,7 +21,10 @@ def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: boo
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
manager.delete(resource)
try:
manager.delete(resource)
except Exception as exception:
print(exception)
print("")
@@ -1,8 +1,9 @@
import abc
from google.cloud import aiplatform
from typing import Any
from proto.datetime_helpers import DatetimeWithNanoseconds
from google.cloud import aiplatform
from google.cloud.aiplatform import base
from proto.datetime_helpers import DatetimeWithNanoseconds
# If a resource was updated within this number of seconds, do not delete.
RESOURCE_UPDATE_BUFFER_IN_SECONDS = 60 * 60 * 8
+116
View File
@@ -0,0 +1,116 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
import argparse
import pathlib
import execute_changed_notebooks_helper
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--timeout",
type=int,
help="Timeout in seconds",
default=86400,
required=False,
)
parser.add_argument(
"--private_pool_id",
type=str,
help="The private pool id.",
required=False,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
)
execute_changed_notebooks_helper.process_and_execute_notebooks(
notebooks=notebooks,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
private_pool_id=args.private_pool_id,
should_parallelize=args.should_parallelize,
timeout=args.timeout,
)
@@ -13,34 +13,26 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import concurrent
import dataclasses
import datetime
import functools
import operator
import os
import pathlib
import nbformat
import re
import subprocess
from typing import List, Optional
from tabulate import tabulate
import operator
import execute_notebook_remote
from utils import util, NotebookProcessors
import nbformat
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
from ratemate import RateLimit
from tabulate import tabulate
from utils import NotebookProcessors, util
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
# A buffer so that workers finish before the orchestrating job
WORKER_TIMEOUT_BUFFER_IN_SECONDS: int = 60 * 60
def format_timedelta(delta: datetime.timedelta) -> str:
@@ -115,15 +107,22 @@ def _create_tag(filepath: str) -> str:
return tag
def execute_notebook(
rate_limit = RateLimit(max_count=50, per=60, greedy=True)
def process_and_execute_notebook(
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
deadline: datetime,
notebook: str,
should_get_tail_logs: bool = False,
) -> NotebookExecutionResult:
rate_limit.wait() # wait before creating the task
print(f"Running notebook: {notebook}")
# Create paths
@@ -156,12 +155,20 @@ def execute_notebook(
# Upload the pre-processed code to a GCS bucket
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
# Calculate timeout in seconds
timeout_in_seconds = max(
int((deadline - datetime.datetime.now()).total_seconds()), 1
)
operation = execute_notebook_remote.execute_notebook_remote(
code_archive_uri=code_archive_uri,
notebook_uri=notebook,
notebook_output_uri=notebook_output_uri,
container_uri=container_uri,
tag=tag,
private_pool_id=private_pool_id,
private_pool_region=variable_region,
timeout_in_seconds=timeout_in_seconds,
)
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
@@ -202,41 +209,13 @@ def execute_notebook(
return result
def run_changed_notebooks(
def get_changed_notebooks(
test_paths_file: str,
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
should_parallelize: bool,
base_branch: Optional[str] = None,
):
) -> List[str]:
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
Get the notebooks that exist under the folders defined in the test_paths_file.
It only returns notebooks that have differences from the Git base_branch.
"""
test_paths = []
@@ -266,8 +245,55 @@ def run_changed_notebooks(
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
return notebooks
def process_and_execute_notebooks(
notebooks: List[str],
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
should_parallelize: bool,
timeout: int,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
timeout (str):
Required. Timeout string according to https://cloud.google.com/build/docs/build-config-file-schema#timeout.
"""
notebook_execution_results: List[NotebookExecutionResult] = []
# Calculate deadline
deadline = datetime.datetime.now() + datetime.timedelta(
seconds=max(timeout - WORKER_TIMEOUT_BUFFER_IN_SECONDS, 0)
)
if len(notebooks) > 0:
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
@@ -275,28 +301,34 @@ def run_changed_notebooks(
print(
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
)
with concurrent.futures.ThreadPoolExecutor(max_workers=None) as executor:
with concurrent.futures.ThreadPoolExecutor(max_workers=100) as executor:
print(f"Max workers: {executor._max_workers}")
notebook_execution_results = list(
executor.map(
functools.partial(
execute_notebook,
process_and_execute_notebook,
container_uri,
staging_bucket,
artifacts_bucket,
variable_project_id,
variable_region,
private_pool_id,
deadline,
),
notebooks,
)
)
else:
notebook_execution_results = [
execute_notebook(
process_and_execute_notebook(
container_uri=container_uri,
staging_bucket=staging_bucket,
artifacts_bucket=artifacts_bucket,
variable_project_id=variable_project_id,
variable_region=variable_region,
private_pool_id=private_pool_id,
deadline=deadline,
notebook=notebook,
)
for notebook in notebooks
@@ -341,67 +373,3 @@ def run_changed_notebooks(
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
run_changed_notebooks(
test_paths_file=args.test_paths_file,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
should_parallelize=args.should_parallelize,
base_branch=args.base_branch,
)
+7 -4
View File
@@ -13,10 +13,13 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import ExecuteNotebook
"""A CLI to download (optional) and run a single notebook locally"""
parser = argparse.ArgumentParser(description="Run changed notebooks.")
import argparse
import execute_notebook_helper
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
parser.add_argument(
"--notebook_source",
type=str,
@@ -31,7 +34,7 @@ parser.add_argument(
)
args = parser.parse_args()
ExecuteNotebook.execute_notebook(
execute_notebook_helper.execute_notebook(
notebook_source=args.notebook_source,
output_file_or_uri=args.output_file_or_uri,
should_log_output=True,
@@ -13,14 +13,16 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import sys
import os
import errno
import papermill as pm
import shutil
"""Methods to run a notebook locally"""
from utils import util
import errno
import os
import shutil
import sys
import papermill as pm
from google.cloud.aiplatform import utils
from utils import util
# This script is used to execute a notebook and write out the output notebook.
@@ -30,6 +32,7 @@ def execute_notebook(
output_file_or_uri: str,
should_log_output: bool,
):
"""Execute a single notebook using Papermill"""
file_name = os.path.basename(os.path.normpath(notebook_source))
# Download notebook if it's a GCS URI
+52 -24
View File
@@ -1,18 +1,34 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook on Google Cloud Build"""
from re import sub
from typing import Optional
import google.auth
import yaml
from google.api_core import client_options, operation
from google.cloud.aiplatform import utils
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from google.protobuf import duration_pb2
from yaml.loader import FullLoader
import google.auth
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from typing import Optional
import yaml
from google.cloud.aiplatform import utils
from google.api_core import operation
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
TIMEOUT_IN_SECONDS = 86400
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
def execute_notebook_remote(
@@ -20,20 +36,14 @@ def execute_notebook_remote(
notebook_uri: str,
notebook_output_uri: str,
container_uri: str,
private_pool_id: Optional[str],
private_pool_region: Optional[str],
tag: Optional[str],
timeout_in_seconds: Optional[int] = None,
) -> operation.Operation:
"""Create and execute a simple Google Cloud Build configuration,
print the in-progress status and print the completed status."""
"""Create and execute a single notebook on Google Cloud Build"""
# Load build steps from YAML
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient()
build = cloudbuild_v1.Build()
# The following build steps will output "hello world"
# For more information on build configuration, see
# https://cloud.google.com/build/docs/configuring-builds/create-basic-configuration
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
substitutions = {
@@ -42,6 +52,24 @@ def execute_notebook_remote(
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
}
build = cloudbuild_v1.Build()
options: Optional[client_options.ClientOptions] = None
if private_pool_id and private_pool_region:
# substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
build.options = cloudbuild_config.get("options")
build.options.pool = {"name": private_pool_id}
# Switch to the regional endpoint of the pool
options = client_options.ClientOptions(
api_endpoint=f"{private_pool_region}-{SERVICE_BASE_PATH}"
)
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
(
source_archived_file_gcs_bucket,
source_archived_file_gcs_object,
@@ -56,8 +84,8 @@ def execute_notebook_remote(
build.steps = cloudbuild_config["steps"]
build.substitutions = substitutions
build.timeout = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
build.queue_ttl = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
build.timeout = duration_pb2.Duration(seconds=timeout_in_seconds)
build.queue_ttl = duration_pb2.Duration(seconds=timeout_in_seconds)
if tag:
build.tags = [tag]
@@ -25,4 +25,4 @@ steps:
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"'
env:
- 'IS_TESTING=1'
timeout: 86400s
timeout: 86400s
@@ -5,10 +5,6 @@ steps:
args:
- -c
- 'gcloud config list'
# # Clone the Git repo
# - name: ${_PYTHON_IMAGE}
# entrypoint: git
# args: ['clone', "${_GIT_REPO}", "--branch", "${_GIT_BRANCH_NAME}", "."]
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
@@ -28,11 +24,15 @@ steps:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
# Install Python dependencies and run testing script
# TODO: Only pass in private_pool_id if it is set
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`'
env:
- 'IS_TESTING=1'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
+8 -8
View File
@@ -1,12 +1,12 @@
ipython==8.0.0
jupyter==1.0.0
nbconvert==6.4.0
papermill==2.3.3
numpy==1.22.0
pandas==1.3.5
matplotlib==3.5.1
ipython
numpy
jupyter
nbconvert
papermill
pandas
matplotlib
tabulate
google-cloud-aiplatform
google-cloud-storage
google-cloud-build
gcloud
ratemate
+1
View File
@@ -1,2 +1,3 @@
notebooks/official
notebooks/notebook_template.ipynb
notebooks/community/ml_ops
+5
View File
@@ -0,0 +1,5 @@
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/matching_engine/intro-swivel.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
+4 -2
View File
@@ -13,8 +13,10 @@
# See the License for the specific language governing permissions and
# limitations under the License.
from nbconvert.preprocessors import Preprocessor
from typing import Dict
from nbconvert.preprocessors import Preprocessor
from . import UpdateNotebookVariables as update_notebook_variables
@@ -60,4 +62,4 @@ class UpdateVariablesPreprocessor(Preprocessor):
executable_cells.append(cell)
notebook.cells = executable_cells
return notebook, resources
return notebook, resources
@@ -78,4 +78,4 @@ def test_region():
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
+9 -9
View File
@@ -1,17 +1,17 @@
from datetime import datetime
from typing import Optional
from google.cloud import storage
from google.cloud.aiplatform import utils
from google.auth import credentials as auth_credentials
import os
import subprocess
import tarfile
import uuid
from datetime import datetime
from typing import Optional
from google.auth import credentials as auth_credentials
from google.cloud import storage
from google.cloud.aiplatform import utils
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
"""Copies a remote GCS file to a local path."""
"""Copies a remote GCS file to a local path"""
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
subprocess.check_output(
@@ -25,7 +25,7 @@ def upload_file(
local_file_path: str,
remote_file_path: str,
) -> str:
"""Copies a local file to a GCS path."""
"""Copies a local file to a GCS path"""
subprocess.check_output(
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
)
@@ -57,4 +57,4 @@ def archive_code_and_upload(staging_bucket: str):
print(f"Uploaded source code archive to {source_archived_file_gcs}")
return source_archived_file_gcs
return source_archived_file_gcs
+6 -6
View File
@@ -2,17 +2,17 @@ If you are opening a PR for `Official Notebooks` under the [notebooks/official](
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
+2 -2
View File
@@ -7,9 +7,9 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Set up Python
uses: actions/setup-python@v2
uses: actions/setup-python@v3
- name: Fetch pull request branch
uses: actions/checkout@v2
uses: actions/checkout@v3
with:
fetch-depth: 0
- name: Fetch base main branch
+3 -3
View File
@@ -2,8 +2,8 @@ git+https://github.com/tensorflow/docs
ipython
jupyter
nbconvert
black==21.10b0
pyupgrade==2.29.1
black==22.3.0
pyupgrade==2.31.1
isort==5.10.1
flake8==4.0.1
nbqa==1.2.2
nbqa==1.3.1
+4 -4
View File
@@ -84,19 +84,19 @@ if [ ${#notebooks[@]} -gt 0 ]; then
FLAKE8_RTN=$?
else
echo "Running black..."
python3 -m nbqa black "$notebook" --nbqa-mutate
python3 -m nbqa black "$notebook"
BLACK_RTN=$?
echo "Running pyupgrade..."
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
python3 -m nbqa pyupgrade "$notebook"
PYUPGRADE_RTN=$?
echo "Running isort..."
python3 -m nbqa isort "$notebook" --nbqa-mutate
python3 -m nbqa isort "$notebook"
ISORT_RTN=$?
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
NBFMT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291 --nbqa-mutate
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
FLAKE8_RTN=$?
fi
+17 -1
View File
@@ -6,7 +6,19 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
## Overview
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [Community Content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
## Repository structure
```bash
├── community-content - Sample code and tutorials contributed by the community
├── notebooks
│ ├── community - Notebooks contributed by the community
│ ├── official - Notebooks demonstrating use of each Vertex AI service
│ │ ├── automl
│ │ ├── custom
│ │ ├── ...
```
## Contributing
@@ -19,3 +31,7 @@ Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-sa
## Disclaimer
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
## Feedback
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
+3 -1
View File
@@ -1,4 +1,6 @@
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/pluto_on_workbench @wkharold
@@ -0,0 +1,824 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "pc5-mbsX9PZC"
},
"source": [
"# AlphaFold On Vertex AI Workbench\n",
"\n",
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
"\n",
"## ![](https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/alphafold_on_workbench/vertexai_40.png) [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
"\n",
"**Differences to AlphaFold v2.1.0**\n",
"\n",
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
"\n",
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
"\n",
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
"\n",
"**Citing this work**\n",
"\n",
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
"\n",
"**Licenses**\n",
"\n",
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
"\n",
"\n",
"**More information**\n",
"\n",
"You can find more information about how AlphaFold works in the following papers:\n",
"\n",
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
"\n",
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b7a02613eb1a"
},
"source": [
"## Download AlphaFold Data"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "woIxeCPygt7K"
},
"outputs": [],
"source": [
"import os\n",
"import subprocess\n",
"import sys\n",
"\n",
"import alphafold.common\n",
"import tqdm.notebook\n",
"from IPython.utils import io\n",
"\n",
"TQDM_BAR_FORMAT = (\n",
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
")\n",
"\n",
"SOURCE_URL = (\n",
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
")\n",
"PARAMS_DIR = \"alphafold/data/params\"\n",
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
"\n",
"try:\n",
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" with io.capture_output() as captured:\n",
"\n",
" # Download and store stereo_chemical_props.txt\n",
" !mkdir -p ~/content/alphafold/alphafold/common\n",
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
" pbar.update(18)\n",
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
"\n",
" # Download alphafold_params_colab_2021-10-27.tar\n",
" !mkdir --parents \"{PARAMS_DIR}\"\n",
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
" pbar.update(27)\n",
"\n",
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
" # !rm \"{PARAMS_PATH}\"\n",
" pbar.update(55)\n",
"\n",
"except subprocess.CalledProcessError:\n",
" print(captured)\n",
" raise"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d8926b7d5529"
},
"source": [
"## Configure GPU Acceleration"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "VzJ5iMjTtoZw"
},
"outputs": [],
"source": [
"# Confirm accelerator configuration\n",
"import jax\n",
"\n",
"if jax.local_devices()[0].platform == \"tpu\":\n",
" raise RuntimeError(\n",
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
" )\n",
"elif jax.local_devices()[0].platform == \"cpu\":\n",
" print(\n",
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
" )\n",
"else:\n",
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
"\n",
"# Make sure all necessary environment variables are set.\n",
"import os\n",
"\n",
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "W4JpOs6oA-QS"
},
"source": [
"## Making a prediction\n",
"\n",
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
"\n",
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
"\n",
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
"\n",
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b310d44229d0"
},
"outputs": [],
"source": [
"# Input sequences (type: str)\n",
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
"sequence_2 = \"\"\n",
"sequence_3 = \"\"\n",
"sequence_4 = \"\"\n",
"sequence_5 = \"\"\n",
"sequence_6 = \"\"\n",
"sequence_7 = \"\"\n",
"sequence_8 = \"\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "rowN0bVYLe9n"
},
"outputs": [],
"source": [
"from alphafold.notebooks import notebook_utils\n",
"\n",
"input_sequences = (\n",
" sequence_1,\n",
" sequence_2,\n",
" sequence_3,\n",
" sequence_4,\n",
" sequence_5,\n",
" sequence_6,\n",
" sequence_7,\n",
" sequence_8,\n",
")\n",
"\n",
"# If folding a complex target and all the input sequences are\n",
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
"# otherwise or if the origin is unknown.\n",
"\n",
"is_prokaryote = False # @param {type:\"boolean\"}\n",
"\n",
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
"MAX_MULTIMER_LENGTH = 2500\n",
"\n",
"# Validate the input.\n",
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
" input_sequences=input_sequences,\n",
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "db551d4877ea"
},
"source": [
"## Search against genetic databases\n",
"\n",
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "2tTeTTsLKPjB"
},
"outputs": [],
"source": [
"import collections\n",
"import copy\n",
"import random\n",
"from concurrent import futures\n",
"from urllib import request\n",
"\n",
"import matplotlib.pyplot as plt\n",
"import numpy as np\n",
"import py3Dmol\n",
"from alphafold.common import protein\n",
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
" pipeline_multimer)\n",
"from alphafold.data.tools import jackhmmer\n",
"from alphafold.model import config, data, model\n",
"from alphafold.relax import relax, utils\n",
"from IPython import display\n",
"from ipywidgets import GridspecLayout, Output\n",
"\n",
"# Color bands for visualizing plddt\n",
"PLDDT_BANDS = [\n",
" (0, 50, \"#FF7D45\"),\n",
" (50, 70, \"#FFDB13\"),\n",
" (70, 90, \"#65CBF3\"),\n",
" (90, 100, \"#0053D6\"),\n",
"]\n",
"\n",
"# --- Find the closest source ---\n",
"test_url_pattern = (\n",
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
")\n",
"ex = futures.ThreadPoolExecutor(3)\n",
"\n",
"\n",
"def fetch(source):\n",
" request.urlretrieve(test_url_pattern.format(source))\n",
" return source\n",
"\n",
"\n",
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
"source = None\n",
"for f in futures.as_completed(fs):\n",
" source = f.result()\n",
" ex.shutdown()\n",
" break\n",
"\n",
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
"# The z_value is the number of sequences in a database.\n",
"MSA_DATABASES = [\n",
" {\n",
" \"db_name\": \"uniref90\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 59,\n",
" \"z_value\": 135_301_051,\n",
" },\n",
" {\n",
" \"db_name\": \"smallbfd\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
" \"num_streamed_chunks\": 17,\n",
" \"z_value\": 65_984_053,\n",
" },\n",
" {\n",
" \"db_name\": \"mgnify\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
" \"num_streamed_chunks\": 71,\n",
" \"z_value\": 304_820_129,\n",
" },\n",
"]\n",
"\n",
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
" MSA_DATABASES.extend(\n",
" [\n",
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
" {\n",
" \"db_name\": \"uniprot\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 98,\n",
" \"z_value\": 219_174_961 + 565_254,\n",
" },\n",
" ]\n",
" )\n",
"\n",
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
"\n",
"MAX_HITS = {\n",
" \"uniref90\": 10_000,\n",
" \"smallbfd\": 5_000,\n",
" \"mgnify\": 501,\n",
" \"uniprot\": 50_000,\n",
"}\n",
"\n",
"\n",
"def get_msa(fasta_path):\n",
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
"\n",
" # Run the search against chunks of genetic databases.\n",
" raw_msa_results = collections.defaultdict(list)\n",
" with tqdm.notebook.tqdm(\n",
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
" ) as pbar:\n",
"\n",
" def jackhmmer_chunk_callback(i):\n",
" pbar.update(n=1)\n",
"\n",
" for db_config in MSA_DATABASES:\n",
" db_name = db_config[\"db_name\"]\n",
" pbar.set_description(f\"Searching {db_name}\")\n",
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
" binary_path=JACKHMMER_BINARY_PATH,\n",
" database_path=db_config[\"db_path\"],\n",
" get_tblout=True,\n",
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
" streaming_callback=jackhmmer_chunk_callback,\n",
" z_value=db_config[\"z_value\"],\n",
" )\n",
" # Group the results by database name.\n",
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
"\n",
" return raw_msa_results\n",
"\n",
"\n",
"features_for_chain = {}\n",
"raw_msa_results_for_sequence = {}\n",
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
"\n",
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
" with open(fasta_path, \"wt\") as f:\n",
" f.write(f\">query\\n{sequence}\")\n",
"\n",
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
" if sequence not in raw_msa_results_for_sequence:\n",
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
" else:\n",
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
"\n",
" # Extract the MSAs from the Stockholm files.\n",
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
" single_chain_msas = []\n",
" uniprot_msa = None\n",
" for db_name, db_results in raw_msa_results.items():\n",
" merged_msa = notebook_utils.merge_chunked_msa(\n",
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
" )\n",
" if merged_msa.sequences and db_name != \"uniprot\":\n",
" single_chain_msas.append(merged_msa)\n",
" msa_size = len(set(merged_msa.sequences))\n",
" print(\n",
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
" )\n",
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
" uniprot_msa = merged_msa\n",
"\n",
" notebook_utils.show_msa_info(\n",
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
" )\n",
"\n",
" # Turn the raw data into model features.\n",
" feature_dict = {}\n",
" feature_dict.update(\n",
" pipeline.make_sequence_features(\n",
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
" )\n",
" )\n",
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
" feature_dict.update(\n",
" notebook_utils.empty_placeholder_template_features(\n",
" num_templates=0, num_res=len(sequence)\n",
" )\n",
" )\n",
"\n",
" # Construct the all_seq features only for heteromers, not homomers.\n",
" if (\n",
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
" and len(set(sequences)) > 1\n",
" ):\n",
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
" \"msa_uniprot_accession_identifiers\",\n",
" \"msa_species_identifiers\",\n",
" )\n",
" all_seq_features = {\n",
" f\"{k}_all_seq\": v\n",
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
" if k in valid_feats\n",
" }\n",
" feature_dict.update(all_seq_features)\n",
"\n",
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
"\n",
"\n",
"# Do further feature post-processing depending on the model type.\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
"\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" all_chain_features = {}\n",
" for chain_id, chain_features in features_for_chain.items():\n",
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
" chain_features, chain_id\n",
" )\n",
"\n",
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
"\n",
" np_example = feature_processing.pair_and_merge(\n",
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
" )\n",
"\n",
" # Pad MSA to avoid zero-sized extra_msa.\n",
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9640643486bd"
},
"source": [
"## Run AlphaFold\n",
"\n",
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "XUo6foMQxwS2"
},
"outputs": [],
"source": [
"run_relax = True\n",
"\n",
"# --- Run the model ---\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
"\n",
"output_dir = \"prediction\"\n",
"os.makedirs(output_dir, exist_ok=True)\n",
"\n",
"plddts = {}\n",
"ranking_confidences = {}\n",
"pae_outputs = {}\n",
"unrelaxed_proteins = {}\n",
"\n",
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" for model_name in model_names:\n",
" pbar.set_description(f\"Running {model_name}\")\n",
"\n",
" cfg = config.model_config(model_name)\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" cfg.data.eval.num_ensemble = 1\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" cfg.model.num_ensemble_eval = 1\n",
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
" model_runner = model.RunModel(cfg, params)\n",
" processed_feature_dict = model_runner.process_features(\n",
" np_example, random_seed=0\n",
" )\n",
" prediction = model_runner.predict(\n",
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
" )\n",
"\n",
" mean_plddt = prediction[\"plddt\"].mean()\n",
"\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" if \"predicted_aligned_error\" in prediction:\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
" else:\n",
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
" # should never get selected.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" # Multimer models are sorted by pTM+ipTM.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
"\n",
" # Set the b-factors to the per-residue plddt.\n",
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
" unrelaxed_protein = protein.from_prediction(\n",
" processed_feature_dict,\n",
" prediction,\n",
" b_factors=b_factors,\n",
" remove_leading_feature_dimension=(\n",
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
" ),\n",
" )\n",
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
"\n",
" # Delete unused outputs to save memory.\n",
" del model_runner\n",
" del params\n",
" del prediction\n",
" pbar.update(n=1)\n",
"\n",
" # --- AMBER relax the best model ---\n",
"\n",
" # Find the best model according to the mean pLDDT.\n",
" best_model_name = max(\n",
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
" )\n",
"\n",
" if run_relax:\n",
" pbar.set_description(\"AMBER relaxation\")\n",
" amber_relaxer = relax.AmberRelaxation(\n",
" max_iterations=0,\n",
" tolerance=2.39,\n",
" stiffness=10.0,\n",
" exclude_residues=[],\n",
" max_outer_iterations=3,\n",
" )\n",
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
" prot=unrelaxed_proteins[best_model_name]\n",
" )\n",
" else:\n",
" print(\"Warning: Running without the relaxation stage.\")\n",
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
" pbar.update(n=1) # Finished AMBER relax.\n",
"\n",
"# Construct multiclass b-factors to indicate confidence bands\n",
"# 0=very low, 1=low, 2=confident, 3=very high\n",
"banded_b_factors = []\n",
"for plddt in plddts[best_model_name]:\n",
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
" if plddt >= min_val and plddt <= max_val:\n",
" banded_b_factors.append(idx)\n",
" break\n",
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
"\n",
"\n",
"# Write out the prediction\n",
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
"with open(pred_output_path, \"w\") as f:\n",
" f.write(relaxed_pdb)\n",
"\n",
"\n",
"# --- Visualise the prediction & confidence ---\n",
"show_sidechains = True\n",
"\n",
"\n",
"def plot_plddt_legend():\n",
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
" thresh = [\n",
" \"Very low (pLDDT < 50)\",\n",
" \"Low (70 > pLDDT > 50)\",\n",
" \"Confident (90 > pLDDT > 70)\",\n",
" \"Very high (pLDDT > 90)\",\n",
" ]\n",
"\n",
" colors = [x[2] for x in PLDDT_BANDS]\n",
"\n",
" plt.figure(figsize=(2, 2))\n",
" for c in colors:\n",
" plt.bar(0, 0, color=c)\n",
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
" plt.xticks([])\n",
" plt.yticks([])\n",
" ax = plt.gca()\n",
" ax.spines[\"right\"].set_visible(False)\n",
" ax.spines[\"top\"].set_visible(False)\n",
" ax.spines[\"left\"].set_visible(False)\n",
" ax.spines[\"bottom\"].set_visible(False)\n",
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
" return plt\n",
"\n",
"\n",
"# Show the structure coloured by chain if the multimer model has been used.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" multichain_view = py3Dmol.view(width=800, height=600)\n",
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
" multichain_view.zoomTo()\n",
" multichain_view.show()\n",
"\n",
"# Color the structure by per-residue pLDDT\n",
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
"view = py3Dmol.view(width=800, height=600)\n",
"view.addModelsAsFrames(to_visualize_pdb)\n",
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
"if show_sidechains:\n",
" style[\"stick\"] = {}\n",
"view.setStyle({\"model\": -1}, style)\n",
"view.zoomTo()\n",
"\n",
"grid = GridspecLayout(1, 2)\n",
"out = Output()\n",
"with out:\n",
" view.show()\n",
"grid[0, 0] = out\n",
"\n",
"out = Output()\n",
"with out:\n",
" plot_plddt_legend().show()\n",
"grid[0, 1] = out\n",
"\n",
"display.display(grid)\n",
"\n",
"# Display pLDDT and predicted aligned error (if output by the model).\n",
"if pae_outputs:\n",
" num_plots = 2\n",
"else:\n",
" num_plots = 1\n",
"\n",
"plt.figure(figsize=[8 * num_plots, 6])\n",
"plt.subplot(1, num_plots, 1)\n",
"plt.plot(plddts[best_model_name])\n",
"plt.title(\"Predicted LDDT\")\n",
"plt.xlabel(\"Residue\")\n",
"plt.ylabel(\"pLDDT\")\n",
"\n",
"if num_plots == 2:\n",
" plt.subplot(1, 2, 2)\n",
" pae, max_pae = list(pae_outputs.values())[0]\n",
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
" plt.colorbar(fraction=0.046, pad=0.04)\n",
"\n",
" # Display lines at chain boundaries.\n",
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
" chain_ids = best_unrelaxed_prot.chain_index\n",
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
" if chain_boundary.size:\n",
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
"\n",
" plt.title(\"Predicted Aligned Error\")\n",
" plt.xlabel(\"Scored residue\")\n",
" plt.ylabel(\"Aligned residue\")\n",
"\n",
"# Save the predicted aligned error (if it exists).\n",
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
"if pae_outputs:\n",
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
" with open(pae_output_path, \"w\") as f:\n",
" f.write(pae_data)\n",
"\n",
"!zip -q -r {output_dir}.zip {output_dir}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lUQAn5LYC5n4"
},
"source": [
"### Interpreting the prediction\n",
"\n",
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
"\n",
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jeb2z8DIA4om"
},
"source": [
"## FAQ & Troubleshooting\n",
"\n",
"\n",
"* How do I get a predicted protein structure for my protein?\n",
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
"* How long will this take?\n",
" * The search against genetic databases can take minutes to hours.\n",
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
"* My notebook no longer seems to be doing anything, what should I do?\n",
" * Some steps may take minutes to hours to complete.\n",
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
"* How does this compare to the open-source version of AlphaFold?\n",
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
"* Does this tool install anything on my computer?\n",
" * No, everything happens in the VM instance within your Google Cloud project.\n",
"* How should I share feedback and bug reports?\n",
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
"\n",
"\n",
"## Related work\n",
"\n",
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
"\n",
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "YfPhvYgKC81B"
},
"source": [
"# License and Disclaimer\n",
"\n",
"This is not an officially-supported Google product.\n",
"\n",
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
"\n",
"Copyright 2021 DeepMind Technologies Limited.\n",
"\n",
"\n",
"## AlphaFold Code License\n",
"\n",
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
"\n",
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
"\n",
"## Model Parameters License\n",
"\n",
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
"\n",
"\n",
"## Third-party software\n",
"\n",
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
"\n",
"\n",
"## Mirrored Databases\n",
"\n",
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
]
}
],
"metadata": {
"accelerator": "GPU",
"colab": {
"collapsed_sections": [],
"name": "AlphaFold.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,82 @@
# Copyright 2022 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
ARG CUDA_MAJOR=11
ARG CUDA_MINOR=0
FROM gcr.io/deeplearning-platform-release/base-cu110
ARG CUDA_MAJOR
ARG CUDA_MINOR
SHELL ["/bin/bash", "-c"]
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
build-essential \
cmake \
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
git \
hmmer \
kalign \
tzdata \
wget \
&& rm -rf /var/lib/apt/lists/*
# Compile HHsuite from source.
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
&& mkdir /tmp/hh-suite/build \
&& pushd /tmp/hh-suite/build \
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
&& make -j 4 && make install \
&& ln -s /opt/hhsuite/bin/* /usr/bin \
&& popd \
&& rm -rf /tmp/hh-suite
ENV PATH="/opt/conda/bin:$PATH"
RUN conda update -qy conda \
&& conda install -y -c conda-forge \
openmm=7.5.1 \
cudatoolkit==${CUDA_VERSION} \
pdbfixer \
pip \
python=3.7
COPY . /app/alphafold
# Install pip packages.
RUN pip3 install --upgrade pip \
&& pip3 install -r /app/alphafold/requirements.txt \
&& pip3 install py3Dmol tqdm \
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
https://storage.googleapis.com/jax-releases/jax_releases.html
# Install alphafold.
WORKDIR /app/alphafold
RUN python setup.py install
# Apply OpenMM patch.
WORKDIR /opt/conda/lib/python3.7/site-packages
RUN patch -p0 < /app/alphafold/docker/openmm.patch
# Creating a tmp location for jackhmmr; not mounting through to host though.
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
# details.
# ENTRYPOINT does not support easily running multiple commands, so instead we
# write a shell script to wrap them up.
WORKDIR /home/jupyter
RUN echo '#!/bin/bash\nldconfig\n\'
+20
View File
@@ -0,0 +1,20 @@
#!/usr/bin/env bash
set -e
# Prod (Publicly viewable)
PROJECT=cloud-devrel-public-resources
REPOSITORY=alphafold
LOCAL_IMAGE=alphafold-on-gcp
REMOTE_IMAGE=${LOCAL_IMAGE?}
TAG=latest
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
git clone https://github.com/deepmind/alphafold.git
cp Dockerfile alphafold/docker/Dockerfile
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
sudo docker push ${REGISTRY?}
Binary file not shown.

After

Width:  |  Height:  |  Size: 3.1 KiB

@@ -0,0 +1,52 @@
# Overview
*Pluto* is a programming environment for Julia, designed to be interactive and helpful. It provides a familiar notebook interface but it is not a Jupyter notebook. The biggest difference is that Pluto notebooks are reactive, changing a variable or function in one cell causes the cells that depend on that variable or function to be reevaluated. Pluto also provides useful interaction mechanisms that allow users to dynamically interact with the notebooks computation state.
The JuliaCon 2020 presentation: [Interactive notebooks ~ Pluto.jl]() provides a good introduction to Pluto. The source is at [fonsp/Pluto.jl]()
# Install Pluto
## Create a Vertex AI JupyterLab Instance
1. From the [GCP console](https://console.cloud.google.com) "hamburger menu"
select Vertex AI > Workbench
2. Click NEW NOTEBOOK
* Choose Python 3 if you won't be using a GPU
* Choose Python 3 (CUDA Toolkit xx.y) if you do want use a GPU
3. Give the notebook an appropriate name
4. Edit Notebook properties if you have special requirements otherwise accept the defaults and click CREATE
5. When the notebook instance is ready click OPEN JUPYTERLAB
## Configure JupyterLab
1. Open a terminal by clicking the Terminal icon.
1. Install the plutoserver
pip3 install git+https://github.com/fonsp/pluto-on-jupyterlab.git
1. In a browser go to [julialang.org/downloads](https://julialang.org/downloads/)
1. In the Current stable release right click on the `Generic Linux on x86 / 64-bit (glibc)` link
Select copy link address
1. Back in the terminal switch to root via
sudo -i
1. Download the release to /opt and install julia in /usr/local/bin
```bash
cd /opt
wget <paste the release link address>
tar xf <name of the downloaded tar file>
ln -s /opt/<julia-x.y.z>/bin/julia /usr/local/bin
^d
```
1. Add the Pluto package to Julia
```bash
julia
julia> ]add Pluto
julia> bksp
julia> using Pluto
julia> ^d
```
1. From the JupyterLab menu bar select File > Shut Down
# Start Pluto
1. Click OPEN JUPYTERLAB in the Workbench
1. In the Notebook section of the Launcher click Pluto.jl
1. The welcome to Pluto.jl screen should appear
@@ -1,6 +1,6 @@
# PyTorch on Google Cloud: Text Classification
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
@@ -9,6 +9,7 @@ This tutorial on text classification shows how to train a PyTorch based text cla
| <h4>Notebook</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
## Folders
@@ -1,6 +1,7 @@
# Use pytorch GPU base image
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
# set working directory
WORKDIR /app
@@ -22,15 +22,18 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
# BUCKET_NAME: Change to your bucket name.
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# JOB_NAME: the name of your job running on AI Platform.
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# This can be a GCS location to a zipped and uploaded package
PACKAGE_PATH=./trainer
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
# or use the default '`us-central1`'. The region is where the job will be run.
REGION="us-central1"
@@ -41,11 +44,8 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
# IMAGE_TAG: an easily identifiable tag for your docker image
IMAGE_TAG=latest
# IMAGE_URI: the complete URI location for Cloud Container Registry
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
# Build the docker image
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
@@ -53,11 +53,19 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
# Deploy the docker image to Cloud Container Registry
docker push ${CUSTOM_TRAIN_IMAGE_URI}
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
Binary file not shown.

After

Width:  |  Height:  |  Size: 45 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 37 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 248 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 38 KiB

@@ -2,10 +2,13 @@
FROM pytorch/torchserve:latest-cpu
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
USER model-server
# copy model artifacts, custom handler and other dependencies
COPY ./custom_text_handler.py /home/model-server/
COPY ./custom_handler.py /home/model-server/
COPY ./index_to_name.json /home/model-server/
COPY ./model/finetuned-bert-classifier/ /home/model-server/
@@ -21,7 +24,7 @@ EXPOSE 7080
EXPOSE 7081
# create model archive file packaging model artifacts and dependencies
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
# run Torchserve HTTP serve to respond to prediction requests
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
@@ -0,0 +1,37 @@
FROM pytorch/torchserve:latest-cpu
USER root
# run and update some basic packages software packages, including security libs
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
# Install gcloud tools for gsutil as well as debugging
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
USER model-server
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
ARG MODEL_NAME=finetuned-bert-classifier
ENV MODEL_NAME="${MODEL_NAME}"
# health and prediction listener ports
ARG AIP_HTTP_PORT=7080
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
ARG MODEL_MGMT_PORT=7081
# expose health and prediction listener ports from the image
EXPOSE "${AIP_HTTP_PORT}"
EXPOSE "${MODEL_MGMT_PORT}"
EXPOSE 8080 8081 8082 7070 7071
# create torchserve configuration file
USER root
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
USER model-server
# run Torchserve HTTP serve to respond to prediction requests
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
@@ -52,7 +52,8 @@ class TransformersClassifierHandler(BaseHandler):
with open(mapping_file_path) as f:
self.mapping = json.load(f)
else:
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
logger.warning('Missing the index_to_name.json file. Inference output will default.')
self.mapping = {"0": "Negative", "1": "Positive"}
self.initialized = True
@@ -88,4 +89,3 @@ class TransformersClassifierHandler(BaseHandler):
def postprocess(self, inference_output):
return inference_output
@@ -19,13 +19,19 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
# BUCKET_NAME: Change to your bucket name
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# The PyTorch image provided by Vertex AI Training.
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
# JOB_NAME: the name of your job running on Vertex AI.
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
@@ -35,19 +41,21 @@ REGION="us-central1"
# JOB_DIR: Where to store prepared package and upload output model.
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
executor-image-uri=${IMAGE_URI},\
python-module=trainer.task,\
local-package-path=../python_package/"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--python-package-uris=${PACKAGE_PATH} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
@@ -122,6 +122,9 @@ def run(args):
# Train / Test the model
trainer = train(args, text_classifier, train_dataset, test_dataset)
metrics = trainer.evaluate(eval_dataset=test_dataset)
trainer.save_metrics("all", metrics)
# Export the trained model
trainer.save_model(os.path.join("/tmp", args.model_name))
@@ -63,20 +63,20 @@
"- [Training](#Training)\n",
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
"- [Tuning](#Hyperparameter-Tuning) \n",
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
"- [Deploying](#Deploying)\n",
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
"\n",
"### Costs \n",
"\n",
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
"\n",
"* [Notebooks](https://cloud.google.com/notebooks)\n",
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Cloud Storage](https://cloud.google.com/storage)\n",
"* [Container Registry](https://cloud.google.com/container-registry)\n",
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
@@ -202,9 +202,9 @@
"id": "e0c1dcadc2c8"
},
"source": [
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"\n",
"#### Install Vertex SDK for Python"
"#### Install Vertex AI SDK for Python"
]
},
{
@@ -1199,7 +1199,7 @@
"source": [
"### Run predictions locally with sample examples\n",
"\n",
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
]
},
{
@@ -1382,7 +1382,7 @@
"id": "f7466d414a0e"
},
"source": [
"### Run Custom Job on Vertex Training with a pre-built container"
"### Run Custom Job on Vertex AI Training with a pre-built container"
]
},
{
@@ -1395,7 +1395,7 @@
"\n",
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
"\n",
"![Training with Prebuilt Containers on Vertex Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
"![Training with Prebuilt Containers on Vertex AI Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
]
},
{
@@ -1569,7 +1569,7 @@
"source": [
"#### **Run custom training job on Vertex AI**\n",
"\n",
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
]
},
{
@@ -1578,7 +1578,7 @@
"id": "5d2957ef04fd"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1598,7 +1598,7 @@
"id": "6b0fed34b728"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**"
"##### **Configure and submit Custom Job to Vertex AI Training service**"
]
},
{
@@ -1609,7 +1609,7 @@
"source": [
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
]
},
{
@@ -1686,7 +1686,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job.png)"
]
},
{
@@ -1798,7 +1798,7 @@
"id": "c170d386492b"
},
"source": [
"### Run Custom Job on Vertex Training with custom container"
"### Run Custom Job on Vertex AI Training with custom container"
]
},
{
@@ -1807,7 +1807,7 @@
"id": "035227b6e581"
},
"source": [
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
"\n",
"![Training with custom containers on Vertex AI](./images/training-with-custom-containers-on-vertex-training.png)"
]
@@ -1834,7 +1834,7 @@
"%%writefile ./custom_container/Dockerfile\n",
"\n",
"# Use pytorch GPU base image\n",
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
"\n",
"# set working directory\n",
"WORKDIR /app\n",
@@ -1968,7 +1968,7 @@
"id": "a23e5e34bea9"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1988,11 +1988,11 @@
"id": "abf1fa4085cb"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**\n",
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
"\n",
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
]
},
{
@@ -2044,7 +2044,7 @@
},
"outputs": [],
"source": [
"# submit the custom job to Vertex training service\n",
"# submit the custom job to Vertex AI training service\n",
"model = job.run(\n",
" replica_count=1,\n",
" machine_type=\"n1-standard-8\",\n",
@@ -2065,7 +2065,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job-container.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job-container.png)"
]
},
{
@@ -2148,11 +2148,11 @@
"id": "ba6122f929e3"
},
"source": [
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
"\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"\n",
"![Hyperparameter Tuning with Custom Containers on Vertex Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
"![Hyperparameter Tuning with Custom Containers on Vertex AI Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
]
},
{
@@ -2163,7 +2163,7 @@
"source": [
"### How hyperparameter tuning works in Vertex AI?\n",
"\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
"\n",
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
@@ -2297,7 +2297,7 @@
"source": [
"### Run Hyperparameter Tuning Job on Vertex AI\n",
"\n",
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
]
},
{
@@ -2326,7 +2326,7 @@
"id": "f60fab07d67c"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -2346,7 +2346,7 @@
"id": "6652aa63ddff"
},
"source": [
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
"\n",
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
"\n",
@@ -2374,7 +2374,7 @@
"id": "9d46db3a8b23"
},
"source": [
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
]
},
{
@@ -2548,7 +2548,7 @@
"\n",
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor hyperparameter tuning job progress in Vertex Training](./images/vertex-training-monitor-hptuning-job-container.png)"
"![Monitor hyperparameter tuning job progress in Vertex AI Training](./images/vertex-training-monitor-hptuning-job-container.png)"
]
},
{
@@ -2557,7 +2557,7 @@
"id": "ba934b434f03"
},
"source": [
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
]
},
{
@@ -2612,7 +2612,7 @@
"id": "5dbccb2b7d32"
},
"source": [
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
]
},
{
@@ -2701,8 +2701,8 @@
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
"\n",
"# BUCKET_NAME: Change to your bucket name\n",
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
"# BUCKET_NAME is a required parameter to run the cell.\n",
"BUCKET_NAME=$1\n",
"\n",
"# APP_NAME: get application name\n",
"APP_NAME=$2\n",
@@ -2711,7 +2711,7 @@
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
"\n",
"# custom container image URI\n",
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"\n",
"# ========================================================\n",
"# create hyperparameter tuning configuration file\n",
@@ -2772,20 +2772,20 @@
"source": [
"## Deploying\n",
"\n",
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
"\n",
"### Deploying model on Vertex Predictions with custom container\n",
"### Deploying model on Vertex AI Predictions with custom container\n",
"\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
"\n",
"![Serving with Custom Containers on Vertex Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"![Serving with Custom Containers on Vertex AI Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"\n",
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
"\n",
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
]
},
{
@@ -2815,7 +2815,7 @@
},
"outputs": [],
"source": [
"%%writefile predictor/custom_text_handler.py\n",
"%%writefile predictor/custom_handler.py\n",
"\n",
"import os\n",
"import json\n",
@@ -2870,7 +2870,8 @@
" with open(mapping_file_path) as f:\n",
" self.mapping = json.load(f)\n",
" else:\n",
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
"\n",
" self.initialized = True\n",
"\n",
@@ -3047,10 +3048,13 @@
"FROM pytorch/torchserve:latest-cpu\n",
"\n",
"# install dependencies\n",
"RUN python3 -m pip install --upgrade pip\n",
"RUN pip3 install transformers\n",
"\n",
"USER model-server\n",
"\n",
"# copy model artifacts, custom handler and other dependencies\n",
"COPY ./custom_text_handler.py /home/model-server/\n",
"COPY ./custom_handler.py /home/model-server/\n",
"COPY ./index_to_name.json /home/model-server/\n",
"COPY ./model/$APP_NAME/ /home/model-server/\n",
"\n",
@@ -3070,7 +3074,7 @@
" --model-name=$APP_NAME \\\n",
" --version=1.0 \\\n",
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
" --handler=/home/model-server/custom_text_handler.py \\\n",
" --handler=/home/model-server/custom_handler.py \\\n",
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
" --export-path=/home/model-server/model-store\n",
"\n",
@@ -3129,7 +3133,7 @@
"source": [
"#### **Run the container locally** ***[Optional]***\n",
"\n",
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
]
},
{
@@ -3267,9 +3271,9 @@
"id": "69477b3a00c0"
},
"source": [
"#### **Deploying the serving container to Vertex Predictions**\n",
"#### **Deploying the serving container to Vertex AI Predictions**\n",
"\n",
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
]
},
{
@@ -3300,7 +3304,7 @@
"id": "a3da91e19af4"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -3437,7 +3441,7 @@
"id": "bc4673478269"
},
"source": [
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
]
},
{
@@ -3487,7 +3491,7 @@
"source": [
"##### **Formatting input for online prediction**\n",
"\n",
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
"\n",
"```\n",
"[\n",
@@ -3560,9 +3564,9 @@
},
"source": [
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"\n",
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
]
},
{
@@ -3653,12 +3657,12 @@
},
"outputs": [],
"source": [
"delete_custom_job = True\n",
"delete_hp_tuning_job = True\n",
"delete_custom_job = False\n",
"delete_hp_tuning_job = False\n",
"delete_endpoint = True\n",
"delete_model = True\n",
"delete_bucket = True\n",
"delete_image = True"
"delete_model = False\n",
"delete_bucket = False\n",
"delete_image = False"
]
},
{
@@ -3686,7 +3690,7 @@
"\n",
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
"\n",
"# Initialize Vertex SDK\n",
"# Initialize Vertex AI SDK\n",
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
]
},
@@ -3924,7 +3928,7 @@
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" print(\n",
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
" )\n",
@@ -3932,7 +3936,7 @@
" # uncomment below line to delete contents of the bucket\n",
" # ! gsutil rm -r $BUCKET_NAME\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" if float(shell_output[0].split()[0]) > 0:\n",
" print(\n",
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
@@ -188,11 +188,14 @@
},
"outputs": [],
"source": [
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
"! pip3 install {USER_FLAG} --upgrade kfp\n",
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow"
"! pip3 install {USER_FLAG} numpy\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
"! pip3 install {USER_FLAG} --upgrade pillow\n",
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
"! pip3 install {USER_FLAG} --upgrade fastapi"
]
},
{
@@ -287,7 +290,7 @@
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
@@ -518,6 +521,7 @@
"import os\n",
"import sys\n",
"\n",
"from google.cloud import aiplatform\n",
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"from kfp.v2 import compiler, dsl\n",
"from kfp.v2.google.client import AIPlatformClient"
@@ -561,13 +565,34 @@
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
"id": "895ac243c125"
},
"outputs": [],
"source": [
"# Dataset parameters\n",
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
"\n",
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "62bfb9a820f6"
},
"outputs": [],
"source": [
"# Download the sample data into your RAW_DATA_PATH\n",
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
},
"outputs": [],
"source": [
"# Pipeline parameters\n",
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
@@ -635,7 +660,7 @@
"source": [
"#### Run unit tests on the Generator component\n",
"\n",
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
]
},
{
@@ -713,12 +738,12 @@
"TRAINING_ARTIFACTS_DIR = (\n",
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
")\n",
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
"TRAINING_MACHINE_TYPE = (\n",
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
")\n",
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -769,8 +794,12 @@
"TRAINED_POLICY_DISPLAY_NAME = (\n",
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
")\n",
"TRAFFIC_SPLIT = {\"0\": 100}\n",
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -900,16 +929,17 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
"from kfp.components import load_component_from_url\n",
"\n",
"generate_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
")\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -978,7 +1008,7 @@
" bigquery_location=bigquery_location,\n",
" bigquery_table_id=bigquery_table_id,\n",
" )\n",
"\n",
" \n",
" # Run the Ingester component.\n",
" ingest_task = ingest_op(\n",
" project_id=project_id,\n",
@@ -988,7 +1018,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -996,28 +1035,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1034,11 +1055,14 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" traffic_split=TRAFFIC_SPLIT,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -1053,12 +1077,11 @@
"# Compile the authored pipeline.\n",
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
"\n",
"# Createa Vertex AI client.\n",
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
"\n",
"# Create a pipeline run job.\n",
"response = api_client.create_run_from_job_spec(\n",
" job_spec_path=PIPELINE_SPEC_PATH,\n",
"job = aiplatform.PipelineJob(\n",
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
" template_path=PIPELINE_SPEC_PATH,\n",
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" # Pipeline configs\n",
" \"project_id\": PROJECT_ID,\n",
@@ -1070,7 +1093,9 @@
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
" },\n",
" enable_caching=ENABLE_CACHING,\n",
")"
")\n",
"\n",
"job.run()"
]
},
{
@@ -1111,7 +1136,11 @@
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
")"
")\n",
"# TF-Agents RL configs\n",
"BATCH_SIZE = 8\n",
"RANK_K = 20\n",
"NUM_ACTIONS = 20"
]
},
{
@@ -1221,7 +1250,7 @@
},
"outputs": [],
"source": [
"endpoints = ! gcloud beta ai endpoints list \\\n",
"endpoints = ! gcloud ai endpoints list \\\n",
" --region=$REGION \\\n",
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
"print(\"\\n\".join(endpoints), \"\\n\")\n",
@@ -1424,13 +1453,11 @@
},
"outputs": [],
"source": [
"from kfp.components import load_component_from_url\n",
"\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -1481,7 +1508,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -1489,28 +1525,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1527,11 +1545,13 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -39,14 +39,15 @@ outputs:
- {name: bigquery_table_id, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
- sh
- -ec
- |
@@ -296,7 +297,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -20,7 +20,7 @@ outputs:
- {name: tfrecord_file, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
@@ -187,7 +187,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -1,3 +1,4 @@
google-cloud-bigquery==2.20.0
tensorflow==2.5.2
tensorflow==2.5.3
pillow==9.0.1
tf-agents==0.8.0
@@ -1,2 +1,4 @@
google-cloud-pubsub==2.5.0
pillow==9.0.1
tf-agents==0.8.0
tensorflow==2.5.2
tensorflow==2.5.3
@@ -0,0 +1,5 @@
dataclasses==0.6
google-cloud-aiplatform==1.8.1
tensorflow==2.5.3
pillow==9.0.1
tf-agents==0.8.0
@@ -27,14 +27,14 @@ outputs:
- {name: training_artifacts_dir, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
- sh
- -ec
- |
@@ -270,7 +270,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -22,13 +22,13 @@ from src.training import task
# Paths and configurations
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
"[your-file-name].json") # FILL IN
"result.json") # FILL IN
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
# Hyperparameters
@@ -1 +1 @@
tensorflow==2.5.2
tensorflow==2.5.3
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -113,8 +113,8 @@
},
"outputs": [],
"source": [
"! gcloud beta ai custom-jobs local-run \\\n",
" --base-image=$BASE_IMAGE_URI \\\n",
"! gcloud ai custom-jobs local-run \\\n",
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
+5
View File
@@ -0,0 +1,5 @@
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product.
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that aren't officially supported by Google.
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
+15 -10
View File
@@ -3,16 +3,21 @@
# @global-owner1 and @global-owner2 will be requested for
# review when someone opens a pull request.
/sdk/sdk_* @aferlitsch
/gapic @aferlitsch
/ml_ops @aferlitsch
/model_monitoring/* @mco
/sdk/sdk_* @andrewferlitsch
/gapic @andrewferlitsch
/ml_ops @andrewferlitsch
/model_monitoring/* @mco-gh
/structured_data/rapid_prototyping_* @rafael-carvalho
/managed_notebooks/ @notebooks-team
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/managed_notebooks/
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
/sdk/SDK_AutoML_Forecasting_Model_Training_Example.ipynb @thehardikv
/sdk/sdk_automl_forecasting_evaluating_a_model.ipynb @thehardikv
/matching_engine @yinghsienwu
/neo4j @benofben @htappen
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
/tensorboard @yfang1
/feature_store @nayaknishant @morgandu
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
/vertex_endpoints/optimized_tensorflow_runtime @vlasenkoalexey
/notebooks/community/ml_ops/stage2/get_started_with_visionapi_and_automl.ipynb @mansari
Binary file not shown.

After

Width:  |  Height:  |  Size: 83 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 141 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 230 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 122 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 140 KiB

File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -6,16 +6,17 @@
"id": "c8c4e360024a"
},
"source": [
"# Taxi fare prediction using chicago taxi-cab dataset\n",
"# Taxi fare prediction using the Chicago Taxi Trips dataset\n",
"\n",
"## Table of contents\n",
"\n",
"* [Overview](#section-1)\n",
"* [Dataset](#section-2)\n",
"* [Objective](#section-3)\n",
"* [Costs](#section-4)\n",
"* [Data analysis](#section-5)\n",
"* [Fit a simple linear regression model](#section-6)\n",
"* [Save the model and upload to a GCS bucket](#section-7)\n",
"* [Save the model and upload to a Cloud Storage bucket](#section-7)\n",
"* [Deploy the model on Vertex AI with support for Vertex Explainable AI](#section-8)\n",
"* [Get explanations from the deployed model](#section-9)\n",
"* [Clean up](#section-10)\n",
@@ -23,23 +24,23 @@
"## Overview\n",
"<a name=\"section-1\"></a>\n",
"\n",
"This notebooks demonstrates analysis, feature selection, model building and deployment with Vertex Explainable AI configured on Vertex AI on a subset of the Chicago Taxi-cab dataset for Taxi-fare prediction problem.\n",
"This notebook demonstrates analysis, feature selection, model building, and deployment with Vertex Explainable AI configured on Vertex AI, using a subset of the Chicago Taxi Trips dataset for taxi-fare prediction.\n",
"\n",
"Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python(Local) kernel. Some components of this notebook may not work in other notebook environments.\n",
"*Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
"\n",
"## Dataset\n",
"<a name=\"section-2\"></a>\n",
"\n",
"The Chicago Taxi-cab dataset includes taxi trips from 2013 to the present, reported to the City of Chicago in its role as a regulatory agency. To protect privacy but allow for aggregate analyses, the Taxi ID is consistent for any given taxi medallion number but does not show the number, Census Tracts are suppressed in some cases, and times are rounded to the nearest 15 minutes. Due to the data reporting process, not all trips are reported but the City believes that most are. This dataset is publicly available on Bigquery under the public datasets with the Table ID : `bigquery-public-data.chicago_taxi_trips.taxi_trips` and also as public dataset on Kaggle Datasets at : [Chicago Taxi Trips Dataset](https://www.kaggle.com/chicago/chicago-taxi-trips-bq).\n",
"The Chicago Taxi Trips dataset includes taxi trips from 2013 to the present, reported to the city of Chicago in its role as a regulatory agency. To protect privacy but allow for aggregate analyses, the taxi ID is consistent for any given taxi medallion number but does not show the number, census tracts are suppressed in some cases, and times are rounded to the nearest 15 minutes. Due to the data reporting process, not all trips are reported but the city believes that most are. This dataset is publicly available on BigQuery as a public dataset with the table ID `bigquery-public-data.chicago_taxi_trips.taxi_trips` and also as a public dataset on Kaggle at [Chicago Taxi Trips](https://www.kaggle.com/chicago/chicago-taxi-trips-bq).\n",
"\n",
" For more information about this dataset and how it was created, please refer [Chicago Digital website](http://digital.cityofchicago.org/index.php/chicago-taxi-data-released).\n",
"For more information about this dataset and how it was created, see the [Chicago Digital website](http://digital.cityofchicago.org/index.php/chicago-taxi-data-released).\n",
"\n",
"## Objective\n",
"<a name=\"section-3\"></a>\n",
"\n",
"The goal of this notebook is to provide an overview on the latest Vertex AI features like Explainable AI and Bigquery in Notebook by trying to solve a Taxi-fare prediction problem. The steps followed in this notebook include : \n",
"The goal of this notebook is to provide an overview on the latest Vertex AI features like Explainable AI and \"BigQuery in Notebooks\" by trying to solve a taxi fare prediction problem. The steps followed in this notebook include: \n",
"\n",
"- Loading the dataset using `Bigquery in Notebooks`.\n",
"- Loading the dataset using \"BigQuery in Notebooks\".\n",
"- Performing exploratory data analysis on the dataset.\n",
"- Feature selection and preprocessing.\n",
"- Building a linear regression model using scikit-learn.\n",
@@ -54,12 +55,12 @@
"This tutorial uses the following billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Bigquery\n",
"- BigQuery\n",
"- Cloud Storage\n",
"\n",
"\n",
"Learn about [Vertex AI\n",
"pricing](https://cloud.google.com/vertex-ai/pricing), [Bigquery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/vertex-ai/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
"Calculator](https://cloud.google.com/products/calculator/)\n",
"to generate a cost estimate based on your projected usage."
@@ -71,7 +72,9 @@
"id": "5ed1f5e85640"
},
"source": [
"#### Set your project ID\n",
"## Before you begin\n",
"\n",
"### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
@@ -84,6 +87,8 @@
},
"outputs": [],
"source": [
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
@@ -120,11 +125,11 @@
"id": "fed4b24ea061"
},
"source": [
"## Select or Create Cloud Storage Bucket for storing the model\n",
"## Select or create a Cloud Storage bucket for storing the model\n",
"\n",
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket uri of the model where the model is stored. Using the model saved, you can then create Vertex AI model and endpoint resources in order to serve online predictions.\n",
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket uri of the model where the model is stored. Using the model saved, you can then create a Vertex AI model and endpoint resources in order to serve online predictions.\n",
"\n",
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets.You may also change the REGION variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets. You may also change the `LOCATION` variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
]
},
{
@@ -148,7 +153,9 @@
},
"outputs": [],
"source": [
"# Set a default bucketname in case bucket name is not given\n",
"from datetime import datetime\n",
"\n",
"# Set a default bucket name in case bucket name is not given\n",
"if BUCKET_NAME == \"\" or BUCKET_NAME == \"[your-bucket-name]\" or BUCKET_NAME is None:\n",
"\n",
" TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")\n",
@@ -165,15 +172,6 @@
"<b>Only if your bucket doesn't already exist</b>: Run the following cell to create your Cloud Storage bucket."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "95702536e547"
},
"source": [
"## Import the required libraries and define constants"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -205,6 +203,15 @@
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2e52fd6d4854"
},
"source": [
"## Import the required libraries and define constants"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -231,12 +238,14 @@
"id": "5166f42557ad"
},
"source": [
"The dataset is quite a large and noisy one and so data from a specific date range will be used. Based on various blogs and resources that are available online, many of them seem to have used the data from around May-2018 which gave some really good results compared to the other date ranges. While there are also some complicated research models propsed for the same problem like considering the weather data, holidays and seasons etc., the current notebook only explores a simple linear regression model as our main objective is to demonstrate the model deployment with Vertex Explainable AI configured on Vertex AI.\n",
"The dataset is quite a large and noisy one, so data from a specific date range will be used. Based on various blogs and resources that are available online, many of them seem to have used the data from around May 2018 which gave some really good results compared to the other date ranges. While there are also some complicated research models proposed for the same problem, like considering the weather data, holidays and seasons, the current notebook only explores a simple linear regression model, as our main objective is to demonstrate the model deployment with Vertex Explainable AI configured on Vertex AI.\n",
"\n",
"## Accessing the data through Bigquery in Notebooks\n",
"`Bigquery in Notebooks` feature of Vertex AI's managed notebooks allows us to use Bigquery and its features from the notebook itself eliminating the need to switch between tabs everytime. For every cell in the notebook, there is an option for Bigquery integration at the top right selecting which would enable us to compose a SQL query that can be executed in Bigquery. \n",
"## Accessing the data through \"BigQuery in Notebooks\"\n",
"\n",
"The \"BigQuery in Notebooks\" feature of Vertex AI Workbench managed notebooks lets you use BigQuery and its features from the notebook itself eliminating the need to switch between tabs everytime. For every cell in the notebook, there is an option for the BigQuery integration at the top right, and selecting it enables you to compose an SQL query that can be executed in BigQuery. \n",
"\n",
"The chosen dataset consists of the following fields:\n",
"\n",
"The chosen dataset consists of the following fields :\n",
"- `unique_key` : Unique identifier for the trip.\n",
"- `taxi_id` : A unique identifier for the taxi.\n",
"- `trip_start_timestamp`: When the trip started, rounded to the nearest 15 minutes.\n",
@@ -261,12 +270,12 @@
"- `dropoff_longitude`: The longitude of the center of the dropoff census tract or the community area if the census tract has been hidden for privacy.\n",
"- `dropoff_location`: The location of the center of the dropoff census tract or the community area if the census tract has been hidden for privacy.\n",
"\n",
"Among the available fields in the dataset, only the fields that seem common and relevant for analysis and modeling like `taxi_id`, `trip_start_timestamp`, `trip_seconds`, `trip_miles`, `payment_type` and `trip_total` are selected. Further, the field `trip_total` is treated as the target variable that would be predicted by the machine learning model. Apparently, this field is a summation of `fare`,`tips`,`tolls` and `extras` fields and so because of their correlation with the target variable, they are being excluded for modeling. Due to the volume of the data, a subset of the dataset over the course of one week i.e., 12-May-2018 to 18-May-2018 is being considered. Within this date range itself, the datapoints can be noisy and so a few conditions like the following are considered : \n",
"Among the available fields in the dataset, only the fields that seem common and relevant for analysis and modeling like `taxi_id`, `trip_start_timestamp`, `trip_seconds`, `trip_miles`, `payment_type` and `trip_total` are selected. Further, the field `trip_total` is treated as the target variable that would be predicted by the machine learning model. Apparently, this field is a summation of the `fare`,`tips`,`tolls` and `extras` fields and so because of their correlation with the target variable, they are being excluded for modeling. Due to the volume of the data, a subset of the dataset over the course of one week, 12-May-2018 to 18-May-2018 is being considered. Within this date range itself, the datapoints can be noisy and so a few conditions like the following are considered: \n",
"\n",
"- Time taken for the trip > 0.\n",
"- Distance covered during the trip > 0.\n",
"- Total trip charges > 0 and\n",
"- Pickup and dropoff areas are valid(not empty)."
"- Pickup and dropoff areas are valid (not empty)."
]
},
{
@@ -301,7 +310,7 @@
"id": "781341730c28"
},
"source": [
"The Bigquery integration also allows us to load the queried data into a pandas dataframe using the `Query and load as DataFrame` button. Clicking the button adds a new cell below that provides a code snippet to load the data into a dataframe."
"The BigQuery integration also lets you load the queried data into a pandas dataframe using the `Query and load as DataFrame` button. Clicking the button adds a new cell below that provides a code snippet to load the data into a dataframe."
]
},
{
@@ -343,7 +352,7 @@
"id": "96d61011e159"
},
"source": [
"Check the fields in the data and the shape."
"Check the fields in the data and their shape."
]
},
{
@@ -426,7 +435,7 @@
"id": "f0feadc628e4"
},
"source": [
"Depending on the percentage of null values in the data, one can choose to either drop them or impute them with mean/median(for numerical values) and mode(for categorical values). In the current data, there doesn't seem to be any null values."
"Depending on the percentage of null values in the data, one can choose to either drop them or impute them with mean/median (for numerical values) and mode (for categorical values). In the current data, there doesn't seem to be any null values."
]
},
{
@@ -480,7 +489,7 @@
"## Analyze numerical data\n",
"<a name=\"section-5\"></a>\n",
"\n",
"To further anaylyze the data, there are various plots that can be used on numerical and categorical fields. In case of numerical data, one can use histograms and box-plots while bar charts are suited for categorical data to better understand the distribution of the data and the outliers in the data."
"To further anaylyze the data, there are various plots that can be used on numerical and categorical fields. In case of numerical data, one can use histograms and box plots while bar charts are suited for categorical data to better understand the distribution of the data and the outliers in the data."
]
},
{
@@ -489,7 +498,7 @@
"id": "fa2d6258b509"
},
"source": [
"Plot Histograms and Box-plots on the numerical fields."
"Plot histograms and box plots on the numerical fields."
]
},
{
@@ -515,7 +524,7 @@
"id": "c3672976d67b"
},
"source": [
"The field `trip_seconds` describes the time taken for the trip in seconds. Optionally, it can be converted into hours for an easier understanding."
"The field `trip_seconds` describes the time taken for the trip in seconds. Optionally, it can be converted into hours."
]
},
{
@@ -557,7 +566,7 @@
"id": "58d57879aa8a"
},
"source": [
"So far we've only considered to look at the univariate plots. To better understand the relationship between the variables, a pair-plot can be plotted."
"So far you've only looked at the univariate plots. To better understand the relationship between the variables, a pair-plot can be plotted."
]
},
{
@@ -580,7 +589,7 @@
"id": "b69e8094ba39"
},
"source": [
"From the box-plots and the histograms plotted so far, it is evident that there are some outliers causing skewness in the data which perhaps could be removed. Also, we can certainly see some linear relationship between the independent variables considered in the pair-plot i.e., `trip_seconds` and `trip_miles` and the dependant variable `trip_total`."
"From the box plots and the histograms visualized so far, it is evident that there are some outliers causing skewness in the data which perhaps could be removed. Also, you can see some linear relationships between the independent variables considered in the pair-plot, for example, `trip_seconds` and `trip_miles` and the dependant variable `trip_total`."
]
},
{
@@ -627,7 +636,7 @@
"id": "341b581e2155"
},
"source": [
"## Analyze Categorical data\n",
"## Analyze categorical data\n",
"\n",
"Further, explore the categorical data by plotting the distribution of all the levels in each field."
]
@@ -653,9 +662,9 @@
"id": "a40a4b2d9d6a"
},
"source": [
"From the above analysis, one can see that almost 99% of the transaction types are Cash and Credit Card. While there are also other type of transactions, their distribution is very less. In such a case, the lower distribution levels can be dropped. On the other hand, total number of pickup and dropoff community areas both seem to have the same levels which make sense. In this case also, one can choose to omit the lower distribution levels but it has to be made sure that both the fields have the same levels afterwards. In the current notebook, we'd keep them as is and proceed with the modeling.\n",
"From the above analysis, one can see that almost 99% of the transaction types are Cash and Credit Card. While there are also other type of transactions, their distribution is negligible. In such a case, the lower distribution levels can be dropped. On the other hand, the total number of pickup and dropoff community areas both seem to have the same levels which make sense. In this case also, one can choose to omit the lower distribution levels but you'd have to make sure that both the fields have the same levels afterward. In the current notebook, keep them as is and proceed with the modeling.\n",
"\n",
"The relationships between the target variable and the categorical fields can be represented through boxplots. For each level, the corresponding distribution of the target variable can be identified."
"The relationships between the target variable and the categorical fields can be represented through box plots. For each level, the corresponding distribution of the target variable can be identified."
]
},
{
@@ -680,7 +689,7 @@
"id": "f49125a8a866"
},
"source": [
"There seems to be one case where the `trip_total` is over 3000 and has the same pickup and dropoff community area i.e., 28 which is clearly an outlier compared to the rest of the points. This datapoint can be removed."
"There seems to be one case where the `trip_total` is over 3000 and has the same pickup and dropoff community area: 28 is clearly an outlier compared to the rest of the points. This datapoint can be removed."
]
},
{
@@ -725,7 +734,7 @@
"id": "58a1d9f0a122"
},
"source": [
"There are also timestamp fields in the data that can prove to be useful. `trip_start_timestamp` represents the start timestamp of the taxi-trip and fields like what day of week it was and what hour it was can be dervied from it."
"There are also useful timestamp fields in the data. `trip_start_timestamp` represents the start timestamp of the taxi trip and fields like what day of week it was and what hour it was can be derived from it."
]
},
{
@@ -747,7 +756,7 @@
"id": "30ae02a15aa1"
},
"source": [
"Since the current dataset is considered only for a week, if there isn't much variation in the newly dervied fields with respect to the target variable, they can be dropped.\n",
"Since the current dataset is limited to only a week, if there isn't much variation in the newly derived fields with respect to the target variable, they can be dropped.\n",
"\n",
"Plot sum and average of the `trip_total` with respect to the `dayofweek`."
]
@@ -804,9 +813,9 @@
"id": "739e985af704"
},
"source": [
"As these plots don't seem to have constant figures with respect to the target variable across their levels, they can be considered for training. In fact, to simplify things these dervied features can be bucketed into less number of levels.\n",
"As these plots don't seem to have constant figures with respect to the target variable across their levels, they can be considered for training. In fact, to simplify things these derived features can be bucketed into fewer levels.\n",
"\n",
"`dayofweek` field can be bucketed into a binary field considering whether or not it was a weekend. If it is a weekday, the record can be assigned 1, else 0. Similarly, `hour` field can also be bucketed and encoded. The normal working hours in Chicago can be assumed to be between *8AM*-*10PM* and if the value falls in between the working hours, it can be encoded as 1, else 0."
"The `dayofweek` field can be bucketed into a binary field considering whether or not it was a weekend. If it is a weekday, the record can be assigned 1, else 0. Similarly, the `hour` field can also be bucketed and encoded. The normal working hours in Chicago can be assumed to be between *8AM*-*10PM* and if the value falls in between the working hours, it can be encoded as 1, else 0."
]
},
{
@@ -848,7 +857,7 @@
"id": "fe87612faa94"
},
"source": [
"## Divide the data in Train and Test sets\n",
"## Divide the data into train and test sets\n",
"\n",
"Split the preprocessed dataset into train and test sets so that the linear regression model can be validated on the test set."
]
@@ -887,10 +896,10 @@
"id": "5b7e470de1da"
},
"source": [
"## Fit a Simple Linear Regression model\n",
"## Fit a simple linear regression model\n",
"<a name=\"section-6\"></a>\n",
"\n",
"Fit a linear regression model using Sklearn's LinearRegression method on the train data."
"Fit a linear regression model using scikit-learn's LinearRegression method on the train data."
]
},
{
@@ -940,7 +949,7 @@
"id": "2ef6b44f0f93"
},
"source": [
"A low RMSE error and a train and test R2 score of 0.93 suggests that the model has fitted well on the data. Further, the coefficients learned by the model for each of its independent variables can also be checked by checking the `coef_` attribute of the sklearn model. \n",
"A low RMSE error and a train and test R2 score of 0.93 suggests that the model is fitted well. Further, the coefficients learned by the model for each of its independent variables can also be checked by checking the `coef_` attribute of the sklearn model. \n",
"\n",
"Check the coefficients learned by the model."
]
@@ -963,7 +972,7 @@
"id": "bcaed0b52e60"
},
"source": [
"## Save the model and upload to a GCS bucket.\n",
"## Save the model and upload to a Cloud Storage bucket\n",
"<a name=\"section-7\"></a>\n",
"\n",
"To deploy the model on Vertex AI, the model needs to be stored in a Cloud Storage bucket first."
@@ -999,10 +1008,10 @@
"id": "9f8ecfa6a19b"
},
"source": [
"## Deploy the Model on Vertex AI with support for Vertex Explainable AI\n",
"## Deploy the model on Vertex AI with support for Vertex Explainable AI\n",
"<a name=\"section-8\"></a>\n",
"\n",
"Configure the Vertex Explainable AI before deploying the model. For further details, see [Configuring Vertex Explainable AI in Vertex AI models](https://cloud.google.com/vertex-ai/docs/explainable-ai/configuring-explanations#scikit-learn-and-xgboost-pre-built-containers)."
"Configure Vertex Explainable AI before deploying the model. For further details, see [Configuring Vertex Explainable AI in Vertex AI models](https://cloud.google.com/vertex-ai/docs/explainable-ai/configuring-explanations#scikit-learn-and-xgboost-pre-built-containers)."
]
},
{
@@ -1114,7 +1123,7 @@
"id": "9eaab1c54d66"
},
"source": [
"Deploy the model to the created endpoint with the required machine-type."
"Deploy the model to the created endpoint with the required machine type."
]
},
{
@@ -1167,7 +1176,7 @@
"id": "b751978ff665"
},
"source": [
"## Get explanations from the deployed model.\n",
"## Get explanations from the deployed model\n",
"<a name=\"section-9\"></a>\n",
"\n",
"For testing the deployed online model, select two instances from the test data as payload."
@@ -1191,7 +1200,7 @@
"id": "01532047a99e"
},
"source": [
"Call the endpoint with the payload request and parse the response for explanations. The explanations consists of attributions on the independent variables used for training the model which are based on the configured attribution method. In this case, we've used the `Sampled Shapely` method which assigns credit for the outcome to each feature, and considers different permutations of the features. This method provides a sampling approximation of exact Shapley values. Further information on the attribution methods for explantions can be found at [Overview of ExplainableAI](https://cloud.google.com/vertex-ai/docs/explainable-ai/overview) page."
"Call the endpoint with the payload request and parse the response for explanations. The explanations consists of attributions on the independent variables used for training the model which are based on the configured attribution method. In this case, we've used the `Sampled Shapely` method which assigns credit for the outcome to each feature, and considers different permutations of the features. This method provides a sampling approximation of exact Shapely values. Further information on the attribution methods for explanations can be found at [Overview of Explainable AI](https://cloud.google.com/vertex-ai/docs/explainable-ai/overview)."
]
},
{
@@ -1266,9 +1275,9 @@
"id": "87cf259efb64"
},
"source": [
"## Next Steps\n",
"## Next steps\n",
"\n",
"Since the Chicago-Taxicab dataset is continuously updating, one can preform the same kind of analysis and model training every time a new set of data is available. The date range can also be increased from a week to a month or more depending on the quality of data. Most of the steps followed in this notebook would still be valid and can be applied over the new data unless the data is too noisy. Perhaps, the notebook itself can be scheduled to run at the specified times to retrain the model using the scheduling option of the [Vertex AI workbench's Executor](https://console.cloud.google.com/vertex-ai/workbench/list/executions) feature. "
"Since the Chicago Taxi Trips dataset is continuously updating, one can preform the same kind of analysis and model training every time a new set of data is available. The date range can also be increased from a week to a month or more depending on the quality of the data. Most of the steps followed in this notebook would still be valid and can be applied over the new data unless the data is too noisy. Perhaps, the notebook itself can be scheduled to run at the specified times to retrain the model using the scheduling option of [Vertex AI Workbench's executor](https://console.cloud.google.com/vertex-ai/workbench/list/executions). "
]
},
{
@@ -1277,7 +1286,7 @@
"id": "eae8d94e3641"
},
"source": [
"## Clean Up\n",
"## Clean up\n",
"<a name=\"section-10\"></a>\n",
"\n",
"Delete the resources created in this notebook.\n",
Binary file not shown.

After

Width:  |  Height:  |  Size: 382 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 445 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 63 KiB

@@ -7,49 +7,53 @@
},
"source": [
"# Predictive Maintenance \n",
"\n",
"## Table of contents\n",
"* [Overview](#section-1)\n",
"* [Dataset](#section-2)\n",
"* [Objective](#section-3)\n",
"* [Costs](#section-4)\n",
"* [Data Analysis](#section-5)\n",
"* [Fit a Regression model](#section-6)\n",
"* [Data analysis](#section-5)\n",
"* [Fit a regression model](#section-6)\n",
"* [Evaluate the trained model](#section-7)\n",
"* [Save the model](#section-8)\n",
"* [Running a notebook end-to-end using **Executor**](#section-9)\n",
"* [Running a notebook end-to-end using the executor](#section-9)\n",
"* [Hosting the model on Vertex AI](#section-10)\n",
" * [Create an Endpoint](#section-11)\n",
" * [Deploy the model to the created Endpoint](#section-12)\n",
" * [Test calling the endpoint](#section-13)\n",
" * [Create an endpoint](#section-11)\n",
" * [Deploy the model to the created endpoint](#section-12)\n",
" * [Test calling the endpoint](#section-13)\n",
"* [Clean up](#section-14)\n",
"\n",
"\n",
"## Overview\n",
"<a name=\"section-1\"></a>\n",
"This notebook demonstrates performing predictive maintenance on industrial data using machine learning techniques, deploying the machine learning model on Vertex-AI and automating the workflow using executor feature of Vertex-AI.\n",
"\n",
"<b>Note</b>: This notebook is designed to run on managed notebooks instance of Vertex AI Workbench. Some components of this notebook may not work in other notebook environments.\n",
"This notebook demonstrates how to perform predictive maintenance on industrial data using machine learning techniques, deploy the machine learning model on Vertex AI, and automate the workflow using the executor feature of Vertex AI Workbench.\n",
"\n",
"*Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the XGBoost (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
"\n",
"## Dataset\n",
"<a name=\"section-2\"></a>\n",
"The dataset used in this notebook is a part of the [NASA Turbofan Engine Degradation Dataset](https://ti.arc.nasa.gov/tech/dash/groups/pcoe/prognostic-data-repository/) which consists of simulated time-series data for four sets of fleet-engines under different combinations of operational conditions and fault modes. In this notebook, only one of the engine's simulated data(FD001) has been considered to analyze and train a model that can predict the engine's remaining useful life.\n",
"\n",
"## Objective\n",
"The dataset used in this notebook is a part of the [NASA Turbofan Engine Degradation Simulation dataset](https://ti.arc.nasa.gov/tech/dash/groups/pcoe/prognostic-data-repository/), which consists of simulated time-series data for four sets of fleet engines under different combinations of operational conditions and fault modes. In this notebook, only one of the engine's simulated data (FD001) has been used to analyze and train a model that can predict the engine's remaining useful life.\n",
"\n",
"## Objectives\n",
"<a name=\"section-3\"></a>\n",
"In this notebook :\n",
"\n",
"- Loading the required dataset from Cloud Storage bucket.\n",
"The objectives of this notebook include:\n",
"\n",
"- Loading the required dataset from a Cloud Storage bucket.\n",
"- Analyzing the fields present in the dataset.\n",
"- Selecting the required data for the predictive maintenance model.\n",
"- Training an XGBoost regression model for predicting the remaining useful life.\n",
"- Evaluating the model.\n",
"- Running the notebook end-to-end as a training job using Executor.\n",
"- Deploying the model on Vertex-AI.\n",
"- Deploying the model on Vertex AI.\n",
"- Clean up.\n",
"\n",
"\n",
"## Costs\n",
"<a name=\"section-4\"></a>\n",
"\n",
"This tutorial uses the following billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
@@ -68,8 +72,10 @@
"id": "5b15a97278df"
},
"source": [
"## Kernel selection\n",
"Select <b>XGBoost</b> kernel while running this notebook on Vertex-AIs managed instances or ensure that the following libraries are installed in the environment where this notebook is being run.\n",
"## Before you begin\n",
"\n",
"### Kernel selection\n",
"Select <b>XGBoost</b> kernel while running this notebook on Vertex AI Workbench managed notebooks instances or ensure that the following libraries are installed in the environment where this notebook is being run.\n",
"- XGBoost\n",
"- Pandas\n",
"- Seaborn\n",
@@ -80,7 +86,9 @@
"- google.cloud.aiplatform\n",
"- google.cloud.storage\n",
"\n",
"## Set your project ID"
"### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
@@ -91,7 +99,36 @@
},
"outputs": [],
"source": [
"PROJECT_ID = \"[your-project-id]\""
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "750bf2883c2d"
},
"source": [
"Otherwise, set your project ID here."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3c6db1ca88b9"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
@@ -124,11 +161,11 @@
"id": "ea53caa30628"
},
"source": [
"## Select or Create Cloud Storage Bucket for storing the model\n",
"## Select or Create a Cloud Storage Bucket for storing the model\n",
"\n",
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket URI of the model where the model is stored. Using the model saved, you can then create Vertex AI model and endpoint resources in order to serve online predictions.\n",
"\n",
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets.You may also change the REGION variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets. You may also change the `REGION` variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
]
},
{
@@ -263,7 +300,7 @@
"id": "8cfc304d35b5"
},
"source": [
"The data itself doesn't contain any feature names and thus needs its columns to be re-named. The data source already provides us with some data description. Apparently, the <b>ID</b> column represents the unit-number of the fleet-engine and <b>Cycle</b> represents the time in cycles. <b>OpSet1</b>,<b>Opset2</b> & <b>Opset3</b> represent the three operational settings that are described in the original data source and have a substantial effect on engine performance. The rest of the fields show sensor readings collected from 21 different sensors."
"The data itself doesn't contain any feature names and thus needs its columns to be renamed. The data source already provides some data description. Apparently, the <b>ID</b> column represents the unit-number of the fleet-engine and <b>Cycle</b> represents the time in cycles. <b>OpSet1</b>,<b>Opset2</b> & <b>Opset3</b> represent the three operational settings that are described in the original data source and have a substantial effect on engine performance. The rest of the fields show sensor readings collected from 21 different sensors."
]
},
{
@@ -336,7 +373,7 @@
"id": "43c3f01352ad"
},
"source": [
"On an average, there seems to be around 225 cycles per each ID in the dataset. Further, lets check the data-types of the fields and the number of null records in the data."
"On an average, there seem to be around 225 cycles per each ID in the dataset. Next, lets check the data types of the fields and the number of null records in the data."
]
},
{
@@ -418,7 +455,7 @@
"id": "284debdf4294"
},
"source": [
"Fields **SensorMeasure7**, **SensorMeasure12**, **SensorMeasure20** & **SensorMeasure21** correlate highly with many other fields. These fields can be omitted. Further, **SensorMeasure8**, **SensorMeasure11** and **SensorMeasure4** seem highly correlated with each other and so any one of them, say **SensorMeasure4** can be kept and the rest can be omitted."
"Fields **SensorMeasure7**, **SensorMeasure12**, **SensorMeasure20** & **SensorMeasure21** correlate highly with many other fields. These fields can be omitted. Further, **SensorMeasure8**, **SensorMeasure11** and **SensorMeasure4** seem highly correlated with each other and so any one of them, for example, **SensorMeasure4**, can be kept and the rest can be omitted."
]
},
{
@@ -455,7 +492,7 @@
"id": "8197cdef2cff"
},
"source": [
"As the current objective is to predict the remaining useful life(RUL) of each unit(ID), the target variable needs to be identified. Since we're dealing with a timeseries data that represents the lifetime of a unit, remaining useful life of a unit can be calculated by subtracting the current cycle from the maximum cycle of that unit.\n",
"As the current objective is to predict the remaining useful life (RUL) of each unit (ID), the target variable needs to be identified. Since we're dealing with a timeseries data that represents the lifetime of a unit, remaining useful life of a unit can be calculated by subtracting the current cycle from the maximum cycle of that unit.\n",
"\n",
"\t\t\t\t\tRUL = Max. Cycle - Current Cycle \n",
"## RUL calculation and Feature selection"
@@ -518,7 +555,7 @@
"id": "fc3b82355cdc"
},
"source": [
"The above plot suggests that the RUL i.e., the remaining cycles is decreasing as the current cycle increases which is expected. Further, lets see the how the other fields relate to RUL in the current dataset."
"The above plot suggests that the RUL, in other words, the remaining cycles, is decreasing as the current cycle increases which is expected. Further, lets see the how the other fields relate to RUL in the current dataset."
]
},
{
@@ -557,7 +594,7 @@
"- Fields **SensorMeasure5** and **SensorMeasure16** don't show much variance with the RUL and seem constant all the time. Hence, they can be removed.\n",
"- Fields **SensorMeasure2**, **SensorMeasure3**, **SensorMeasure4**, **SensorMeasure13**, **SensorMeasure15** & **SensorMeasure17** show a similar rising trend.\n",
"- **SensorMeasure9** and **SensorMeasure14** show a similar trend.\n",
"- **SensorMeasure6** shows flatline most of the time except at a very few places and therefore can be ignored."
"- **SensorMeasure6** shows a flatline most of the time except in a very few places and therefore can be ignored."
]
},
{
@@ -583,7 +620,7 @@
"id": "cae198bd96ef"
},
"source": [
"## Split the data into Train and Test\n",
"## Split the data into train and test\n",
"\n",
"Divide the dataset with the selected features into train and test sets."
]
@@ -613,9 +650,10 @@
"id": "43a26d74c687"
},
"source": [
"## Fit a Regression model\n",
"## Fit a regression model\n",
"<a name=\"section-6\"></a>\n",
"Initialize and train a regression model using XGBoost library with the calculated RUL as the target feature."
"\n",
"Initialize and train a regression model using the XGBoost library with the calculated RUL as the target feature."
]
},
{
@@ -769,23 +807,25 @@
"id": "4bd88d7f4bbb"
},
"source": [
"## Running a notebook end-to-end using **Executor**\n",
"## Running a notebook end-to-end using executor\n",
"<a name=\"section-9\"></a>\n",
"\n",
"### Automating the notebook execution\n",
"All the steps followed till now can be run as a training job without using any additional code using the Notebook executor. Notebook executor can help you run a notebook file from start to end, with your choice of the environment, machine type, input parameters, and other characteristics. After setting up an execution, the notebook is executed as a job in Vertex AI custom training. Your jobs can be monitored from the Notebook Executor pane in the menu on the left.\n",
"All the steps followed until now can be run as a training job without using any additional code using the Vertex AI Workbench executor. The executor can help you run a notebook file from start to end, with your choice of the environment, machine type, input parameters, and other characteristics. After setting up an execution, the notebook is executed as a job in Vertex AI custom training. Your jobs can be monitored from the Executor pane in the left sidebar.\n",
"\n",
"<img src=\"images/executor.PNG\">\n",
"\n",
"Executor also lets you choose the environment and machine type while automating the runs similar to Vertex AI training jobs without switching to the training jobs UI. Apart from the custom container that replicates the existing kernel by default, pre-built environments like TensorFlow Enterprise, PyTorch, and others can also be selected to run the notebook. Furthermore the required compute power can be specified by choosing from the list of machine types available, including GPUs.\n",
"The executor also lets you choose the environment and machine type while automating the runs similar to Vertex AI training jobs without switching to the training jobs UI. Apart from the custom container that replicates the existing kernel by default, pre-built environments like TensorFlow Enterprise, PyTorch, and others can also be selected to run the notebook. The required compute power can be specified by choosing from the list of machine types available, including GPUs.\n",
"\n",
"## Scheduled runs on executor\n",
"\n",
"Notebook runs can also be scheduled recurringly with the executor. To do so, select Schedule-based recurring executions as the run type instead of One-time execution. The frequency of the job and the time when it executes is provided when you create the execution.\n",
"\n",
"<img src=\"https://storage.googleapis.com/gweb-cloudblog-publish/images/7_Vertex_AI_Workbench.max-1100x1100.jpg\">\n",
"\n",
"## Parameterizing the variables\n",
"Executor lets you run a notebook with different sets of input parameters.If you’ve added parameter tags to any of your notebook cells, you can pass in your parameter values to the executor. More about how to use this feature can be found on this [blog](https://cloud.google.com/blog/products/ai-machine-learning/schedule-and-execute-notebooks-with-vertex-ai-workbench).\n",
"\n",
"The executor lets you run a notebook with different sets of input parameters. If you’ve added parameter tags to any of your notebook cells, you can pass in your parameter values to the executor. More about how to use this feature can be found on this [blog](https://cloud.google.com/blog/products/ai-machine-learning/schedule-and-execute-notebooks-with-vertex-ai-workbench).\n",
"\n",
"<img src=\"https://storage.googleapis.com/gweb-cloudblog-publish/images/6_Vertex_AI_Workbench.max-700x700.jpg\">\n"
]
@@ -944,7 +984,7 @@
"## Clean up\n",
"<a name=\"section-14\"></a>\n",
"\n",
"Undeploy the model from endpoint."
"Undeploy the model from the endpoint."
]
},
{
@@ -1022,7 +1062,7 @@
],
"metadata": {
"colab": {
"name": "Predictive_maintenance_usecase.ipynb",
"name": "predictive_maintenance_usecase.ipynb",
"toc_visible": true
},
"kernelspec": {
@@ -0,0 +1,823 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "d1cc1c1fa076"
},
"source": [
"# Pricing Optimization \n",
"## Table of contents\n",
"* [Overview](#section-1)\n",
"* [Dataset](#section-2)\n",
"* [Objective](#section-3)\n",
"* [Costs](#section-4)\n",
"* [Create a BigQuery dataset](#section-5)\n",
"* [Load the dataset from Cloud Storage](#section-6)\n",
"* [Data analysis](#section-7)\n",
"* [Preprocess the data for training](#section-8)\n",
"* [Train the model using BigQuery ML](#section-9)\n",
"* [Generate forecasts from the model](#section-10)\n",
"* [Interpret the results to choose the best price](#section-11)\n",
"* [Clean up](#section-12)\n",
"\n",
"## Overview\n",
"<a name=\"section-1\"></a>\n",
"\n",
"This notebook demonstrates analysis of pricing optimization on [CDM Pricing Data](https://github.com/trifacta/trifacta-google-cloud/tree/main/design-pattern-pricing-optimization) and automating the workflow using Vertex AI Workbench managed notebooks.\n",
"\n",
"*Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
"\n",
"## Dataset\n",
"<a name=\"section-2\"></a>\n",
"\n",
"The dataset used in this notebook is a part of the [CDM Pricing dataset](https://github.com/trifacta/trifacta-google-cloud/blob/main/design-pattern-pricing-optimization/CDM_Pricing_large_table.csv), which consists of product sales information on specified dates.\n",
"\n",
"## Objective\n",
"<a name=\"section-3\"></a>\n",
"\n",
"The objective of this notebook is to build a pricing optimization model using Vertex AI. The following steps have been followed: \n",
"\n",
"- Load the required dataset from a Cloud Storage bucket.\n",
"- Analyze the fields present in the dataset.\n",
"- Process the data to build a model.\n",
"- Build a BigQuery ML forecast model on the processed data.\n",
"- Get forecasted values from the BigQuery ML model.\n",
"- Interpret the forecasts to identify the best prices.\n",
"- Clean up.\n",
"\n",
"## Costs\n",
"<a name=\"section-4\"></a>\n",
"\n",
"This tutorial uses the following billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- BigQuery\n",
"- Cloud Storage\n",
"\n",
"\n",
"Learn about [Vertex AI\n",
"pricing](https://cloud.google.com/vertex-ai/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
"Calculator](https://cloud.google.com/products/calculator/)\n",
"to generate a cost estimate based on your projected usage.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5ed1f5e85640"
},
"source": [
"## Before you begin\n",
"\n",
"### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c3f30148b66d"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "750bf2883c2d"
},
"source": [
"Otherwise, set your project ID here."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3c6db1ca88b9"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2a1c270c7d34"
},
"source": [
"### Import the required libraries and define constants\n"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "acc6fac1fa55"
},
"outputs": [],
"source": [
"import matplotlib.pyplot as plt\n",
"import pandas as pd\n",
"import seaborn as sns\n",
"from google.cloud import bigquery\n",
"from google.cloud.bigquery import Client"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a06006dff8f9"
},
"outputs": [],
"source": [
"DATASET = \"[your-bigquery-dataset-id]\" # set the BigQuery dataset-id\n",
"TRAINING_DATA_TABLE = \"[your-bigquery-table-id-to-store-the-training-data]\" # set the BigQuery table-id to store the training data"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "016c3d47cc69"
},
"source": [
"## Create a BigQuery dataset\n",
"<a name=\"section-5\"></a>\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "12ccd8d7956e"
},
"source": [
"#@bigquery\n",
"-- create a dataset in BigQuery\n",
"\n",
"CREATE SCHEMA pricing_optimization\n",
"OPTIONS(\n",
" location=\"us\"\n",
" )"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "c106b978a79b"
},
"source": [
"## Load the dataset from Cloud Storage\n",
"<a name=\"section-6\"></a>\n"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8aeae9da9796"
},
"outputs": [],
"source": [
"DATA_LOCATION = \"gs://cloud-samples-data/ai-platform-unified/datasets/tabular/cdm_pricing_large_table.csv\"\n",
"df = pd.read_csv(DATA_LOCATION)\n",
"print(df.shape)\n",
"df.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "7b98d5f09842"
},
"source": [
"You will build a forecast model on this data and thus determine the best price for a product. For this type of model, you will not be using many fields: only the sales and price related ones. For the current execrcise, focus on the following fields:\n",
"\n",
"- `Product_ID`\n",
"- `Customer_Hierarchy`\n",
"- `Fiscal_Date`\n",
"- `List_Price_Converged`\n",
"- `Invoiced_quantity_in_Pieces`\n",
"- `Net_Sales`\n",
"\n",
"## Data Analysis\n",
"<a name=\"section-7\"></a>\n",
"\n",
"First, explore the data and distributions.\n",
"\n",
"Select the required columns from the dataframe."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "af4b41c5eb1f"
},
"outputs": [],
"source": [
"id_col = \"Product_ID\"\n",
"date_col = \"Fiscal_Date\"\n",
"categ_cols = [\"Customer_Hierarchy\"]\n",
"num_cols = [\"List_Price_Converged\", \"Invoiced_quantity_in_Pieces\", \"Net_Sales\"]\n",
"\n",
"df = df[[id_col, date_col] + categ_cols + num_cols].copy()\n",
"df.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3d780043ee5b"
},
"source": [
"Check the column types and null values in the dataframe."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f54c445a1288"
},
"outputs": [],
"source": [
"df.info()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cd817b414c4d"
},
"source": [
"This data description reveals that there are no null values in the data. Also, the field `Fiscal_Date` which is a date field is loaded as an object type. \n",
"\n",
"Change the type of the date field to datetime."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b160fac085c8"
},
"outputs": [],
"source": [
"df[\"Fiscal_Date\"] = pd.to_datetime(df[\"Fiscal_Date\"], infer_datetime_format=True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fb4778578064"
},
"source": [
"Plot the distributions for the categorical fields."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "dd0467cd57c3"
},
"outputs": [],
"source": [
"for i in categ_cols:\n",
" df[i].value_counts(normalize=True).plot(kind=\"bar\")\n",
" plt.title(i)\n",
" plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "145deed255e0"
},
"source": [
"Plot the distributions for the numerical fields."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f934137c6d82"
},
"outputs": [],
"source": [
"for i in num_cols:\n",
" _, ax = plt.subplots(1, 2, figsize=(10, 4))\n",
" df[i].plot(kind=\"box\", ax=ax[0])\n",
" df[i].plot(kind=\"hist\", ax=ax[1])\n",
" ax[0].set_title(i + \"-Boxplot\")\n",
" ax[1].set_title(i + \"-Histogram\")\n",
" plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f9b9c2e58380"
},
"source": [
"Check the maximum date and minimum date in Fiscal_Date column."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2a10aa689f9d"
},
"outputs": [],
"source": [
"print(df[\"Fiscal_Date\"].max())\n",
"print(df[\"Fiscal_Date\"].min())"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "4834f63e2e59"
},
"source": [
"Check the product distribution across each category."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4664877f5304"
},
"outputs": [],
"source": [
"grp_cols = [\"Customer_Hierarchy\", \"Product_ID\"]\n",
"grp_df = df[grp_cols].groupby(by=grp_cols).count().reset_index()\n",
"grp_df.groupby(\"Customer_Hierarchy\").nunique()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "01ed02b9c8fd"
},
"source": [
"Check the percentage changes in the orders based on the percentage changes in the price."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b2c428cb135"
},
"outputs": [],
"source": [
"# aggregate the data\n",
"df_aggr = (\n",
" df.groupby([\"Product_ID\", \"List_Price_Converged\"])\n",
" .agg({\"Fiscal_Date\": min, \"Invoiced_quantity_in_Pieces\": sum, \"Net_Sales\": sum})\n",
" .reset_index()\n",
")\n",
"# rename the aggregated columns\n",
"df_aggr.rename(\n",
" columns={\n",
" \"Fiscal_Date\": \"First_price_date\",\n",
" \"Invoiced_quantity_in_Pieces\": \"Total_ordered_pieces\",\n",
" \"Net_Sales\": \"Total_net_sales\",\n",
" },\n",
" inplace=True,\n",
")\n",
"\n",
"# sort values chronologically\n",
"df_aggr.sort_values(by=[\"Product_ID\", \"First_price_date\"], inplace=True)\n",
"df_aggr.reset_index(drop=True, inplace=True)\n",
"\n",
"# add columns for previous values\n",
"df_aggr[\"Previous_List\"] = df_aggr.groupby([\"Product_ID\"])[\n",
" \"List_Price_Converged\"\n",
"].shift()\n",
"df_aggr[\"Previous_Total_ordered_pieces\"] = df_aggr.groupby([\"Product_ID\"])[\n",
" \"Total_ordered_pieces\"\n",
"].shift()\n",
"\n",
"# average price change across sku's\n",
"df_aggr[\"price_change_perc\"] = (\n",
" (df_aggr[\"List_Price_Converged\"] - df_aggr[\"Previous_List\"])\n",
" / df_aggr[\"Previous_List\"].fillna(0)\n",
" * 100\n",
")\n",
"df_aggr[\"order_change_perc\"] = (\n",
" (df_aggr[\"Total_ordered_pieces\"] - df_aggr[\"Previous_Total_ordered_pieces\"])\n",
" / df_aggr[\"Previous_Total_ordered_pieces\"].fillna(0)\n",
" * 100\n",
")\n",
"\n",
"# plot a scatterplot to visualize the changes\n",
"sns.scatterplot(\n",
" x=\"price_change_perc\",\n",
" y=\"order_change_perc\",\n",
" data=df_aggr,\n",
" hue=\"Product_ID\",\n",
" legend=False,\n",
")\n",
"plt.title(\"Percentage of change in price vs order\")\n",
"plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8259e916fe25"
},
"source": [
"For most of the products, the percentage change in orders are high where the percentage changes in the prices are low. This suggests that too much change in the prices can affect the number of orders. \n",
"\n",
"**Note**: There seem to be some outliers in the data as percentage changes greater than 800 are found. In the current exercise, do not take any manual measures to deal with outliers as you will create a BigQuery ML timeseries model that already deals with outliers.\n",
"\n",
"## Preprocess the data for training\n",
"<a name=\"section-8\"></a>\n",
"\n",
"Check which `Product_ID`'s have the maximum orders."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f5cbc7709c6a"
},
"outputs": [],
"source": [
"df_orders = df.groupby([\"Product_ID\", \"Customer_Hierarchy\"], as_index=False)[\n",
" \"Invoiced_quantity_in_Pieces\"\n",
"].sum()\n",
"df_orders.loc[\n",
" df_orders.groupby(\"Customer_Hierarchy\")[\"Invoiced_quantity_in_Pieces\"].idxmax()\n",
"]"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fd6d227e513e"
},
"source": [
"From the above result, you can infer the following:\n",
"\n",
"- Under the **Food** category, **SKU 62** has the maximum orders.\n",
"- Under the **Manufacturing** category, **SKU 17** has the maximum orders.\n",
"- Under the **Paper** category, **SKU 107** has the maximum orders.\n",
"- Under the **Publishing** category, **SKU 8** has the maximum orders.\n",
"- Under the **Utilities** category, **SKU 140** has the maximum orders.\n",
"\n",
"Given that there are too many ids and only a few records for most of them, consider only the above `Product_ID`s for which there are a maximum number of orders. \n",
"\n",
"**Note**: The `Invoiced_quantity_in_Pieces` field seems to be a *float* type rather than an *int* type as it should be. This could be because the data itself might be averaged in the first place."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2dbc0d64d157"
},
"source": [
"Check the various prices available for these `Product_ID`s."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "acc1dbd2d838"
},
"outputs": [],
"source": [
"df_type_food = df[(df[\"Product_ID\"] == \"SKU 62\") & (df[\"Customer_Hierarchy\"] == \"Food\")]\n",
"print(\"Food :\")\n",
"print(df_type_food[\"List_Price_Converged\"].value_counts())\n",
"df_type_manuf = df[\n",
" (df[\"Product_ID\"] == \"SKU 17\") & (df[\"Customer_Hierarchy\"] == \"Manufacturing\")\n",
"]\n",
"print(\"Manufacturing :\")\n",
"print(df_type_manuf[\"List_Price_Converged\"].value_counts())\n",
"df_type_paper = df[\n",
" (df[\"Product_ID\"] == \"SKU 107\") & (df[\"Customer_Hierarchy\"] == \"Paper\")\n",
"]\n",
"print(\"Paper :\")\n",
"print(df_type_paper[\"List_Price_Converged\"].value_counts())\n",
"df_type_pub = df[\n",
" (df[\"Product_ID\"] == \"SKU 8\") & (df[\"Customer_Hierarchy\"] == \"Publishing\")\n",
"]\n",
"print(\"Publishing :\")\n",
"print(df_type_pub[\"List_Price_Converged\"].value_counts())\n",
"df_type_util = df[\n",
" (df[\"Product_ID\"] == \"SKU 140\") & (df[\"Customer_Hierarchy\"] == \"Utilities\")\n",
"]\n",
"print(\"Utilities :\")\n",
"print(df_type_util[\"List_Price_Converged\"].value_counts())"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f023af578c0f"
},
"source": [
"In the publishing category, `Product_ID` `SKU 8` and `SKU 17` are less than or equal to two different prices in the entire data and so you will exclude them and consider the rest for building the forecast model. The idea here is to train a forecast model on the timeseries data for products with different prices.\n",
"\n",
"Join the data for all the `Product_ID`s into one dataframe and remove duplicate records."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a44771cc4c20"
},
"outputs": [],
"source": [
"df_final = pd.concat([df_type_food, df_type_paper, df_type_util])\n",
"df_final = (\n",
" df_final[\n",
" [\n",
" \"Product_ID\",\n",
" \"Fiscal_Date\",\n",
" \"Customer_Hierarchy\",\n",
" \"List_Price_Converged\",\n",
" \"Invoiced_quantity_in_Pieces\",\n",
" ]\n",
" ]\n",
" .drop_duplicates()\n",
" .reset_index(drop=True)\n",
")\n",
"df_final.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "add5063df368"
},
"source": [
"Save the data to a BigQuery table."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fd82ba56571f"
},
"outputs": [],
"source": [
"bq_client = bigquery.Client(project=PROJECT_ID)\n",
"\n",
"job_config = bigquery.LoadJobConfig(\n",
" # Specify a (partial) schema. All columns are always written to the\n",
" # table. The schema is used to assist in data type definitions.\n",
" schema=[\n",
" bigquery.SchemaField(\"Product_ID\", bigquery.enums.SqlTypeNames.STRING),\n",
" bigquery.SchemaField(\"Fiscal_Date\", bigquery.enums.SqlTypeNames.DATE),\n",
" bigquery.SchemaField(\"List_Price_Converged\", bigquery.enums.SqlTypeNames.FLOAT),\n",
" bigquery.SchemaField(\n",
" \"Invoiced_quantity_in_Pieces\", bigquery.enums.SqlTypeNames.FLOAT\n",
" ),\n",
" ],\n",
" # Optionally, set the write disposition. BigQuery appends loaded rows\n",
" # to an existing table by default, but with WRITE_TRUNCATE write\n",
" # disposition it replaces the table with the loaded data.\n",
" write_disposition=\"WRITE_TRUNCATE\",\n",
")\n",
"\n",
"# save the dataframe to a table in the created dataset\n",
"job = bq_client.load_table_from_dataframe(\n",
" df_final,\n",
" \"{}.{}.{}\".format(PROJECT_ID, DATASET, TRAINING_DATA_TABLE),\n",
" job_config=job_config,\n",
") # Make an API request.\n",
"job.result() # Wait for the job to complete."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fca77641b03b"
},
"source": [
"# Train the model using BigQuery ML\n",
"<a name=\"section-9\"></a>\n",
"\n",
"Train an [Arima-Plus](https://cloud.google.com/bigquery-ml/docs/reference/standard-sql/bigqueryml-syntax-create-time-series) model on the data using BigQuery ML."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cded27507891"
},
"source": [
"#@bigquery\n",
"create or replace model pricing_optimization.bqml_arima\n",
"options\n",
" (model_type = 'ARIMA_PLUS',\n",
" time_series_timestamp_col = 'Fiscal_Date',\n",
" time_series_data_col = 'Invoiced_quantity_in_Pieces',\n",
" time_series_id_col = 'ID'\n",
" ) as\n",
"select\n",
" Fiscal_Date,\n",
" Concat(Product_ID,\"_\" ,Cast(List_Price_Converged as string)) as ID,\n",
" Invoiced_quantity_in_Pieces\n",
"from\n",
" pricing_optimization.TRAINING_DATA\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "332fd11ff32b"
},
"source": [
"## Generate forecasts from the model\n",
"<a name=\"section-10\"></a>\n",
"\n",
"Predict the sales for the next 30 days for each id and save to a dataframe."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ef926cdbf28e"
},
"outputs": [],
"source": [
"client = Client()\n",
"\n",
"query = '''\n",
"DECLARE HORIZON STRING DEFAULT \"30\"; #number of values to forecast\n",
"DECLARE CONFIDENCE_LEVEL STRING DEFAULT \"0.90\"; ## required confidence level\n",
"\n",
"EXECUTE IMMEDIATE format(\"\"\"\n",
" SELECT\n",
" *\n",
" FROM \n",
" ML.FORECAST(MODEL pricing_optimization.bqml_arima, \n",
" STRUCT(%s AS horizon, \n",
" %s AS confidence_level)\n",
" )\n",
" \"\"\",HORIZON,CONFIDENCE_LEVEL)'''\n",
"job = client.query(query)\n",
"dfforecast = job.to_dataframe()\n",
"dfforecast.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "608c7de72dae"
},
"source": [
"## Interpret the results to choose the best price\n",
"<a name=\"section-11\"></a>\n",
"\n",
"Calculate average forecast values for the forecast duration."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e1e193680400"
},
"outputs": [],
"source": [
"dfforecast_avg = (\n",
" dfforecast[[\"ID\", \"forecast_value\"]].groupby(\"ID\", as_index=False).mean()\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5ce395d652a3"
},
"source": [
"Extract the ID and Price fields from the ID field."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "452c56fa58ed"
},
"outputs": [],
"source": [
"dfforecast_avg[\"Product_ID\"] = dfforecast_avg[\"ID\"].apply(lambda x: x.split(\"_\")[0])\n",
"dfforecast_avg[\"Price\"] = dfforecast_avg[\"ID\"].apply(lambda x: x.split(\"_\")[1])"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3cee67f4028f"
},
"source": [
"Plot the average forecasted sales vs. the price of the product."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fb351c8f383d"
},
"outputs": [],
"source": [
"for i in dfforecast_avg[\"Product_ID\"].unique():\n",
" dfforecast_avg[dfforecast_avg[\"Product_ID\"] == i].set_index(\"Price\").sort_values(\n",
" \"forecast_value\"\n",
" ).plot(kind=\"bar\")\n",
" plt.title(\"Price vs. Average Sales for \" + i)\n",
" plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "67ff3acc74a5"
},
"source": [
"Based on the plots for price vs. the average forecasted orders, it can be said that to use the maximum orders, each of the considered `Product_ID`s can follow the below prices:\n",
"\n",
"- SKU 107's price range can be from 4.44 - 4.73 units\n",
"- SKU 140's price can be 1.95 units\n",
"- SKU 62's price can be 4.23 units\n",
"\n",
"\n",
"## Clean Up\n",
"<a name=\"section-12\"></a>\n",
"\n",
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial. The following code deletes the entire dataset."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d78908b8134d"
},
"outputs": [],
"source": [
"# Construct a BigQuery client object.\n",
"client = bigquery.Client()\n",
"\n",
"# TODO(developer): Set model_id to the ID of the model to fetch.\n",
"dataset_id = \"{PROJECT}.{DATASET}\".format(PROJECT=PROJECT_ID, DATASET=DATASET)\n",
"\n",
"# Use the delete_contents parameter to delete a dataset and its contents.\n",
"# Use the not_found_ok parameter to not receive an error if the dataset has already been deleted.\n",
"client.delete_dataset(\n",
" dataset_id, delete_contents=True, not_found_ok=True\n",
") # Make an API request.\n",
"\n",
"print(\"Deleted dataset '{}'.\".format(dataset_id))"
]
}
],
"metadata": {
"colab": {
"name": "pricing-optimization.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -459,7 +459,7 @@
},
"outputs": [],
"source": [
"! gsutil cp gs://cloud-samples-data/ai-platform-unified/matching_engine/glove-100-angular.hdf5 ."
"! gsutil cp gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5 ."
]
},
{
File diff suppressed because it is too large Load Diff
@@ -1,877 +0,0 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ur8xi4C7S06n"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "JAPoU8Sm5E6e"
},
"source": [
"<table align=\"left\">\n",
"\n",
" <td>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/master/notebooks/community/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/notebooks/community/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "WBFL9LagqmwT"
},
"source": [
"#Vertex AI: Track parameters and metrics for locally trained models"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "tvgnzT1CKxrO"
},
"source": [
"## Overview\n",
"\n",
"This notebook demonstrates how to track metrics and parameters for ML training jobs and analyze this metadata using Vertex SDK for Python.\n",
"\n",
"### Dataset\n",
"\n",
"In this notebook, we will train a simple distributed neural network (DNN) model to predict automobile's miles per gallon (MPG) based on automobile information in the [auto-mpg dataset](https://www.kaggle.com/devanshbesain/exploration-and-analysis-auto-mpg).\n",
"\n",
"### Objective\n",
"\n",
"In this notebook, you will learn how to use Vertex SDK for Python to:\n",
"\n",
" * Track parameters and metrics for a locally trainined model.\n",
" * Extract and perform analysis for all parameters and metrics within an Experiment.\n",
"\n",
"### Costs \n",
"\n",
"\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"* Vertex AI\n",
"* Cloud Storage\n",
"\n",
"\n",
"Learn about [Vertex AI\n",
"pricing](https://cloud.google.com/vertex-ai/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
"Calculator](https://cloud.google.com/products/calculator/)\n",
"to generate a cost estimate based on your projected usage."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ze4-nDLfK4pw"
},
"source": [
"### Set up your local development environment\n",
"\n",
"**If you are using Colab or Google Cloud Notebooks**, your environment already meets\n",
"all the requirements to run this notebook. You can skip this step."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gCuSR8GkAgzl"
},
"source": [
"**Otherwise**, make sure your environment meets this notebook's requirements.\n",
"You need the following:\n",
"\n",
"* The Google Cloud SDK\n",
"* Git\n",
"* Python 3\n",
"* virtualenv\n",
"* Jupyter notebook running in a virtual environment with Python 3\n",
"\n",
"The Google Cloud guide to [Setting up a Python development\n",
"environment](https://cloud.google.com/python/setup) and the [Jupyter\n",
"installation guide](https://jupyter.org/install) provide detailed instructions\n",
"for meeting these requirements. The following steps provide a condensed set of\n",
"instructions:\n",
"\n",
"1. [Install and initialize the Cloud SDK.](https://cloud.google.com/sdk/docs/)\n",
"\n",
"1. [Install Python 3.](https://cloud.google.com/python/setup#installing_python)\n",
"\n",
"1. [Install\n",
" virtualenv](https://cloud.google.com/python/setup#installing_and_using_virtualenv)\n",
" and create a virtual environment that uses Python 3. Activate the virtual environment.\n",
"\n",
"1. To install Jupyter, run `pip install jupyter` on the\n",
"command-line in a terminal shell.\n",
"\n",
"1. To launch Jupyter, run `jupyter notebook` on the command-line in a terminal shell.\n",
"\n",
"1. Open this notebook in the Jupyter Notebook Dashboard."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "i7EUnXsZhAGF"
},
"source": [
"### Install additional packages\n",
"\n",
"Run the following commands to install the Vertex SDK for Python."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "IaYsrh0Tc17L"
},
"outputs": [],
"source": [
"import sys\n",
"\n",
"if \"google.colab\" in sys.modules:\n",
" USER_FLAG = \"\"\n",
"else:\n",
" USER_FLAG = \"--user\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "wyy5Lbnzg5fi"
},
"outputs": [],
"source": [
"!python3 -m pip install {USER_FLAG} google-cloud-aiplatform --upgrade"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "hhq5zEbGg0XX"
},
"source": [
"### Restart the kernel\n",
"\n",
"After you install the additional packages, you need to restart the notebook kernel so it can find the packages."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "EzrelQZ22IZj"
},
"outputs": [],
"source": [
"# Automatically restart kernel after installs\n",
"import os\n",
"\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" # Automatically restart kernel after installs\n",
" import IPython\n",
"\n",
" app = IPython.Application.instance()\n",
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lWEdiXsJg0XY"
},
"source": [
"## Before you begin\n",
"\n",
"### Select a GPU runtime\n",
"\n",
"**Make sure you're running this notebook in a GPU runtime if you have that option. In Colab, select \"Runtime --> Change runtime type > GPU\"**"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "BF1j6f9HApxa"
},
"source": [
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com).\n",
"\n",
"1. If you are running this notebook locally, you will need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "WReHDGG5g0XY"
},
"source": [
"#### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "oM1iC_MfAts1"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "qJYoRfYng0XZ"
},
"source": [
"Otherwise, set your project ID here."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "riG_qUokg0XZ"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "06571eb4063b"
},
"source": [
"#### Timestamp\n",
"\n",
"If you are in a live tutorial session, you might be using a shared test account or project. To avoid name collisions between users on resources created, you create a timestamp for each instance session, and append it onto the name of resources you create in this tutorial."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "697568e92bd6"
},
"outputs": [],
"source": [
"from datetime import datetime\n",
"\n",
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dr--iN2kAylZ"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Google Cloud Notebooks**, your environment is already\n",
"authenticated. Skip this step."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "sBCra4QMA2wR"
},
"source": [
"**If you are using Colab**, run the cell below and follow the instructions\n",
"when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"1. In the Cloud Console, go to the [**Create service account key**\n",
" page](https://console.cloud.google.com/apis/credentials/serviceaccountkey).\n",
"\n",
"2. Click **Create service account**.\n",
"\n",
"3. In the **Service account name** field, enter a name, and\n",
" click **Create**.\n",
"\n",
"4. In the **Grant this service account access to project** section, click the **Role** drop-down list. Type \"Vertex AI\"\n",
"into the filter box, and select\n",
" **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"5. Click *Create*. A JSON file that contains your key downloads to your\n",
"local environment.\n",
"\n",
"6. Enter the path to your service account key as the\n",
"`GOOGLE_APPLICATION_CREDENTIALS` variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "PyQmSRbKA8r-"
},
"outputs": [],
"source": [
"import os\n",
"import sys\n",
"\n",
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"# If on Google Cloud Notebooks, then don't execute this code\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\"):\n",
" if \"google.colab\" in sys.modules:\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "XoEqT2Y4DJmf"
},
"source": [
"### Import libraries and define constants"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "Y9Uo3tifg1kx"
},
"source": [
"Import required libraries."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "pRUOFELefqf1"
},
"outputs": [],
"source": [
"import matplotlib.pyplot as plt\n",
"import pandas as pd\n",
"from google.cloud import aiplatform\n",
"from tensorflow.python.keras import Sequential, layers\n",
"from tensorflow.python.keras.utils import data_utils"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "xtXZWmYqJ1bh"
},
"source": [
"Define some constants"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "JIOrI-hoJ46P"
},
"outputs": [],
"source": [
"EXPERIMENT_NAME = \"\" # @param {type:\"string\"}\n",
"REGION = \"[your-region]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jWQLXXNVN4Lv"
},
"source": [
"If EXEPERIMENT_NAME is not set, set a default one below:"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "Q1QInYWOKsmo"
},
"outputs": [],
"source": [
"if EXPERIMENT_NAME == \"\" or EXPERIMENT_NAME is None:\n",
" EXPERIMENT_NAME = \"my-experiment-\" + TIMESTAMP"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "Xuny18aMcWDb"
},
"source": [
"## Concepts\n",
"\n",
"To better understanding how parameters and metrics are stored and organized, we'd like to introduce the following concepts:\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "NThDci5bp0Uw"
},
"source": [
"### Experiment\n",
"Experiments describe a context that groups your runs and the artifacts you create into a logical session. For example, in this notebook you create an Experiment and log data to that experiment."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "SAyRR3Ydp4X5"
},
"source": [
"### Run\n",
"A run represents a single path/avenue that you executed while performing an experiment. A run includes artifacts that you used as inputs or outputs, and parameters that you used in this execution. An Experiment can contain multiple runs. "
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "l1YW2pgyegFP"
},
"source": [
"## Getting started tracking parameters and metrics\n",
"\n",
"You can use the Vertex SDK for Python to track metrics and parameters for models trained locally. \n",
"\n",
"In the following example, you train a simple distributed neural network (DNN) model to predict automobile's miles per gallon (MPG) based on automobile information in the [auto-mpg dataset](https://www.kaggle.com/devanshbesain/exploration-and-analysis-auto-mpg)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "KPY41M9_AhZU"
},
"source": [
"### Load and process the training dataset"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bfMQSmRuUuX-"
},
"source": [
"Download and process the dataset."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "RiQuMv4bmpuV"
},
"outputs": [],
"source": [
"def read_data(uri):\n",
" dataset_path = data_utils.get_file(\"auto-mpg.data\", uri)\n",
" column_names = [\n",
" \"MPG\",\n",
" \"Cylinders\",\n",
" \"Displacement\",\n",
" \"Horsepower\",\n",
" \"Weight\",\n",
" \"Acceleration\",\n",
" \"Model Year\",\n",
" \"Origin\",\n",
" ]\n",
" raw_dataset = pd.read_csv(\n",
" dataset_path,\n",
" names=column_names,\n",
" na_values=\"?\",\n",
" comment=\"\\t\",\n",
" sep=\" \",\n",
" skipinitialspace=True,\n",
" )\n",
" dataset = raw_dataset.dropna()\n",
" dataset[\"Origin\"] = dataset[\"Origin\"].map(\n",
" lambda x: {1: \"USA\", 2: \"Europe\", 3: \"Japan\"}.get(x)\n",
" )\n",
" dataset = pd.get_dummies(dataset, prefix=\"\", prefix_sep=\"\")\n",
" return dataset\n",
"\n",
"\n",
"dataset = read_data(\n",
" \"http://archive.ics.uci.edu/ml/machine-learning-databases/auto-mpg/auto-mpg.data\"\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "Y06J7A7yU21t"
},
"source": [
"Split dataset for training and testing."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "p5JBCBKyH-NC"
},
"outputs": [],
"source": [
"def train_test_split(dataset, split_frac=0.8, random_state=0):\n",
" train_dataset = dataset.sample(frac=split_frac, random_state=random_state)\n",
" test_dataset = dataset.drop(train_dataset.index)\n",
" train_labels = train_dataset.pop(\"MPG\")\n",
" test_labels = test_dataset.pop(\"MPG\")\n",
"\n",
" return train_dataset, test_dataset, train_labels, test_labels\n",
"\n",
"\n",
"train_dataset, test_dataset, train_labels, test_labels = train_test_split(dataset)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gaNNTFPaU7KT"
},
"source": [
"Normalize the features in the dataset for better model performance."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "VGq5QCoyIEWJ"
},
"outputs": [],
"source": [
"def normalize_dataset(train_dataset, test_dataset):\n",
" train_stats = train_dataset.describe()\n",
" train_stats = train_stats.transpose()\n",
"\n",
" def norm(x):\n",
" return (x - train_stats[\"mean\"]) / train_stats[\"std\"]\n",
"\n",
" normed_train_data = norm(train_dataset)\n",
" normed_test_data = norm(test_dataset)\n",
"\n",
" return normed_train_data, normed_test_data\n",
"\n",
"\n",
"normed_train_data, normed_test_data = normalize_dataset(train_dataset, test_dataset)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "UBXUgxgqA_GB"
},
"source": [
"### Define ML model and training function"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "66odBYKrIN4q"
},
"outputs": [],
"source": [
"def train(\n",
" train_data,\n",
" train_labels,\n",
" num_units=64,\n",
" activation=\"relu\",\n",
" dropout_rate=0.0,\n",
" validation_split=0.2,\n",
" epochs=1000,\n",
"):\n",
"\n",
" model = Sequential(\n",
" [\n",
" layers.Dense(\n",
" num_units,\n",
" activation=activation,\n",
" input_shape=[len(train_dataset.keys())],\n",
" ),\n",
" layers.Dropout(rate=dropout_rate),\n",
" layers.Dense(num_units, activation=activation),\n",
" layers.Dense(1),\n",
" ]\n",
" )\n",
"\n",
" model.compile(loss=\"mse\", optimizer=\"adam\", metrics=[\"mae\", \"mse\"])\n",
" print(model.summary())\n",
"\n",
" history = model.fit(\n",
" train_data, train_labels, epochs=epochs, validation_split=validation_split\n",
" )\n",
"\n",
" return model, history"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "O8XJZB3gR8eL"
},
"source": [
"### Initialize the Vertex AI SDK for Python and create an Experiment\n",
"\n",
"Initialize the *client* for Vertex AI and create an experiment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "o_wnT10RJ7-W"
},
"outputs": [],
"source": [
"aiplatform.init(project=PROJECT_ID, location=REGION, experiment=EXPERIMENT_NAME)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "u-iTnzt3B6Z_"
},
"source": [
"### Start several model training runs\n",
"\n",
"Training parameters and metrics are logged for each run."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "i2wnpu8_7JfV"
},
"outputs": [],
"source": [
"parameters = [\n",
" {\"num_units\": 16, \"epochs\": 3, \"dropout_rate\": 0.1},\n",
" {\"num_units\": 16, \"epochs\": 10, \"dropout_rate\": 0.1},\n",
" {\"num_units\": 16, \"epochs\": 10, \"dropout_rate\": 0.2},\n",
" {\"num_units\": 32, \"epochs\": 10, \"dropout_rate\": 0.1},\n",
" {\"num_units\": 32, \"epochs\": 10, \"dropout_rate\": 0.2},\n",
"]\n",
"\n",
"for i, params in enumerate(parameters):\n",
" aiplatform.start_run(run=f\"auto-mpg-local-run-{i}\")\n",
" aiplatform.log_params(params)\n",
" model, history = train(\n",
" normed_train_data,\n",
" train_labels,\n",
" num_units=params[\"num_units\"],\n",
" activation=\"relu\",\n",
" epochs=params[\"epochs\"],\n",
" dropout_rate=params[\"dropout_rate\"],\n",
" )\n",
" aiplatform.log_metrics(\n",
" {metric: values[-1] for metric, values in history.history.items()}\n",
" )\n",
"\n",
" loss, mae, mse = model.evaluate(normed_test_data, test_labels, verbose=2)\n",
" aiplatform.log_metrics({\"eval_loss\": loss, \"eval_mae\": mae, \"eval_mse\": mse})"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jZLrJZTfL7tE"
},
"source": [
"### Extract parameters and metrics into a dataframe for analysis"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "A1PqKxlpOZa2"
},
"source": [
"We can also extract all parameters and metrics associated with any Experiment into a dataframe for further analysis."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "jbRf1WoH_vbY"
},
"outputs": [],
"source": [
"experiment_df = aiplatform.get_experiment_df()\n",
"experiment_df"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "EYuYgqVCMKU1"
},
"source": [
"### Visualizing an experiment's parameters and metrics"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "r8orCj8iJuO1"
},
"outputs": [],
"source": [
"plt.rcParams[\"figure.figsize\"] = [15, 5]\n",
"\n",
"ax = pd.plotting.parallel_coordinates(\n",
" experiment_df.reset_index(level=0),\n",
" \"run_name\",\n",
" cols=[\n",
" \"param.num_units\",\n",
" \"param.dropout_rate\",\n",
" \"param.epochs\",\n",
" \"metric.loss\",\n",
" \"metric.val_loss\",\n",
" \"metric.eval_loss\",\n",
" ],\n",
" color=[\"blue\", \"green\", \"pink\", \"red\"],\n",
")\n",
"ax.set_yscale(\"symlog\")\n",
"ax.legend(bbox_to_anchor=(1.0, 0.5))"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "WTHvPMweMlP1"
},
"source": [
"## Visualizing experiments in Cloud Console"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "F19_5lw0MqXv"
},
"source": [
"Run the following to get the URL of Vertex AI Experiments for your project.\n"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "GmN9vE9pqqzt"
},
"outputs": [],
"source": [
"print(\"Vertex AI Experiments:\")\n",
"print(\n",
" f\"https://console.cloud.google.com/ai/platform/experiments/experiments?folder=&organizationId=&project={PROJECT_ID}\"\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "TpV-iwP9qw9c"
},
"source": [
"## Cleaning up\n",
"\n",
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial."
]
}
],
"metadata": {
"colab": {
"collapsed_sections": [],
"name": "sdk-metric-parameter-tracking-for-locally-trained-models.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
+2 -2
View File
@@ -12,7 +12,7 @@ The purpose of this set of notebooks and markdown files is to demonstrate Google
2. [Experimentation](stage2)
3. [Formalization](stage3)
4. [Evaluation](stage4)
5. Deployment
6. Serving
5. [Deployment](stage5)
6. [Serving](stage6)
7. Monitoring
8. Continuous Training
@@ -30,10 +30,78 @@ The first stage in MLOps is the collection and preparation for the purpose of de
[Get Started with BQ datasets](get_started_bq_datasets.ipynb)
```
The steps performed include:
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- compatible for `AutoML` training.
- Extract a copy of the dataset from `BigQuery` to a CSV file in Cloud Storage -- compatible for `AutoML` or custom training.
- Select rows from a `BigQuery` dataset into a `pandas` dataframe -- compatible for custom training.
- Select rows from a `BigQuery` dataset into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
- Select rows from extracted CSV files into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
- Create a `BigQuery` dataset from CSV files.
- Extract data from `BigQuery` table into a `DMatrix` -- compatible for custom training `XGBoost` models.
```
[Get Started with Vertex datasets](get_started_vertex_datasets.ipynb)
```
The steps performed include:
- Create a Vertex AI `Dataset` resource for:
- image data
- text data
- video data
- tabular data
- forecasting data
- Search `Dataset` resources using a filter.
- Read a sample of a `BigQuery` dataset into a dataframe.
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
- Detect anomalies in new data using TensorFlow Data Validation.
- Generate a TFRecord feature specification using TensorFlow Transform from the data schema.
- Export a dataset and convert to TFRecords.
```
[Get Started with Dataflow](get_started_dataflow.ipynb)
```
The steps performed include:
- Offline preprocessing of data:
- Serially - w/o dataflow
- Parallel - with dataflow
- Upstream preprocessing of data:
- tabular data
- image data
```
[Get Started with Data Labeling](get_started_data_labeling.ipynb)
```
The steps performed include:
- Create a Specialist Pool for data labelers.
- Create a data labeling job.
- Submit the data labeling job.
- List data labeling jobs.
- Cancel a data labeling job.
```
### E2E Stage Example
[Stage 1: Data Management](mlops_data_management.ipynb)
```
The steps performed include:
- Explore and visualize the data.
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- for AutoML training.
- Extract a copy of the dataset to a CSV file in Cloud Storage.
- Create a Vertex AI `Dataset` resource from CSV files -- alternative for AutoML training.
- Read a sample of the `BigQuery` dataset into a dataframe.
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
- Generate a TFRecord feature specification using TensorFlow Data Validation from the data schema.
- Preprocess a portion of the BigQuery data using `Dataflow` -- for custom training.
```
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -34,13 +34,18 @@
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" <td>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -67,7 +72,7 @@
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). In this version of the dataset you consider the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
]
},
{
@@ -104,7 +109,7 @@
"source": [
"### Recommendations\n",
"\n",
"When doing E2E MLOps on Google Cloud, the following best practices with structured (tabular) data in BigQuery:\n",
"When doing E2E MLOps on Google Cloud, following are the best practices when dealing with structured (tabular) data in BigQuery:\n",
"\n",
"- For AutoML training:\n",
" - Create a managed dataset with Vertex AI `TabularDataset`.\n",
@@ -124,7 +129,7 @@
" - Within the generator (upstream)\n",
" - Within the model (downstream)\n",
" - XGBoost model training:\n",
" - Use BigQuery ML builtin XGBoost training.\n",
" - Use BigQuery ML built-in XGBoost training.\n",
" - Alternatively, create a DMatrix generator from CSV files extracted from BigQuery table.\n",
" - Pytorch model training:\n",
" - Extract the BigQuery to a pandas dataframe.\n",
@@ -132,10 +137,19 @@
" - Create a DataLoader generator from the pandas dataframe.\n",
"\n",
"\n",
"- Alternately:\n",
"- Alternatively:\n",
" - Extract the BigQuery table to CSV files.\n",
" - Preprocess the CSV files.\n",
" - Create a tf.data.Dataset generator from the CSV files."
" - Create a tf.data.Dataset generator from the CSV files.\n",
" \n",
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Cloud Storage\n",
"- BigQuery\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
@@ -146,7 +160,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages to execute this notebook."
]
},
{
@@ -157,40 +171,26 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "install_xgboost"
},
"source": [
"Install the latest GA version of *XGBoost* library as well."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "install_xgboost"
},
"outputs": [],
"source": [
"! pip3 install -U xgboost $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"# Install the packages\n",
"! pip3 install --upgrade pyarrow $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
"! pip3 install -U xgboost $USER_FLAG -q\n",
"! pip3 install -U tensorflow $USER_FLAG -q\n",
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q"
]
},
{
@@ -222,6 +222,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "84cd83853240"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -298,7 +324,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -325,6 +354,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77c385f0db59"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "535223fa4b84"
},
"outputs": [],
"source": [
"i # If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -335,12 +425,7 @@
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"When you submit a custom training job using the Vertex SDK, you upload a Python package\n",
"containing your training code to a Cloud Storage bucket. Vertex AI runs\n",
"the code from this package. In this tutorial, Vertex AI also saves the\n",
"trained model that results from your job in the same bucket. You can then\n",
"create an `Endpoint` resource based on this output in order to serve\n",
"online predictions.\n",
"When you create a dataset resource using the Vertex SDK, you can provide a Cloud Storage bucket that contains the data. Vertex AI creates the dataset resource from the data. In this tutorial, Vertex AI also creates a dataset resource from your data in the Cloud Storage bucket.\n",
"\n",
"Set the name of your Cloud Storage bucket below. Bucket names must be globally unique across all Google Cloud projects, including those outside of your organization."
]
@@ -353,7 +438,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -364,8 +450,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -385,7 +472,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -405,7 +492,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -414,9 +501,6 @@
"id": "setup_vars"
},
"source": [
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
]
},
@@ -428,75 +512,12 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_bq"
},
"source": [
"#### Import BigQuery\n",
"\n",
"Import the BigQuery package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_bq"
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aiplatform\n",
"import pandas as pd\n",
"import xgboost as xgb\n",
"from google.cloud import bigquery"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_xgboost"
},
"source": [
"#### Import XGBoost\n",
"\n",
"Import the XGBoost package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_xgboost"
},
"outputs": [],
"source": [
"import xgboost as xgb"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_pandas"
},
"source": [
"#### Import pandas\n",
"\n",
"Import the pandas package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_pandas"
},
"outputs": [],
"source": [
"import pandas as pd"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -516,7 +537,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, location=REGION)"
"aiplatform.init(project=PROJECT_ID, location=REGION)"
]
},
{
@@ -538,7 +559,7 @@
},
"outputs": [],
"source": [
"bqclient = bigquery.Client()"
"bqclient = bigquery.Client(project=PROJECT_ID)"
]
},
{
@@ -549,7 +570,7 @@
"source": [
"#### Location of BigQuery training data.\n",
"\n",
"Now set the variable `IMPORT_FILE` to the location of the data table in BigQuery."
"Now, set the variable `IMPORT_FILE` to the location of the data table in BigQuery and `BQ_TABLE` with the table id."
]
},
{
@@ -591,10 +612,10 @@
},
"outputs": [],
"source": [
"dataset = aip.TabularDataset.create(\n",
"dataset = aiplatform.TabularDataset.create(\n",
" display_name=\"NOAA historical weather data\" + \"_\" + TIMESTAMP,\n",
" bq_source=[IMPORT_FILE],\n",
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
" labels={\"user_metadata\": BUCKET_URI[5:]},\n",
")\n",
"\n",
"label_column = \"mean_temp\"\n",
@@ -610,7 +631,7 @@
"source": [
"### Copy the dataset to Cloud Storage\n",
"\n",
"Next, you make a copy of the BigQuery dataset, as a CSV file, to Cloud Storage using the BigQuery extract command.\n",
"Next, you make a copy of the BigQuery table as a CSV file, to Cloud Storage using the BigQuery extract command.\n",
"\n",
"Learn more about [BigQuery command line interface](https://cloud.google.com/bigquery/docs/reference/bq-cli-reference)."
]
@@ -626,9 +647,9 @@
"comps = BQ_TABLE.split(\".\")\n",
"BQ_PROJECT_DATASET_TABLE = comps[0] + \":\" + comps[1] + \".\" + comps[2]\n",
"\n",
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_NAME/mydata*.csv\n",
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_URI/mydata*.csv\n",
"\n",
"IMPORT_FILES = ! gsutil ls $BUCKET_NAME/mydata*.csv\n",
"IMPORT_FILES = ! gsutil ls $BUCKET_URI/mydata*.csv\n",
"\n",
"print(IMPORT_FILES)\n",
"\n",
@@ -664,15 +685,12 @@
},
"outputs": [],
"source": [
"if \"IMPORT_FILES\" in globals():\n",
" gcs_source = IMPORT_FILES\n",
"else:\n",
" gcs_source = [IMPORT_FILE]\n",
"gcs_source = IMPORT_FILES\n",
"\n",
"dataset = aip.TabularDataset.create(\n",
"dataset = aiplatform.TabularDataset.create(\n",
" display_name=\"NOAA historical weather data\" + \"_\" + TIMESTAMP,\n",
" gcs_source=gcs_source,\n",
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
" labels={\"user_metadata\": BUCKET_URI[5:]},\n",
")\n",
"\n",
"\n",
@@ -694,6 +712,30 @@
"Learn more about [Creating BigQuery views](https://cloud.google.com/bigquery/docs/views)."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "7dc142433e50"
},
"outputs": [],
"source": [
"# Set dataset name and view name in BigQuery\n",
"BQ_MY_DATASET = \"[your-dataset-name]\"\n",
"BQ_MY_TABLE = \"[your-view-name]\"\n",
"\n",
"# Otherwise, use the default names\n",
"if (\n",
" BQ_MY_DATASET == \"\"\n",
" or BQ_MY_DATASET is None\n",
" or BQ_MY_DATASET == \"[your-dataset-name]\"\n",
"):\n",
" BQ_MY_DATASET = \"mlops_dataset_\" + TIMESTAMP\n",
"\n",
"if BQ_MY_TABLE == \"\" or BQ_MY_TABLE is None or BQ_MY_TABLE == \"[your-view-name]\":\n",
" BQ_MY_TABLE = \"mlops_view_\" + TIMESTAMP"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -702,8 +744,7 @@
},
"outputs": [],
"source": [
"BQ_MY_DATASET = 'mydataset'\n",
"BQ_MY_TABLE = 'myview'\n",
"# Create the resources\n",
"! bq --location=US mk -d \\\n",
"$PROJECT_ID:$BQ_MY_DATASET\n",
"\n",
@@ -744,8 +785,8 @@
},
"outputs": [],
"source": [
"# Download a table.\n",
"table = bigquery.TableReference.from_string(\"bigquery-public-data.samples.gsod\")\n",
"# Download the table.\n",
"table = bigquery.TableReference.from_string(BQ_TABLE)\n",
"\n",
"rows = bqclient.list_rows(\n",
" table,\n",
@@ -1031,22 +1072,6 @@
"TABLE_ID = \"gsod\"\n",
"\n",
"\n",
"def create_bigquery_dataset(dataset_id):\n",
" dataset = bigquery.Dataset(\n",
" bigquery.dataset.DatasetReference(PROJECT_ID, dataset_id)\n",
" )\n",
" dataset.location = \"us\"\n",
"\n",
" try:\n",
" dataset = bqclient.create_dataset(dataset) # API request\n",
" return True\n",
" except Exception as err:\n",
" print(err)\n",
" if err.code != 409: # http_client.CONFLICT\n",
" raise\n",
" return False\n",
"\n",
"\n",
"def load_data_into_bigquery(url, dataset_id, table_id):\n",
" create_bigquery_dataset(dataset_id)\n",
" dataset = bqclient.dataset(dataset_id)\n",
@@ -1079,13 +1104,11 @@
"source": [
"### Read BigQuery table into XGboost DMatrix\n",
"\n",
"Currently, there is no direct data feeding connector between BigQuery and the open source XGBoost.\n",
"Currently, there is no direct data feeding connector between BigQuery and the open source XGBoost. The BigQuery ML service has a built-in XGBoost training module.\n",
"\n",
"The BigQuery ML service has XGBoost training builtin.\n",
"Alernatively, you extract the data either as a pandas dataframe or as CSV files. The extracted data is then given as an input to a `DMatrix` object when training the model.\n",
"\n",
"Alernatively, you extract the data either as a pandas dataframe or as CSV files. The extracted data is then inputted to a `DMatrix` object when training the model.\n",
"\n",
"Learn more about [Getting started with builtin XGBoost](https://cloud.google.com/ai-platform/training/docs/algorithms/xgboost-start)"
"Learn more about [Getting started with built-in XGBoost](https://cloud.google.com/ai-platform/training/docs/algorithms/xgboost-start)."
]
},
{
@@ -1096,7 +1119,7 @@
"source": [
"### Read pandas table into XGboost DMatrix\n",
"\n",
"Next, you load the pandas dataframe into a `DMatrix` object. XGBoost does not support non-numeric inputs. Any column that is categorical will need to be one-hot encoded prior to loading the dataframe."
"Next, you load the pandas dataframe into a `DMatrix` object. XGBoost does not support non-numeric inputs. Any column that is categorical need to be one-hot encoded prior to loading the dataframe."
]
},
{
@@ -1122,7 +1145,7 @@
"source": [
"### Read CSV files into XGboost DMatrix\n",
"\n",
"Currently, there is no Cloud Storage support in XGBoost. If you use CSV files for input, you will need to download them locally."
"Currently, there is no Cloud Storage support in XGBoost. If you use CSV files for input, you need to download them locally."
]
},
{
@@ -1144,87 +1167,42 @@
"id": "cleanup:mbsdk"
},
"source": [
"# Cleaning up\n",
"# Clean up\n",
"\n",
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"- Vertex AI Dataset resource\n",
"- Cloud Storage Bucket\n",
"- BigQuery Dataset\n",
"\n",
"Set `delete_storage` to _True_ to delete the storage resources used in this notebook."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cleanup:mbsdk"
"id": "47ad926d84e8"
},
"outputs": [],
"source": [
"delete_all = True\n",
"import os\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Delete the dataset using the Vertex dataset object\n",
"dataset.delete()\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Delete the temporary BigQuery dataset\n",
"! bq rm -r -f $PROJECT_ID:$DATASET_ID\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"delete_storage = False\n",
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
" # Delete the created GCS bucket\n",
" ! gsutil rm -r $BUCKET_URI\n",
" # Delete the created BigQuery datasets\n",
" ! bq rm -r -f $PROJECT_ID:$BQ_MY_DATASET"
]
}
],
@@ -39,8 +39,14 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -139,7 +145,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages to execute this notebook."
]
},
{
@@ -150,20 +156,26 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install -U tensorflow==2.5 $USER_FLAG -q\n",
"! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG -q\n",
"! pip3 install -U tensorflow-transform==1.2 $USER_FLAG -q\n",
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
"! pip3 install --upgrade apache-beam[gcp] $USER_FLAG -q"
]
},
{
@@ -195,6 +207,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "84cd83853240"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -271,7 +309,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -298,6 +339,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77c385f0db59"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "535223fa4b84"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -326,7 +428,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -337,8 +440,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -358,7 +462,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -378,7 +482,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -401,7 +505,7 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
"import google.cloud.aiplatform as aiplatform"
]
},
{
@@ -555,7 +659,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, location=REGION)"
"aiplatform.init(project=PROJECT_ID, location=REGION)"
]
},
{
@@ -676,6 +780,31 @@
"dataframe[\"station_number\"] = pd.to_numeric(dataframe[\"station_number\"])"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bqml_create_dataset"
},
"source": [
"### Create BQ dataset resource\n",
"\n",
"First, you create an empty dataset resource in your project."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bqml_create_dataset"
},
"outputs": [],
"source": [
"BQ_MY_DATASET = 'samples'\n",
"BQ_MY_TABLE = 'gsod'\n",
"! bq --location=US mk -d \\\n",
"$PROJECT_ID:$BQ_MY_DATASET"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -979,7 +1108,7 @@
},
"outputs": [],
"source": [
"SCHEMA_LOCATION = BUCKET_NAME + \"/schema.txt\"\n",
"SCHEMA_LOCATION = BUCKET_URI + \"/schema.txt\"\n",
"\n",
"# When running Apache Beam directly (file is directly accessed)\n",
"tfdv.write_schema_text(output_path=SCHEMA_LOCATION, schema=schema)\n",
@@ -1124,7 +1253,7 @@
" )\n",
"\n",
"\n",
"EXPORTED_DATA_PREFIX = os.path.join(BUCKET_NAME, \"exported_data\")\n",
"EXPORTED_DATA_PREFIX = os.path.join(BUCKET_URI, \"exported_data\")\n",
"\n",
"QUERY_STRING = \"SELECT {},{} FROM {} LIMIT 500\".format(\n",
" \"CAST(station_number as STRING) AS station_number,year,month,day\",\n",
@@ -1137,7 +1266,7 @@
" \"runner\": RUNNER,\n",
" \"raw_data_query\": QUERY_STRING,\n",
" \"exported_data_prefix\": EXPORTED_DATA_PREFIX,\n",
" \"temp_location\": os.path.join(BUCKET_NAME, \"temp\"),\n",
" \"temp_location\": os.path.join(BUCKET_URI, \"temp\"),\n",
" \"project\": PROJECT_ID,\n",
" \"region\": REGION,\n",
" \"setup_file\": \"./setup.py\",\n",
@@ -1162,17 +1291,7 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"Otherwise, you can delete the individual resources you created in this tutorial."
]
},
{
@@ -1183,61 +1302,11 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"delete_storage = True\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
" if \"BUCKET_URI\" in globals():\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -34,15 +34,21 @@
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_vertex_datasets.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_vertex_datasets.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
"<img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/get_started_vertex_datasets.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td> \n",
"</table>\n",
"<br/><br/><br/>"
]
@@ -130,7 +136,17 @@
" - Create a tf.data.Dataset generator from the CSV index file.\n",
" - If text strings are in text files:\n",
" - Using the JSON index file, convert the text files and labels to TFRecords.\n",
" - Create a tf.data.Dataset from the TFRecords."
" - Create a tf.data.Dataset from the TFRecords.\n",
"\n",
" \n",
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Cloud Storage\n",
"- BigQuery\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
@@ -141,7 +157,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the packages required for executing this notebook."
]
},
{
@@ -152,20 +168,27 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install -U tensorflow $USER_FLAG -q\n",
"! pip3 install -U tensorflow-data-validation $USER_FLAG -q\n",
"! pip3 install -U tensorflow-transform $USER_FLAG -q\n",
"! pip3 install -U tensorflow-io $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q\n",
"! pip3 install --upgrade future $USER_FLAG -q"
]
},
{
@@ -197,6 +220,30 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cb082379ed5b"
},
"source": [
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com). \n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -216,7 +263,24 @@
},
"outputs": [],
"source": [
"PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" # Get your Google Cloud project ID from gcloud\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "37c0a68ff20d"
},
"source": [
"Otherwise, set your project ID here."
]
},
{
@@ -227,18 +291,15 @@
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None or PROJECT_ID == \"[your-project-id]\":\n",
" # Get your GCP project id from gcloud\n",
" shell_output = ! gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID:\", PROJECT_ID)"
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "set_gcloud_project_id"
"id": "c021ca495967"
},
"outputs": [],
"source": [
@@ -273,7 +334,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -300,6 +364,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "927085b84a07"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"**Click Create service account**.\n",
"\n",
"In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex\" into the filter box, and select **Vertex Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "89788a802687"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -328,7 +453,7 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_URI = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
]
},
{
@@ -339,8 +464,8 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_URI = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
]
},
{
@@ -360,7 +485,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -380,7 +505,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -392,7 +517,11 @@
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
"### Import libraries and define constants\n",
"\n",
"Import the BigQuery package, TensorFlow Data Validation (TFDV) package and TensorFlow Data Validation package into your Python environment. \n",
"\n",
"Import TensorFlow Transform (TFT) package and pandas into your Python environment."
]
},
{
@@ -403,97 +532,13 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_bq"
},
"source": [
"#### Import BigQuery\n",
"\n",
"Import the BigQuery package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_bq"
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip\n",
"import pandas as pd\n",
"import tensorflow_data_validation as tfdv\n",
"import tensorflow_transform as tft\n",
"from google.cloud import bigquery"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_tfdv"
},
"source": [
"#### Import TensorFlow Data Validation\n",
"\n",
"Import the TensorFlow Data Validation (TFDV) package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_tfdv"
},
"outputs": [],
"source": [
"import tensorflow_data_validation as tfdv"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_tft"
},
"source": [
"#### Import TensorFlow Transform\n",
"\n",
"Import the TensorFlow Transform (TFT) package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_tft"
},
"outputs": [],
"source": [
"import tensorflow_transform as tft"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_pandas"
},
"source": [
"#### Import pandas\n",
"\n",
"Import the pandas package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_pandas"
},
"outputs": [],
"source": [
"import pandas as pd"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -1149,9 +1194,9 @@
"comps = BQ_TABLE.split(\".\")\n",
"BQ_PROJECT_DATASET_TABLE = comps[0] + \":\" + comps[1] + \".\" + comps[2]\n",
"\n",
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_NAME/mydata*.csv\n",
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_URI/mydata*.csv\n",
"\n",
"IMPORT_FILES = ! gsutil ls $BUCKET_NAME/mydata*.csv\n",
"IMPORT_FILES = ! gsutil ls $BUCKET_URI/mydata*.csv\n",
"\n",
"print(IMPORT_FILES)\n",
"\n",
@@ -1209,6 +1254,38 @@
"To create a dataframe from multiple CSV sources, you read each CSV file and concatenate the dataframes together."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bcd2e4e0703b"
},
"source": [
"If you are running this notebook on Colab, run the following cell to install packages fsspec and gcsfs."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "927bd3f92268"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Google Cloud Notebook, then don't execute this code\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\"):\n",
" if \"google.colab\" in sys.modules:\n",
" ! pip3 install fsspec\n",
" ! pip3 install gcsfs"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -1269,7 +1346,7 @@
},
"outputs": [],
"source": [
"EXPORTED_DIR = f\"{BUCKET_NAME}/exported\"\n",
"EXPORTED_DIR = f\"{BUCKET_URI}/exported\"\n",
"exported_files = dataset.export_data(output_dir=EXPORTED_DIR)\n",
"\n",
"! gsutil ls $EXPORTED_DIR"
@@ -1498,7 +1575,7 @@
" data = f.readlines()\n",
"\n",
"# The path to the TFRecord cached file.\n",
"GCS_TFRECORD_URI = BUCKET_NAME + \"/flowers.tfrecord\"\n",
"GCS_TFRECORD_URI = BUCKET_URI + \"/flowers.tfrecord\"\n",
"\n",
"# Create the TFRecord cached file\n",
"with tf.io.TFRecordWriter(GCS_TFRECORD_URI) as writer:\n",
@@ -1532,14 +1609,7 @@
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"- Bucket"
]
},
{
@@ -1550,61 +1620,12 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"# Delete the dataset using the Vertex dataset object\n",
"dataset.delete()\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"# Delete the bucket\n",
"if os.getenv(\"IS_TESTING\"):\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
File diff suppressed because it is too large Load Diff
@@ -39,8 +39,14 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/mlops_data_management.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/mlops_data_management.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/mlops_data_management.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -133,7 +139,20 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"ONCE_ONLY = True\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
@@ -178,6 +197,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "84cd83853240"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -254,7 +299,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -281,6 +329,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77c385f0db59"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "535223fa4b84"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -309,7 +418,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -320,8 +430,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -341,7 +452,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -361,7 +472,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -516,7 +627,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -757,7 +868,7 @@
"dataset = aip.TabularDataset.create(\n",
" display_name=\"Chicago Taxi\" + \"_\" + TIMESTAMP,\n",
" bq_source=[IMPORT_FILE],\n",
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
" labels={\"user_metadata\": BUCKET_NAME},\n",
")\n",
"\n",
"label_column = \"tip_bin\"\n",
@@ -949,9 +1060,9 @@
},
"outputs": [],
"source": [
"STATISTICS_SCHEMA = BUCKET_NAME + \"/statistics.jsonl\"\n",
"STATISTICS_SCHEMA = BUCKET_URI + \"/statistics.jsonl\"\n",
"\n",
"tfdv.write_stats_text(stats, BUCKET_NAME + \"/statistics.jsonl\")\n",
"tfdv.write_stats_text(stats, BUCKET_URI + \"/statistics.jsonl\")\n",
"\n",
"with tf.io.gfile.GFile(\n",
" \"gs://\" + dataset.labels[\"user_metadata\"] + \"/metadata.jsonl\", \"r\"\n",
@@ -964,7 +1075,7 @@
") as f:\n",
" json.dump(metadata, f)\n",
"\n",
"!gsutil cat $BUCKET_NAME/metadata.jsonl"
"! gsutil cat $BUCKET_URI/metadata.jsonl"
]
},
{
@@ -1011,7 +1122,7 @@
},
"outputs": [],
"source": [
"SCHEMA_LOCATION = BUCKET_NAME + \"/schema.txt\"\n",
"SCHEMA_LOCATION = BUCKET_URI + \"/schema.txt\"\n",
"\n",
"# When running Apache Beam directly (file is directly accessed)\n",
"tfdv.write_schema_text(output_path=SCHEMA_LOCATION, schema=schema)\n",
@@ -1049,7 +1160,7 @@
") as f:\n",
" json.dump(metadata, f)\n",
"\n",
"!gsutil cat $BUCKET_NAME/metadata.jsonl"
"! gsutil cat $BUCKET_URI/metadata.jsonl"
]
},
{
@@ -1372,10 +1483,10 @@
" )\n",
"\n",
"\n",
"EXPORTED_JSONL_PREFIX = os.path.join(BUCKET_NAME, \"exported_data/jsonl\")\n",
"EXPORTED_TFREC_PREFIX = os.path.join(BUCKET_NAME, \"exported_data/tfrec\")\n",
"TRANSFORMED_DATA_PREFIX = os.path.join(BUCKET_NAME, \"transformed_data\")\n",
"TRANSFORM_ARTIFACTS_DIR = os.path.join(BUCKET_NAME, \"transformed_artifacts\")\n",
"EXPORTED_JSONL_PREFIX = os.path.join(BUCKET_URI, \"exported_data/jsonl\")\n",
"EXPORTED_TFREC_PREFIX = os.path.join(BUCKET_URI, \"exported_data/tfrec\")\n",
"TRANSFORMED_DATA_PREFIX = os.path.join(BUCKET_URI, \"transformed_data\")\n",
"TRANSFORM_ARTIFACTS_DIR = os.path.join(BUCKET_URI, \"transformed_artifacts\")\n",
"\n",
"QUERY_STRING = \"SELECT * FROM {} LIMIT 300000\".format(BQ_TABLE)\n",
"JOB_NAME = \"chicago\" + TIMESTAMP\n",
@@ -1388,7 +1499,7 @@
" \"transform_artifact_dir\": TRANSFORM_ARTIFACTS_DIR,\n",
" \"exported_jsonl_prefix\": EXPORTED_JSONL_PREFIX,\n",
" \"exported_tfrec_prefix\": EXPORTED_TFREC_PREFIX,\n",
" \"temp_location\": os.path.join(BUCKET_NAME, \"temp\"),\n",
" \"temp_location\": os.path.join(BUCKET_URI, \"temp\"),\n",
" \"project\": PROJECT_ID,\n",
" \"region\": REGION,\n",
" \"setup_file\": \"./setup.py\",\n",
@@ -1459,7 +1570,7 @@
") as f:\n",
" json.dump(metadata, f)\n",
"\n",
"!gsutil cat $BUCKET_NAME/metadata.jsonl"
"! gsutil cat $BUCKET_URI/metadata.jsonl"
]
},
{
@@ -1473,17 +1584,9 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"Otherwise, you can delete the individual resources you created in this tutorial.\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"*Note:* stage2/mlops_experimentation is dependent on the resources created by this stage1 notebook."
]
},
{
@@ -1504,8 +1607,8 @@
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
" if \"BUCKET_URI\" in globals():\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
+221 -2
View File
@@ -33,18 +33,237 @@ The second stage in MLOps is experimenting in developing one or more baseline mo
[Get Started with Vertex Experiments and Vertex ML Metadata](get_started_vertex_experiments.ipynb)
```
The steps performed include:
- Use Python logging to log training configuration/results locally.
- Use Google Cloud Logging to log training configuration/results in cloud storage.
- Create a Vertex AI `Experiment` resource.
- Instantiate an experiment run.
- Log parameters for the run.
- Log metrics for the run.
- Display the logged experiment run.
```
[Get Started with Vertex TensorBoard](get_started_vertex_tensorboard.ipynb)
[Get Started with Custom Training Packages](get_started_vertex_training.ipynb)
```
The steps performed include:
- Create a TensorBoard callback when training a model.
- Using Tensorboard with locally trained model.
- Using Vertex AI TensorBoard with Vertex AI Training.
```
[Get Started with Custom Training Packages (Tensorflow)](get_started_vertex_training.ipynb)
```
The steps performed include:
- Training using a single Python script.
- Training using a Python package.
- Training using a custom training image.
- Laying out a training package.
```
[Get Started with Custom Training Packages (Scikit-Learn)](get_started_vertex_training_sklearn.ipynb)
```
The steps performed include:
- Training using a Python package.
- Report accuracy when hyperparameter tuning.
- Save the model artifacts to Cloud Storage using GCSFuse.
- Create a `Vertex AI Model` resource.
```
[Get Started with Custom Training Packages (XGBoost)](get_started_vertex_training_xgboost.ipynb)
```
The steps performed include:
- Training using a Python package.
- Report accuracy when hyperparameter tuning.
- Save the model artifacts to Cloud Storage using GCSFuse.
- Create a `Vertex AI Model` resource.
```
[Get Started with Custom Training Packages (Pytorch)](get_started_vertex_training_pytorch.ipynb)
```
The steps performed include:
- Single node training using a Python package.
- Report accuracy when hyperparameter tuning.
- Save the model artifacts to Cloud Storage using GCSFuse.
- Create a `Vertex AI Model` resource.
```
[Get Started with Custom Training Packages (R)](get_started_vertex_training_r.ipynb)
```
The steps performed include:
- Locally train an R model in a notebook using %%R magic commands
- Create a deployment image with trained R model and serving functions.
- Test the deployment image locally.
- Create a `Vertex AI Model` resource for the deployment image with embedded R model.
- Deploy the deployment image with embedded R model to a `Vertex AI Endpoint` resource.
- Test the deployment image with embedded R model.
- Create a R-to-Python training package.
- Create a training image for training the model.
- Train a R model using `Vertex AI Trainingh` service with the R-to-Python training package.
```
[Get Started with Distributed Training](get_started_vertex_distributed_training.ipynb)
```
The steps performed include:
- `MirroredStrategy`: Train on a single VM with multiple GPUs.
- `MultiWorkerMirroredStrategy`: Train on multiple VMs with automatic setup of replicas.
- `MultiWorkerMirroredStrategy`: Train on multiple VMs with fine grain control of replicas.
- `ReductionServer`: Train on multiple VMS and sync updates across VMS with `Vertex AI Reduction Server`.
- `TPUTraining`: Train with multiple Cloud TPUs.
```
[Get Started with Vizier Hyperparameter Tuning](get_started_vertex_vizier.ipynb)
```
The steps performed include:
- Hyperparameter tuning with Random algorithm.
- Hyperparameter tuning with Vizier (Bayesian) algorithm.
```
[Get Started with AutoML Training](get_started_automl_training.ipynb)
[Get Started with BQML Training](get_started_bqml_training.ipyn)
```
The steps performed include:
- Train an image model.
- Export the image model as an edge model.
- Train a tabular model.
- Export the tabular model as a cloud model.
- Train a text model.
```
[Get Started with BQML Training](get_started_bqml_training.ipynb)
```
The steps performed include:
- Create a local BigQuery table in your project
- Train a BQML model
- Evaluate the BQML model
- Export the BQML model as a cloud model
- Upload the exported model as a `Vertex AI Model` resource
- Hyperparameter tune a BQML model with `Vertex AI Vizier`
- Automatically register a BQML model to `Vertex AI Model Registry`
```
[Get Started with Vertex Feature Store](get_started_vertex_feature_store.ipynb)
```
The steps performed include:
- Creating a Vertex AI `Featurestore` resource.
- Creating `EntityType` resources for the `Featurestore` resource.
- Creating `Feature` resources for each `EntityType` resource.
- Import feature values (entity data items) into `Featurestore` resource from Cloud Storage.
- Import feature values (entity data items) into `Featurestore` resource from pandas DataFrame.
- Perform online serving from a `Featurestore` resource.
- Perform batch serving from a `Featurestore` resource.
```
[Get Started with Google CMEK Training](get_started_with_cmek_training.ipynb)
```
The steps performed include:
- Creating a customer managed encryption key.
- Creating an image dataset with CMEK encryption.
- Train an AutoML model with CMEK encryption.
```
[Get Started with TensorFlow Hub models](get_started_with_tfhub_models.ipynb)
```
The steps performed include:
- Download a TensorFlow Hub prebuilt model.
- Add the task component as a classifier for the CIFAR-10 dataset.
- Fine tune locally the model with transfer learning training.
- Construct a custom training script:
- Get training data from TensorFlow Datasets
- Get model architecture from TensorFlow Hub
- Train then model
- Save model artifacts and upload as Vertex AI Model resource.
```
[Get Started with Vertex AI TabNet builtin algorithm](get_started_with_tabnet.ipynb)
```
The steps performed include:
- Get the training data.
- Configure training parameters for the Vertex AI TabNet container.
- Train the model using Vertex AI Training using CSV data.
- Upload the model as a Vertex AI Model resource.
- Deploy the Vertex AI Model resource to a Vertex AI Endpoint resource.
- Make a prediction with the deployed model.
- Hyperparameter tuning the Vertex AI TabNet model.
- Train the model using Vertex AI Training using BigQuery table.
```
[Get Started with Vertex AI TabNet builtin algorithm](get_started_with_tabnet.ipynb)
```
The steps performed include:
- Get the training data.
- Configure training parameters for the Vertex AI TabNet container.
- Train the model using Vertex AI Training using CSV data.
- Upload the model as a Vertex AI Model resource.
- Deploy the Vertex AI Model resource to a Vertex AI Endpoint resource.
- Make a prediction with the deployed model.
- Hyperparameter tuning the Vertex AI TabNet model.
- Train the model using Vertex AI Training using BigQuery table.
```
[Get Started with Vision API and AutoML](get_started_with_visionapi_and_automl.ipynb)
```
The steps performed include:
- Preprocess training files using `Vision AI` APIs to extract the text from PDF files.
- Create a custom import file that includes annotation data based on the sample `BigQuery` dataset.
- Create a `Vertex AI Dataset` resource.
- Train the model.
- View the model evaluation.
- Deploy the `Vertex AI Model` resource to a serving `Endpoint` resource.
- Make a prediction.
- Undeploy the `Model`.
```
### E2E Stage Example
[Stage 2: Experimentation](mlops_experimentation.ipynb)
```
The steps performed include:
- Review the `Dataset` resource created during stage 1.
- Train an AutoML tabular binary classifier model in the background.
- Build the experimental model architecture.
- Construct a custom training package for the `Dataset` resource.
- Test the custom training package locally.
- Test the custom training package in the cloud with Vertex AI Training.
- Hyperparameter tune the model training with Vertex AI Vizier.
- Train the custom model with Vertex AI Training.
- Add a serving function for online/batch prediction to the custom model.
- Test the custom model with the serving function.
- Evaluate the custom model using Vertex AI Batch Prediction
- Wait for the AutoML training job to complete.
- Evaluate the AutoML model using Vertex AI Batch Prediction with the same evaluation slices as the custom model.
- Set the evaluation results of the AutoML model as the baseline.
- If the evaluation of the custom model is below baseline, continue to experiment with the custom model.
- If the evaluation of the custom model is above baseline, save the model as the first best model.
```
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -39,8 +39,14 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_automl_training.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_automl_training.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage2/get_started_automl_training.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -65,9 +71,11 @@
"id": "dataset:flowers,icn"
},
"source": [
"### Dataset\n",
"### Datasets\n",
"\n",
"The dataset used for this tutorial is the [Flowers dataset](https://www.tensorflow.org/datasets/catalog/tf_flowers) from [TensorFlow Datasets](https://www.tensorflow.org/datasets/catalog/overview). The version of the dataset you will use in this tutorial is stored in a public Cloud Storage bucket. The trained model predicts the type of flower an image is from a class of five flowers: daisy, dandelion, rose, sunflower, or tulip."
"#### Image\n",
"\n",
"The image dataset used for this tutorial is the [Flowers dataset](https://www.tensorflow.org/datasets/catalog/tf_flowers) from [TensorFlow Datasets](https://www.tensorflow.org/datasets/catalog/overview). The version of the dataset you will use in this tutorial is stored in a public Cloud Storage bucket. The trained model predicts the type of flower in a given image from a class of five flowers: daisy, dandelion, rose, sunflower, or tulip."
]
},
{
@@ -76,9 +84,9 @@
"id": "dataset:gsod,lrg"
},
"source": [
"### Dataset\n",
"#### Tabular\n",
"\n",
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
"The tabular dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
]
},
{
@@ -87,9 +95,20 @@
"id": "dataset:happydb,tcn"
},
"source": [
"### Dataset\n",
"#### Text\n",
"\n",
"The dataset used for this tutorial is the [Happy Moments dataset](https://www.kaggle.com/ritresearch/happydb) from [Kaggle Datasets](https://www.kaggle.com/ritresearch/happydb). The version of the dataset you will use in this tutorial is stored in a public Cloud Storage bucket."
"The text dataset used for this tutorial is the [Happy Moments dataset](https://www.kaggle.com/ritresearch/happydb) from [Kaggle Datasets](https://www.kaggle.com/ritresearch/happydb). The version of the dataset you will use in this tutorial is stored in a public Cloud Storage bucket."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "98eb93ec6faa"
},
"source": [
"#### Video\n",
"\n",
"The video dataset used for this tutorial is the golf swing recognition portion of the [Human Motion dataset](https://todo) from [MIT](http://cbcl.mit.edu/publications/ps/Kuehne_etal_iccv11.pdf). The version of the dataset you will use in this tutorial is stored in a public Cloud Storage bucket. The trained model will predict the start frame where a golf swing begins."
]
},
{
@@ -108,11 +127,12 @@
"\n",
"The steps performed include:\n",
"\n",
"- Train an image model.\n",
"- Export the image model as an edge model.\n",
"- Train a tabular model.\n",
"- Export the tabular model as a cloud model.\n",
"- Train a text model."
"- Train an image model\n",
"- Export the image model as an edge model\n",
"- Train a tabular model\n",
"- Export the tabular model as a cloud model\n",
"- Train a text model\n",
"- Train a video model"
]
},
{
@@ -125,9 +145,24 @@
"\n",
"When doing E2E MLOps on Google Cloud, the following are best practices for when to use AutoML:\n",
"\n",
"**You have a limited amount of training data**\n",
"* **You have a limited amount of training data**\n",
"\n",
"**You want to establish a baseline metric before experimenting with a custom model**"
"* **You want to establish a baseline metric before experimenting with a custom model**"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fb3451ce8e47"
},
"source": [
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Cloud Storage\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing) and [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
@@ -138,7 +173,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the packages required for executing this notebook."
]
},
{
@@ -149,20 +184,23 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"# Install the packages\n",
"\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-storage $USER_FLAG -q"
]
},
{
@@ -200,6 +238,23 @@
"id": "project_id"
},
"source": [
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands.\n",
"\n",
"#### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
@@ -270,7 +325,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -297,6 +355,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3ffa6b6c7cdb"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2b72272258fc"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -320,7 +439,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -331,8 +451,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -352,7 +473,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -372,7 +493,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -395,7 +516,7 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
"import google.cloud.aiplatform as aiplatform"
]
},
{
@@ -417,7 +538,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -448,7 +569,7 @@
"source": [
"## AutoML image models\n",
"\n",
"AutoML can train the following types of models:\n",
"AutoML can train the following types of image models:\n",
"\n",
"- classification\n",
"- objection detection\n",
@@ -504,10 +625,7 @@
},
"outputs": [],
"source": [
"if \"IMPORT_FILES\" in globals():\n",
" FILE = IMPORT_FILES[0]\n",
"else:\n",
" FILE = IMPORT_FILE\n",
"FILE = IMPORT_FILE\n",
"\n",
"count = ! gsutil cat $FILE | wc -l\n",
"print(\"Number of Examples\", int(count[0]))\n",
@@ -545,10 +663,10 @@
},
"outputs": [],
"source": [
"dataset = aip.ImageDataset.create(\n",
" display_name=\"Happy Moments\" + \"_\" + TIMESTAMP,\n",
"dataset = aiplatform.ImageDataset.create(\n",
" display_name=\"flowers_\" + TIMESTAMP,\n",
" gcs_source=[IMPORT_FILE],\n",
" import_schema_uri=aip.schema.dataset.ioformat.image.single_label_classification,\n",
" import_schema_uri=aiplatform.schema.dataset.ioformat.image.single_label_classification,\n",
")\n",
"\n",
"print(dataset.resource_name)"
@@ -593,8 +711,8 @@
},
"outputs": [],
"source": [
"dag = aip.AutoMLImageTrainingJob(\n",
" display_name=\"happydb_\" + TIMESTAMP,\n",
"dag = aiplatform.AutoMLImageTrainingJob(\n",
" display_name=\"flowers_\" + TIMESTAMP,\n",
" prediction_type=\"classification\",\n",
" multi_label=False,\n",
" model_type=\"MOBILE_TF_LOW_LATENCY_1\",\n",
@@ -612,14 +730,14 @@
"source": [
"#### Run the training pipeline\n",
"\n",
"Next, you run the DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"Next, you run the created DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"\n",
"- `dataset`: The `Dataset` resource to train the model.\n",
"- `model_display_name`: The human readable name for the trained model.\n",
"- `training_fraction_split`: The percentage of the dataset to use for training.\n",
"- `test_fraction_split`: The percentage of the dataset to use for test (holdout data).\n",
"- `validation_fraction_split`: The percentage of the dataset to use for validation.\n",
"- `budget_milli_node_hours`: (optional) Maximum training time specified in unit of millihours (1000 = hour).\n",
"- `budget_milli_node_hours`: (optional) Maximum training time specified in unit of milli node-hours (1000 = node-hour).\n",
"- `disable_early_stopping`: If `True`, training maybe completed before using the entire budget if the service believes it cannot further improve on the model objective measurements.\n",
"\n",
"The `run` method when completed returns the `Model` resource.\n",
@@ -637,7 +755,7 @@
"source": [
"model = dag.run(\n",
" dataset=dataset,\n",
" model_display_name=\"happydb_\" + TIMESTAMP,\n",
" model_display_name=\"flowers_\" + TIMESTAMP,\n",
" training_fraction_split=0.8,\n",
" validation_fraction_split=0.1,\n",
" test_fraction_split=0.1,\n",
@@ -653,9 +771,8 @@
},
"source": [
"## Review model evaluation scores\n",
"After your model has finished training, you can review the evaluation scores for it.\n",
"\n",
"First, you need to get a reference to the new model. As with datasets, you can either use the reference to the model variable you created when you deployed the model or you can list all of the models in your project."
"After your model training has finished, you can review the evaluation scores for it using the `list_model_evaluations()` method. This method will return an iterator for each evaluation slice."
]
},
{
@@ -666,18 +783,10 @@
},
"outputs": [],
"source": [
"# Get model resource ID\n",
"models = aip.Model.list(filter=\"display_name=happydb_\" + TIMESTAMP)\n",
"model_evaluations = model.list_model_evaluations()\n",
"\n",
"# Get a reference to the Model Service client\n",
"client_options = {\"api_endpoint\": f\"{REGION}-aiplatform.googleapis.com\"}\n",
"model_service_client = aip.gapic.ModelServiceClient(client_options=client_options)\n",
"\n",
"model_evaluations = model_service_client.list_model_evaluations(\n",
" parent=models[0].resource_name\n",
")\n",
"model_evaluation = list(model_evaluations)[0]\n",
"print(model_evaluation)"
"for model_evaluation in model_evaluations:\n",
" print(model_evaluation.to_dict())"
]
},
{
@@ -721,7 +830,7 @@
"source": [
"### Get test item\n",
"\n",
"You will use an arbitrary example out of the dataset as a test item. Don't be concerned that the example was likely used in training the model -- we just want to demonstrate how to make a prediction."
"You will use an arbitrary example out of the dataset as a test item. Don't be concerned that the example was likely used in training the model. You are just looking at how to make a prediction."
]
},
{
@@ -753,7 +862,7 @@
"\n",
"#### Request\n",
"\n",
"Since in this example your test item is in a Cloud Storage bucket, you open and read the contents of the image using `tf.io.gfile.Gfile()`. To pass the test data to the prediction service, you encode the bytes into base64 -- which makes the content safe from modification while transmitting binary data over the network.\n",
"Since your test item is in a public Cloud Storage bucket in this example, you copy it to your bucket and read the contents of the image using `Cloud Storage SDK`. To pass the test data to the prediction service, you encode the bytes into base64 which makes the content safe from modification while transmitting binary data over the network.\n",
"\n",
"The format of each instance is:\n",
"\n",
@@ -775,32 +884,66 @@
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "predict_request:mbsdk,icn"
"id": "1c1d53e89beb"
},
"outputs": [],
"source": [
"import base64\n",
"\n",
"import tensorflow as tf\n",
"from google.cloud import storage\n",
"\n",
"with tf.io.gfile.GFile(test_item, \"rb\") as f:\n",
" content = f.read()\n",
"# Copy the test image to the Cloud storage bucket as \"test.jpg\"\n",
"test_image_local = \"{}/test.jpg\".format(BUCKET_URI)\n",
"! gsutil cp $test_item $test_image_local\n",
"\n",
"# Download the test image in bytes format\n",
"storage_client = storage.Client(project=PROJECT_ID)\n",
"bucket = storage_client.bucket(bucket_name=BUCKET_NAME)\n",
"test_content = bucket.get_blob(\"test.jpg\").download_as_bytes()\n",
"\n",
"# The format of each instance should conform to the deployed model's prediction input schema.\n",
"instances = [{\"content\": base64.b64encode(content).decode(\"utf-8\")}]\n",
"instances = [{\"content\": base64.b64encode(test_content).decode(\"utf-8\")}]\n",
"\n",
"prediction = endpoint.predict(instances=instances)\n",
"\n",
"print(prediction)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3b1b67898533"
},
"source": [
"#### Alternate method using [GFile](https://www.tensorflow.org/api_docs/python/tf/io/gfile/GFile)\n",
"\n",
"Alternatively, [GFile](https://www.tensorflow.org/api_docs/python/tf/io/gfile/GFile) method from tensorflow-io library can be used to read the data from Cloud storage directly. The following code snippet does the same :\n",
"\n",
"```\n",
"import base64\n",
"import tensorflow as tf\n",
"\n",
"# Read the test file using GFile\n",
"with tf.io.gfile.GFile(test_item, \"rb\") as f:\n",
" content = f.read()\n",
"\n",
"# The format of each instance should conform to the deployed model's prediction input schema.\n",
"instances = [{\"content\": base64.b64encode(content).decode(\"utf-8\")}]\n",
"\n",
"prediction = endpoint.predict(instances=instances)\n",
"\n",
"print(prediction)\n",
"```\n",
"Nevertheless, `tf.io.gfile.GFile` supports multiple file system implementations, including local files, Google Cloud Storage (using a gs:// prefix), and HDFS (using an hdfs:// prefix)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "undeploy_model:mbsdk"
},
"source": [
"## Undeploy the model\n",
"#### Undeploy the model\n",
"\n",
"When you are done doing predictions, you undeploy the model from the `Endpoint` resouce. This deprovisions all compute resources and ends billing for the deployed model."
]
@@ -846,7 +989,7 @@
"outputs": [],
"source": [
"response = model.export_model(\n",
" artifact_destination=BUCKET_NAME, export_format_id=\"tflite\", sync=True\n",
" artifact_destination=BUCKET_URI, export_format_id=\"tflite\", sync=True\n",
")\n",
"\n",
"model_package = response[\"artifactOutputUri\"]"
@@ -987,10 +1130,10 @@
},
"outputs": [],
"source": [
"dataset = aip.TabularDataset.create(\n",
" display_name=\"Happy Moments\" + \"_\" + TIMESTAMP,\n",
"dataset = aiplatform.TabularDataset.create(\n",
" display_name=\"gsod_\" + TIMESTAMP,\n",
" bq_source=[IMPORT_FILE],\n",
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
" labels={\"user_metadata\": BUCKET_NAME},\n",
")\n",
"\n",
"label_column = \"mean_temp\"\n",
@@ -1046,9 +1189,7 @@
" - regression:\n",
" - `minimize-rmse`\n",
" - `minimize-mae`\n",
" - `minimize-rmsle`\n",
"\n",
"The instantiated object is the DAG (directed acyclic graph) for the training pipeline."
" - `minimize-rmsle`"
]
},
{
@@ -1059,8 +1200,8 @@
},
"outputs": [],
"source": [
"dag = aip.AutoMLTabularTrainingJob(\n",
" display_name=\"happydb_\" + TIMESTAMP,\n",
"dag = aiplatform.AutoMLTabularTrainingJob(\n",
" display_name=\"gsod_\" + TIMESTAMP,\n",
" optimization_prediction_type=\"regression\",\n",
" optimization_objective=\"minimize-rmse\",\n",
" column_transformations=TRANSFORMATIONS,\n",
@@ -1077,7 +1218,7 @@
"source": [
"#### Run the training pipeline\n",
"\n",
"Next, you run the DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"Next, you run the created DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"\n",
"- `dataset`: The `Dataset` resource to train the model.\n",
"- `model_display_name`: The human readable name for the trained model.\n",
@@ -1103,7 +1244,7 @@
"source": [
"model = dag.run(\n",
" dataset=dataset,\n",
" model_display_name=\"happydb_\" + TIMESTAMP,\n",
" model_display_name=\"gsod_\" + TIMESTAMP,\n",
" training_fraction_split=0.8,\n",
" validation_fraction_split=0.1,\n",
" test_fraction_split=0.1,\n",
@@ -1120,9 +1261,8 @@
},
"source": [
"## Review model evaluation scores\n",
"After your model has finished training, you can review the evaluation scores for it.\n",
"\n",
"First, you need to get a reference to the new model. As with datasets, you can either use the reference to the model variable you created when you deployed the model or you can list all of the models in your project."
"After your model training has finished, you can review the evaluation scores for it using the `list_model_evaluations()` method. This method will return an iterator for each evaluation slice."
]
},
{
@@ -1133,18 +1273,10 @@
},
"outputs": [],
"source": [
"# Get model resource ID\n",
"models = aip.Model.list(filter=\"display_name=happydb_\" + TIMESTAMP)\n",
"model_evaluations = model.list_model_evaluations()\n",
"\n",
"# Get a reference to the Model Service client\n",
"client_options = {\"api_endpoint\": f\"{REGION}-aiplatform.googleapis.com\"}\n",
"model_service_client = aip.gapic.ModelServiceClient(client_options=client_options)\n",
"\n",
"model_evaluations = model_service_client.list_model_evaluations(\n",
" parent=models[0].resource_name\n",
")\n",
"model_evaluation = list(model_evaluations)[0]\n",
"print(model_evaluation)"
"for model_evaluation in model_evaluations:\n",
" print(model_evaluation.to_dict())"
]
},
{
@@ -1177,7 +1309,7 @@
"id": "undeploy_model:mbsdk"
},
"source": [
"## Undeploy the model\n",
"#### Undeploy the model\n",
"\n",
"When you are done doing predictions, you undeploy the model from the `Endpoint` resouce. This deprovisions all compute resources and ends billing for the deployed model."
]
@@ -1218,7 +1350,7 @@
"outputs": [],
"source": [
"response = model.export_model(\n",
" artifact_destination=BUCKET_NAME, export_format_id=\"tf-saved-model\", sync=True\n",
" artifact_destination=BUCKET_URI, export_format_id=\"tf-saved-model\", sync=True\n",
")\n",
"\n",
"model_package = response[\"artifactOutputUri\"]"
@@ -1350,10 +1482,7 @@
},
"outputs": [],
"source": [
"if \"IMPORT_FILES\" in globals():\n",
" FILE = IMPORT_FILES[0]\n",
"else:\n",
" FILE = IMPORT_FILE\n",
"FILE = IMPORT_FILE\n",
"\n",
"count = ! gsutil cat $FILE | wc -l\n",
"print(\"Number of Examples\", int(count[0]))\n",
@@ -1391,10 +1520,10 @@
},
"outputs": [],
"source": [
"dataset = aip.TextDataset.create(\n",
" display_name=\"Happy Moments\" + \"_\" + TIMESTAMP,\n",
"dataset = aiplatform.TextDataset.create(\n",
" display_name=\"happydb_\" + TIMESTAMP,\n",
" gcs_source=[IMPORT_FILE],\n",
" import_schema_uri=aip.schema.dataset.ioformat.text.single_label_classification,\n",
" import_schema_uri=aiplatform.schema.dataset.ioformat.text.single_label_classification,\n",
")\n",
"\n",
"print(dataset.resource_name)"
@@ -1420,9 +1549,7 @@
" - `sentiment`: A text sentiment analysis model.\n",
" - `extraction`: A text entity extraction model.\n",
"- `multi_label`: If a classification task, whether single (False) or multi-labeled (True).\n",
"- `sentiment_max`: If a sentiment analysis task, the maximum sentiment value.\n",
"\n",
"The instantiated object is the DAG (directed acyclic graph) for the training pipeline."
"- `sentiment_max`: If a sentiment analysis task, the maximum sentiment value.\n"
]
},
{
@@ -1433,7 +1560,7 @@
},
"outputs": [],
"source": [
"dag = aip.AutoMLTextTrainingJob(\n",
"dag = aiplatform.AutoMLTextTrainingJob(\n",
" display_name=\"happydb_\" + TIMESTAMP,\n",
" prediction_type=\"classification\",\n",
" multi_label=False,\n",
@@ -1450,7 +1577,7 @@
"source": [
"#### Run the training pipeline\n",
"\n",
"Next, you run the DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"Next, you run the created DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"\n",
"- `dataset`: The `Dataset` resource to train the model.\n",
"- `model_display_name`: The human readable name for the trained model.\n",
@@ -1487,9 +1614,8 @@
},
"source": [
"## Review model evaluation scores\n",
"After your model has finished training, you can review the evaluation scores for it.\n",
"\n",
"First, you need to get a reference to the new model. As with datasets, you can either use the reference to the model variable you created when you deployed the model or you can list all of the models in your project."
"After your model training has finished, you can review the evaluation scores for it using the `list_model_evaluations()` method. This method will return an iterator for each evaluation slice."
]
},
{
@@ -1500,18 +1626,10 @@
},
"outputs": [],
"source": [
"# Get model resource ID\n",
"models = aip.Model.list(filter=\"display_name=happydb_\" + TIMESTAMP)\n",
"model_evaluations = model.list_model_evaluations()\n",
"\n",
"# Get a reference to the Model Service client\n",
"client_options = {\"api_endpoint\": f\"{REGION}-aiplatform.googleapis.com\"}\n",
"model_service_client = aip.gapic.ModelServiceClient(client_options=client_options)\n",
"\n",
"model_evaluations = model_service_client.list_model_evaluations(\n",
" parent=models[0].resource_name\n",
")\n",
"model_evaluation = list(model_evaluations)[0]\n",
"print(model_evaluation)"
"for model_evaluation in model_evaluations:\n",
" print(model_evaluation.to_dict())"
]
},
{
@@ -1542,7 +1660,7 @@
"id": "undeploy_model:mbsdk"
},
"source": [
"## Undeploy the model\n",
"#### Undeploy the model\n",
"\n",
"When you are done doing predictions, you undeploy the model from the `Endpoint` resouce. This deprovisions all compute resources and ends billing for the deployed model."
]
@@ -1686,10 +1804,7 @@
},
"outputs": [],
"source": [
"if \"IMPORT_FILES\" in globals():\n",
" FILE = IMPORT_FILES[0]\n",
"else:\n",
" FILE = IMPORT_FILE\n",
"FILE = IMPORT_FILE\n",
"\n",
"count = ! gsutil cat $FILE | wc -l\n",
"print(\"Number of Examples\", int(count[0]))\n",
@@ -1726,10 +1841,10 @@
},
"outputs": [],
"source": [
"dataset = aip.VideoDataset.create(\n",
" display_name=\"Happy Moments\" + \"_\" + TIMESTAMP,\n",
"dataset = aiplatform.VideoDataset.create(\n",
" display_name=\"human_motion_\" + TIMESTAMP,\n",
" gcs_source=[IMPORT_FILE],\n",
" import_schema_uri=aip.schema.dataset.ioformat.video.classification,\n",
" import_schema_uri=aiplatform.schema.dataset.ioformat.video.classification,\n",
")\n",
"\n",
"print(dataset.resource_name)"
@@ -1753,9 +1868,7 @@
"- `prediction_type`: The type task to train the model for.\n",
" - `classification`: A video classification model.\n",
" - `object_tracking`: A video object tracking model.\n",
" - `action_recognition`: A video action recognition model.\n",
"\n",
"The instantiated object is the DAG (directed acyclic graph) for the training pipeline."
" - `action_recognition`: A video action recognition model."
]
},
{
@@ -1766,8 +1879,8 @@
},
"outputs": [],
"source": [
"dag = aip.AutoMLVideoTrainingJob(\n",
" display_name=\"happydb_\" + TIMESTAMP,\n",
"dag = aiplatform.AutoMLVideoTrainingJob(\n",
" display_name=\"human_motion_\" + TIMESTAMP,\n",
" prediction_type=\"classification\",\n",
")\n",
"\n",
@@ -1782,7 +1895,7 @@
"source": [
"#### Run the training pipeline\n",
"\n",
"Next, you run the DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"Next, you run the created DAG to start the training job by invoking the method `run`, with the following parameters:\n",
"\n",
"- `dataset`: The `Dataset` resource to train the model.\n",
"- `model_display_name`: The human readable name for the trained model.\n",
@@ -1804,7 +1917,7 @@
"source": [
"model = dag.run(\n",
" dataset=dataset,\n",
" model_display_name=\"happydb_\" + TIMESTAMP,\n",
" model_display_name=\"human_motion_\" + TIMESTAMP,\n",
" training_fraction_split=0.8,\n",
" test_fraction_split=0.2,\n",
")"
@@ -1817,9 +1930,8 @@
},
"source": [
"## Review model evaluation scores\n",
"After your model has finished training, you can review the evaluation scores for it.\n",
"\n",
"First, you need to get a reference to the new model. As with datasets, you can either use the reference to the model variable you created when you deployed the model or you can list all of the models in your project."
"After your model training has finished, you can review the evaluation scores for it using the `list_model_evaluations()` method. This method will return an iterator for each evaluation slice."
]
},
{
@@ -1830,18 +1942,10 @@
},
"outputs": [],
"source": [
"# Get model resource ID\n",
"models = aip.Model.list(filter=\"display_name=happydb_\" + TIMESTAMP)\n",
"model_evaluations = model.list_model_evaluations()\n",
"\n",
"# Get a reference to the Model Service client\n",
"client_options = {\"api_endpoint\": f\"{REGION}-aiplatform.googleapis.com\"}\n",
"model_service_client = aip.gapic.ModelServiceClient(client_options=client_options)\n",
"\n",
"model_evaluations = model_service_client.list_model_evaluations(\n",
" parent=models[0].resource_name\n",
")\n",
"model_evaluation = list(model_evaluations)[0]\n",
"print(model_evaluation)"
"for model_evaluation in model_evaluations:\n",
" print(model_evaluation.to_dict())"
]
},
{
@@ -1899,16 +2003,7 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"Otherwise, you can delete the individual resources you created in this tutorial.\n"
]
},
{
@@ -1919,66 +2014,11 @@
},
"outputs": [],
"source": [
"delete_dataset = True\n",
"delete_pipeline = True\n",
"delete_model = True\n",
"delete_endpoint = True\n",
"delete_batchjob = True\n",
"delete_customjob = True\n",
"delete_hptjob = True\n",
"delete_bucket = True\n",
"# Set this to true only if you'd like to delete your bucket\n",
"delete_bucket = False\n",
"\n",
"# Delete the dataset using the Vertex fully qualified identifier for the dataset\n",
"try:\n",
" if delete_dataset and \"dataset_id\" in globals():\n",
" clients[\"dataset\"].delete_dataset(name=dataset_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"# Delete the training pipeline using the Vertex fully qualified identifier for the pipeline\n",
"try:\n",
" if delete_pipeline and \"pipeline_id\" in globals():\n",
" clients[\"pipeline\"].delete_training_pipeline(name=pipeline_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"# Delete the model using the Vertex fully qualified identifier for the model\n",
"try:\n",
" if delete_model and \"model_to_deploy_id\" in globals():\n",
" clients[\"model\"].delete_model(name=model_to_deploy_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"# Delete the endpoint using the Vertex fully qualified identifier for the endpoint\n",
"try:\n",
" if delete_endpoint and \"endpoint_id\" in globals():\n",
" clients[\"endpoint\"].delete_endpoint(name=endpoint_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"# Delete the batch job using the Vertex fully qualified identifier for the batch job\n",
"try:\n",
" if delete_batchjob and \"batch_job_id\" in globals():\n",
" clients[\"job\"].delete_batch_prediction_job(name=batch_job_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"# Delete the custom job using the Vertex fully qualified identifier for the custom job\n",
"try:\n",
" if delete_customjob and \"job_id\" in globals():\n",
" clients[\"job\"].delete_custom_job(name=job_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"# Delete the hyperparameter tuning job using the Vertex fully qualified identifier for the hyperparameter tuning job\n",
"try:\n",
" if delete_hptjob and \"hpt_job_id\" in globals():\n",
" clients[\"job\"].delete_hyperparameter_tuning_job(name=hpt_job_id)\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if delete_bucket or os.getenv(\"IS_TESTING\"):\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -38,9 +38,15 @@
" View on GitHub\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_bqml_training.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_bqml_training.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_bqml_training.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -67,7 +73,7 @@
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the Penguins dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset predicts the species."
"The dataset used for this tutorial is the Penguins dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). This version of the dataset is used to predict the species of penguins from the available features like culmen-length, flipper-depth etc."
]
},
{
@@ -84,16 +90,26 @@
"\n",
"- `BigQueryML Training`\n",
"- `Vertex AI Model resource`\n",
"- `Vertex AI Vizier.\n",
"- `Vertex AI Vizier`\n",
"\n",
"The steps performed include:\n",
"\n",
"- Create a local BQ table in your project.\n",
"- Train a BQML model.\n",
"- Evaluate the BQML model.\n",
"- Export the BQML model as a cloud model.\n",
"- Upload the exported model as a Vertex AI Model resource.\n",
"- Hyperparameter tune a BQML model with Vertex AI Vizier."
"- Create a local BigQuery table in your project\n",
"- Train a BQML model\n",
"- Evaluate the BQML model\n",
"- Export the BQML model as a cloud model\n",
"- Upload the exported model as a `Vertex AI Model` resource\n",
"- Hyperparameter tune a BQML model with `Vertex AI Vizier`\n",
"- Automatically register a BQML model to `Vertex AI Model Registry`\n",
"\n",
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Cloud Storage\n",
"- BigQuery\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
@@ -104,7 +120,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages for executing this notebook."
]
},
{
@@ -115,20 +131,22 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\"/opt/deeplearning/metadata/env_version\")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"# Install the packages\n",
"! pip3 install --upgrade pyarrow \\\n",
" google-cloud-aiplatform \\\n",
" google-cloud-bigquery \\\n",
" google-cloud-bigquery-storage $USER_FLAG -q"
]
},
{
@@ -166,6 +184,23 @@
"id": "project_id"
},
"source": [
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands.\n",
"\n",
"#### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
@@ -236,7 +271,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -263,6 +301,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f3bd8c0d0469"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e0953a00668e"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -286,7 +385,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -297,8 +397,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -318,7 +419,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -338,7 +439,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -347,9 +448,6 @@
"id": "setup_vars"
},
"source": [
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
]
},
@@ -361,28 +459,7 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_bq"
},
"source": [
"#### Import BigQuery\n",
"\n",
"Import the BigQuery package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_bq"
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aiplatform\n",
"from google.cloud import bigquery"
]
},
@@ -392,7 +469,7 @@
"id": "init_aip:mbsdk"
},
"source": [
"### Initialize Vertex AI SDK for Python\n",
"### Initialize Vertex AI and BigQuery SDKs for Python\n",
"\n",
"Initialize the Vertex AI SDK for Python for your project and corresponding bucket."
]
@@ -405,7 +482,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -414,8 +491,6 @@
"id": "init_bq"
},
"source": [
"### Create BigQuery client\n",
"\n",
"Create the BigQuery client."
]
},
@@ -427,7 +502,7 @@
},
"outputs": [],
"source": [
"bqclient = bigquery.Client()"
"bqclient = bigquery.Client(project=PROJECT_ID)"
]
},
{
@@ -436,17 +511,17 @@
"id": "accelerators:prediction,mbsdk"
},
"source": [
"#### Set hardware accelerators\n",
"### Set hardware accelerators\n",
"\n",
"You can set hardware accelerators for prediction.\n",
"\n",
"Set the variable `DEPLOY_GPU/DEPLOY_NGPU` to use a container image supporting a GPU and the number of GPUs allocated to the virtual machine (VM) instance. For example, to use a GPU container image with 4 Nvidia Telsa K80 GPUs allocated to each VM, you would specify:\n",
"\n",
" (aip.AcceleratorType.NVIDIA_TESLA_K80, 4)\n",
" (aiplatform.AcceleratorType.NVIDIA_TESLA_K80, 4)\n",
"\n",
"Otherwise specify `(None, None)` to use a container image to run on a CPU.\n",
"\n",
"Learn more [here](https://cloud.google.com/vertex-ai/docs/general/locations#accelerators) hardware accelerator support for your region"
"Learn more [here](https://cloud.google.com/vertex-ai/docs/general/locations#accelerators) hardware accelerator support for your region."
]
},
{
@@ -457,13 +532,15 @@
},
"outputs": [],
"source": [
"import os\n",
"\n",
"if os.getenv(\"IS_TESTING_DEPLOY_GPU\"):\n",
" DEPLOY_GPU, DEPLOY_NGPU = (\n",
" aip.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" aiplatform.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" int(os.getenv(\"IS_TESTING_DEPLOY_GPU\")),\n",
" )\n",
"else:\n",
" DEPLOY_GPU, DEPLOY_NGPU = (aip.gapic.AcceleratorType.NVIDIA_TESLA_K80, 1)"
" DEPLOY_GPU, DEPLOY_NGPU = (aiplatform.gapic.AcceleratorType.NVIDIA_TESLA_K80, 1)"
]
},
{
@@ -472,7 +549,7 @@
"id": "container:prediction"
},
"source": [
"#### Set pre-built containers\n",
"### Set pre-built containers\n",
"\n",
"Set the pre-built Docker container image for prediction.\n",
"\n",
@@ -519,11 +596,11 @@
"id": "machine:prediction"
},
"source": [
"#### Set machine type\n",
"### Set machine type\n",
"\n",
"Next, set the machine type to use for prediction.\n",
"\n",
"- Set the variable `DEPLOY_COMPUTE` to configure the compute resources for the VM you will use for prediction.\n",
"- Set the variable `DEPLOY_COMPUTE` to configure the compute resources for the VM which is used for prediction.\n",
" - `machine type`\n",
" - `n1-standard`: 3.75GB of memory per vCPU.\n",
" - `n1-highmem`: 6.5GB of memory per vCPU\n",
@@ -557,7 +634,7 @@
"id": "bqml_intro"
},
"source": [
"## Bigquery ML introduction\n",
"## BigQuery ML introduction\n",
"\n",
"BigQuery ML (BQML) provides the capability to train ML tabular models, such as classification and regression, in BigQuery using SQL syntax.\n",
"\n",
@@ -582,9 +659,9 @@
"id": "bqml_create_dataset"
},
"source": [
"### Create BQ dataset/model resource\n",
"### Create BQ dataset resource\n",
"\n",
"First, you create a empty dataset/model resource in your project."
"First, you create an empty dataset resource in your project."
]
},
{
@@ -653,13 +730,39 @@
"print(\"{} created in {}\".format(tblname, job.ended - job.started))"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3b3aa4481cd7"
},
"outputs": [],
"source": [
"MODEL_QUERY = f\"\"\"\n",
"DROP MODEL `{BQ_DATASET_NAME}.{MODEL_NAME}`\n",
"\"\"\"\n",
"\n",
"job = bqclient.query(MODEL_QUERY)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ef9e14b91475"
},
"outputs": [],
"source": [
"job"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bqml_eval_model"
},
"source": [
"### Evaluate the BQML trained model\n",
"### Evaluate the trained BQML model\n",
"\n",
"Next, retrieve the model evaluation for the trained BQML model.\n",
"\n",
@@ -694,7 +797,7 @@
"source": [
"### Export the model from BQML\n",
"\n",
"The model you trained in BQML is a TensorFlow model. Next, you will export the TensorFlow model artifacts in TF.SavedModel format."
"The model you trained in BQML is a TensorFlow model. Next, you export the TensorFlow model artifacts in TF.SavedModel format."
]
},
{
@@ -705,10 +808,10 @@
},
"outputs": [],
"source": [
"param = f\"{PROJECT_ID}:{BQ_DATASET_NAME}.{MODEL_NAME} {BUCKET_NAME}/{MODEL_NAME}\"\n",
"param = f\"{PROJECT_ID}:{BQ_DATASET_NAME}.{MODEL_NAME} {BUCKET_URI}/{MODEL_NAME}\"\n",
"! bq extract -m $param\n",
"\n",
"MODEL_DIR = f\"{BUCKET_NAME}/{BQ_DATASET_NAME}\"\n",
"MODEL_DIR = f\"{BUCKET_URI}/{BQ_DATASET_NAME}\"\n",
"! gsutil ls $MODEL_DIR"
]
},
@@ -718,9 +821,25 @@
"id": "upload_bqml_model"
},
"source": [
"## Upload the BQML model to a Model resource\n",
"## Upload the BigQuery ML model to a Vertex AI Model resource\n",
"\n",
"Finally, now that you have the BQML model exported as a TF.SavedModel format, you upload the model artifacts to Vertex AI Model resource, in the same way as if you were uploading a custom trained model."
"Finally, now that you have the BigQuery ML model exported, you upload the model artifacts to Vertex AI Model resource, in the same way as if you were uploading a custom trained model.\n",
"\n",
"Below is a partial list of mapping BigQuery ML model types to their corresponding exported model format:\n",
"\n",
"'LINEAR_REG'<br/>\n",
"'LOGISTIC_REG' --> TensorFlow SavedFormat\n",
"\n",
"'AUTOML_CLASSIFIER'<br/>\n",
"'AUTOML_REGRESSOR' --> TensorFlow SavedFormat\n",
"\n",
"'BOOSTED_TREE_CLASSIFIER'<br/>\n",
"'BOOSTED_TREE_REGRESSOR' --> XGBoost format\n",
"\n",
"'DNN_CLASSIFIER'<br/>\n",
"'DNN_REGRESSOR'<br/>\n",
"'DNN_LINEAR_COMBINED_CLASSIFIER'<br/>\n",
"'DNN_LINEAR_COMBINED_REGRESSOR' --> TensorFlow Estimator"
]
},
{
@@ -731,7 +850,7 @@
},
"outputs": [],
"source": [
"model = aip.Model.upload(\n",
"model = aiplatform.Model.upload(\n",
" display_name=\"penguins_\" + TIMESTAMP,\n",
" artifact_uri=MODEL_DIR,\n",
" serving_container_image_uri=DEPLOY_IMAGE,\n",
@@ -752,7 +871,7 @@
"- `deployed_model_display_name`: A human readable name for the deployed model.\n",
"- `traffic_split`: Percent of traffic at the endpoint that goes to this model, which is specified as a dictionary of one or more key/value pairs.\n",
"If only one model, then specify as { \"0\": 100 }, where \"0\" refers to this model being uploaded and 100 means 100% of the traffic.\n",
"If there are existing models on the endpoint, for which the traffic will be split, then use model_id to specify as { \"0\": percent, model_id: percent, ... }, where model_id is the model id of an existing model to the deployed endpoint. The percents must add up to 100.\n",
"If there are existing models on the endpoint, for which the traffic needs to be split, then use model_id to specify as { \"0\": percent, model_id: percent, ... }, where model_id is the model id of an existing model to the deployed endpoint. The percents must add up to 100.\n",
"- `machine_type`: The type of machine to use for training.\n",
"- `accelerator_type`: The hardware accelerator type.\n",
"- `accelerator_count`: The number of accelerators to attach to a worker replica.\n",
@@ -801,7 +920,7 @@
"id": "undeploy_model:mbsdk"
},
"source": [
"## Undeploy the model\n",
"#### Undeploy the model\n",
"\n",
"When you are done doing predictions, you undeploy the model from the `Endpoint` resouce. This deprovisions all compute resources and ends billing for the deployed model."
]
@@ -823,9 +942,9 @@
"id": "model_delete:mbsdk"
},
"source": [
"#### Delete the model\n",
"#### Delete the `Vertex AI Model` resource\n",
"\n",
"The method 'delete()' will delete the model."
"The method 'delete()' deletes the model."
]
},
{
@@ -839,6 +958,32 @@
"model.delete()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "7890ae6f6410"
},
"source": [
"### Delete the `BigQuery ML` model\n",
"\n",
"Next, delete the `BigQuery ML` instance of the model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f0b6163e70c0"
},
"outputs": [],
"source": [
"MODEL_QUERY = f\"\"\"\n",
"DROP MODEL `{BQ_DATASET_NAME}.{MODEL_NAME}`\n",
"\"\"\"\n",
"\n",
"job = bqclient.query(MODEL_QUERY)"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -847,7 +992,7 @@
"source": [
"### Hyperparameter Tune and train a BQML model\n",
"\n",
"Next, you train a BQML tabular classification model with hyperparameter tuning using the Vertex AI Vizier service. The hyperparameter settings are specified in the `OPTIONS` statement as follows:\n",
"Next, you train a BQML tabular classification model with hyperparameter tuning using the `Vertex AI Vizier` service. The hyperparameter settings are specified in the `OPTIONS` statement as follows:\n",
"\n",
"- `HPARAM_TUNING_ALGORITHM`: The algorithm for selecting the next trial parameters.\n",
"- `num_trials`: The number of trials.\n",
@@ -902,7 +1047,7 @@
"source": [
"### Evaluate the BQML trained model\n",
"\n",
"Next, retrieve the model evaluation for the trained BQML model.\n",
"Next, retrieve the model evaluation results for the trained BQML model.\n",
"\n",
"Learn more about [The ML.EVALUATE function](https://cloud.google.com/bigquery-ml/docs/reference/standard-sql/bigqueryml-syntax-evaluate)."
]
@@ -927,6 +1072,32 @@
"print(results)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3f3cee1236b1"
},
"source": [
"### Delete the `BigQuery ML` model\n",
"\n",
"Next, delete the `BigQuery ML` instance of the model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "957b7d841502"
},
"outputs": [],
"source": [
"MODEL_QUERY = f\"\"\"\n",
"DROP MODEL `{BQ_DATASET_NAME}.{MODEL_NAME}`\n",
"\"\"\"\n",
"\n",
"job = bqclient.query(MODEL_QUERY)"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -976,6 +1147,168 @@
"print(\"{} created in {}\".format(tblname, job.ended - job.started))"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "4def8aaf3398"
},
"source": [
"### Delete the `BigQuery ML` model\n",
"\n",
"Next, delete the `BigQuery ML` instance of the model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ff5b32618018"
},
"outputs": [],
"source": [
"MODEL_QUERY = f\"\"\"\n",
"DROP MODEL `{BQ_DATASET_NAME}.{MODEL_NAME}`\n",
"\"\"\"\n",
"\n",
"job = bqclient.query(MODEL_QUERY)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2b4498ca6fea"
},
"source": [
"## Model Registry\n",
"\n",
"Alternatively, you can implicitly upload your BigQuery ML model as a `Vertex AI Model` resource with exporting and importing the model artifacts. In this method, you add additional options when training the model that tells BigQuery ML to automatically upload and register the trained model as a `Model` resource.\n",
"\n",
"### Setting permissions to automatically register the model\n",
"\n",
"You need to set some additional IAM permissions for BigQuery ML to automatically upload and register the model after training. Depending on your service account, the setting of the permissions below may fail. In this case, we recommend executing the permissions in a Cloud Shell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0472e888105e"
},
"outputs": [],
"source": [
"! gcloud projects add-iam-policy-binding $PROJECT_ID \\\n",
" --member='serviceAccount:cloud-dataengine@system.gserviceaccount.com' \\\n",
" --role='roles/aiplatform.admin'\n",
"\n",
"! gcloud projects add-iam-policy-binding $PROJECT_ID \\\n",
" --member='user:cloud-dataengine@prod.google.com' \\\n",
" --role='roles/aiplatform.admin'"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "6c390ee7c11a"
},
"source": [
"### Training and registering the model\n",
"\n",
"Next, you train the model and automatically register the model to the `Vertex AI Model Registry`, by adding the following parameters as options:\n",
"\n",
"- `model_registry`: Set to \"vertex_ai\" to indicate automatic registation to `Vertex AI Model Registry`.\n",
"- `vertex_ai_model_id`: The human readable display name for the registered model.\n",
"- `vertex_ai_model_version_aliases`: Alternate names for the model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "57db464f4c42"
},
"outputs": [],
"source": [
"MODEL_NAME = \"penguins\"\n",
"MODEL_QUERY = f\"\"\"\n",
"CREATE OR REPLACE MODEL `{BQ_DATASET_NAME}.{MODEL_NAME}`\n",
"OPTIONS(\n",
" model_type='DNN_CLASSIFIER',\n",
" labels = ['species'],\n",
" model_registry=\"vertex_ai\",\n",
" vertex_ai_model_id=\"bqml_model_{TIMESTAMP}\", \n",
" vertex_ai_model_version_aliases=[\"1\"]\n",
" )\n",
"AS\n",
"SELECT *\n",
"FROM `{BQ_TABLE}`\n",
"\"\"\"\n",
"\n",
"job = bqclient.query(MODEL_QUERY)\n",
"print(job.errors, job.state)\n",
"\n",
"while job.running():\n",
" from time import sleep\n",
"\n",
" sleep(30)\n",
" print(\"Running ...\")\n",
"print(job.errors, job.state)\n",
"\n",
"tblname = job.ddl_target_table\n",
"tblname = \"{}.{}\".format(tblname.dataset_id, tblname.table_id)\n",
"print(\"{} created in {}\".format(tblname, job.ended - job.started))"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5b4970272040"
},
"source": [
"### Find the model in the `Vertex Model Registry`\n",
"\n",
"Finally, you can use the `Vertex AI Model` list() method with a filter query to find the automatically registered model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "76c22674ba99"
},
"outputs": [],
"source": [
"models = aiplatform.Model.list(filter=\"display_name=bqml_model_\" + TIMESTAMP)\n",
"model = models[0]\n",
"\n",
"print(model.gca_resource)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ef61354b1a5f"
},
"source": [
"### Delete the `BigQuery ML` model\n",
"\n",
"Next, delete the `BigQuery ML` instance of the model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f6004d1ce59d"
},
"outputs": [],
"source": [
"MODEL_QUERY = f\"\"\"\n",
"DROP MODEL `{BQ_DATASET_NAME}.{MODEL_NAME}`\n",
"\"\"\"\n",
"\n",
"job = bqclient.query(MODEL_QUERY)"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -987,17 +1320,9 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"Otherwise, you can delete the individual resources you created in this tutorial.\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"Set `delete_storage` to `True` to delete the Cloud Storage bucket used in this notebook."
]
},
{
@@ -1008,61 +1333,23 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"# Delete the endpoint using the Vertex endpoint object\n",
"endpoint.undeploy_all()\n",
"endpoint.delete()\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Delete the model using the Vertex model object\n",
"try:\n",
" model.delete()\n",
"except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Delete the created BigQuery dataset\n",
"! bq rm -r -f $PROJECT_ID:$BQ_DATASET_NAME\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"delete_storage = False\n",
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
" # Delete the created GCS bucket\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
File diff suppressed because it is too large Load Diff
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -29,7 +29,7 @@
"id": "title:generic,gcp"
},
"source": [
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Logging and Vertex Experiments\n",
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Logging and Vertex AI Experiments\n",
"\n",
"<table align=\"left\">\n",
" <td>\n",
@@ -38,9 +38,15 @@
" View on GitHub\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_experiments.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_experiments.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage2/get_started_vertex_experiments.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -56,7 +62,7 @@
"## Overview\n",
"\n",
"\n",
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 2 : experimentation: get started with Logging and Vertex Experiments."
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 2 : experimentation: get started with Logging and Vertex AI Experiments."
]
},
{
@@ -93,7 +99,7 @@
"source": [
"### Recommendations\n",
"\n",
"When doing E2E MLOps on Google Cloud, the following best practices for logging data when experimenting or formal training a model.\n",
"When doing E2E MLOps on Google Cloud, the following are some of the best practices for logging data when experimenting or formally training a model.\n",
"\n",
"#### Python Logging\n",
"\n",
@@ -105,7 +111,14 @@
"\n",
"#### Experiments\n",
"\n",
"Use Vertex AI Experiments in conjunction with logging when doing experiments to compare results for different experiment configurations."
"Use Vertex AI Experiments in conjunction with logging when performing experiments to compare results for different experiment configurations.\n",
"\n",
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
@@ -116,7 +129,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages for executing this notebook."
]
},
{
@@ -127,20 +140,20 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install --upgrade google-cloud-logging $USER_FLAG -q"
]
},
{
@@ -178,6 +191,24 @@
"id": "project_id"
},
"source": [
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, Compute Engine, Cloud Storage and Cloud Logging APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,compute_component,storage_component,logging).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands.\n",
"\n",
"\n",
"#### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
@@ -248,7 +279,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -275,6 +309,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f3bd8c0d0469"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e0953a00668e"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -284,7 +379,7 @@
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
"### Import libraries"
]
},
{
@@ -295,29 +390,9 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_logging"
},
"source": [
"#### Import logging\n",
"import logging\n",
"\n",
"Import the logging package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_logging"
},
"outputs": [],
"source": [
"import logging"
"import google.cloud.aiplatform as aiplatform"
]
},
{
@@ -339,7 +414,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, location=REGION)"
"aiplatform.init(project=PROJECT_ID, location=REGION)"
]
},
{
@@ -356,9 +431,9 @@
"- Send log output to console.\n",
"- Send log output to a file.\n",
"\n",
"### Logging Levels\n",
"### Logging Levels in Python Logging\n",
"\n",
"The logging levels in order (from least to highest) are, with each level inclusive of the previous level:\n",
"The logging levels in order (from least to highest) and each level inclusive of the previous level are :\n",
"\n",
"1. Informational\n",
"2. Warnings\n",
@@ -398,7 +473,7 @@
"source": [
"### Setting logging level\n",
"\n",
"To set the logging level, you get the logging handler using `getLogger()`. You can have multiple logging handles. When `getLogger()` is called w/o arguments it gets the default handler, named ROOT. With the handler, you set the logging level with the method 'setLevel()`."
"To set the logging level, you get the logging handler using `getLogger()`. You can have multiple logging handles. When `getLogger()` is called without any arguments, it gets the default handler named ROOT. With the handler, you set the logging level with the method `setLevel()`."
]
},
{
@@ -445,7 +520,7 @@
"source": [
"### Output to a local file\n",
"\n",
"You can preserve your logging output to a file that is local to where the Python script is running with the method `BasicConfig()`, with the following paraneters:\n",
"You can preserve your logging output to a file that is local to where the Python script is running with the method `BasicConfig()`, that takes the following parameters:\n",
"\n",
"- `filename`: The file path to the local file to write the log output to.\n",
"- `level`: Sets the level of logging that is written to the logging file.\n",
@@ -482,7 +557,7 @@
"- Send log output to storage.\n",
"- Retrieve log output from storage.\n",
"\n",
"### Logging Levels\n",
"### Logging Levels in Cloud Logging\n",
"\n",
"The logging levels in order (from least to highest) are, with each level inclusive of the previous level:\n",
"\n",
@@ -517,7 +592,7 @@
"from google.cloud.logging.handlers import CloudLoggingHandler\n",
"\n",
"# Connect to the Cloud Logging service\n",
"cl_client = google.cloud.logging.Client()\n",
"cl_client = google.cloud.logging.Client(project=PROJECT_ID)\n",
"handler = CloudLoggingHandler(cl_client, name=\"mylog\")\n",
"\n",
"# Create a logger instance and logging level\n",
@@ -539,7 +614,7 @@
"source": [
"### Logging output\n",
"\n",
"To log output at specific levels is identical in method, and method names, as in Python logging, except that you use your instance of the cloud logger in place of logging."
"Logging output at specific levels is identical to Python logging with respect to method and method names. The only difference is that you use your instance of the cloud logger in place of logging."
]
},
{
@@ -567,7 +642,7 @@
"To get the logged output, you:\n",
"\n",
"1. Retrieve the log handle to the service.\n",
"2. Using the handle call the method `list_entries()`\n",
"2. Using the handle, call the method `list_entries()`.\n",
"3. Iterate through the entries."
]
},
@@ -594,10 +669,10 @@
"source": [
"## Logging with Vertex AI Experiments and Vertex AI ML Metadata\n",
"\n",
"You can log results related to training experiments with `Vertex AI Experiments` and `ML Metadata`:\n",
"You can log results related to training experiments with `Vertex AI Experiments` and `ML Metadata` including:\n",
"\n",
"- Preserve results of an experiment.\n",
"- Track multiple runs -- i.e., training runs -- within an experiment.\n",
"- Track multiple runs i.e., training runs within an experiment.\n",
"- Track parameters (configuration) and metrics (results).\n",
"- Retrieve and display the logged output.\n",
"\n",
@@ -612,14 +687,29 @@
"source": [
"### Create experiment for tracking training related metadata\n",
"\n",
"Setup tracking the parameters (configuration) and metrics (results) for each experiment:\n",
"Setup tracking for parameters (configuration) and metrics (results) in each experiment:\n",
"\n",
"- `aip.init()` - Create an experiment instance\n",
"- `aip.start_run()` - Track a specific run within the experiment.\n",
"- `aiplatform.init()` - Create an experiment instance\n",
"- `aiplatform.start_run()` - Track a specific run within the experiment.\n",
"\n",
"Learn more about [Introduction to Vertex AI ML Metadata](https://cloud.google.com/vertex-ai/docs/ml-metadata/introduction)."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "1ed46e349cf2"
},
"outputs": [],
"source": [
"# Specify a name for the experiment\n",
"EXPERIMENT_NAME = \"[your-experiment-name]\"\n",
"\n",
"if EXPERIMENT_NAME == \"[your-experiment-name]\":\n",
" EXPERIMENT_NAME = \"example-\" + TIMESTAMP"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -628,9 +718,9 @@
},
"outputs": [],
"source": [
"EXPERIMENT_NAME = \"example-\" + TIMESTAMP\n",
"aip.init(experiment=EXPERIMENT_NAME)\n",
"aip.start_run(\"run-1\")"
"# Create experiment\n",
"aiplatform.init(experiment=EXPERIMENT_NAME)\n",
"aiplatform.start_run(\"run-1\")"
]
},
{
@@ -641,14 +731,14 @@
"source": [
"### Log parameters for the experiment\n",
"\n",
"Typically, an experiment is associated with a specific dataset and model architecture. Within an experiment, you may have multiple training runs, where each run tries a different configuration. As examples:\n",
"Typically, an experiment is associated with a specific dataset and a model architecture. Within an experiment, you may have multiple training runs, where each run tries a different configuration. For example:\n",
"\n",
"- Dataset split\n",
"- Dataset sampling and boosting\n",
"- Depth and width of layers\n",
"- Hyperparameters\n",
"\n",
"These configuration settings are referred to as parameters, which you store their key/value pair using the method `log_params()`"
"These configuration settings are referred to as parameters, which you store as key-value pairs using the method `log_params()`"
]
},
{
@@ -663,7 +753,7 @@
"hyperparams[\"epochs\"] = 100\n",
"hyperparams[\"batch_size\"] = 32\n",
"hyperparams[\"learning_rate\"] = 0.01\n",
"aip.log_params(hyperparams)"
"aiplatform.log_params(hyperparams)"
]
},
{
@@ -674,14 +764,14 @@
"source": [
"### Log metrics for the experiment\n",
"\n",
"At the completion, or termination, of a run within an experiment, you can log results that you use to compare runs. As examples:\n",
"At the completion or termination of a run within an experiment, you can log results that you use to compare runs. For example:\n",
"\n",
"- Evaluation metrics\n",
"- Hyperparameter search selection\n",
"- Time to train the model\n",
"- Early stop trigger\n",
"\n",
"These results settings are referred to as metrics, which you store their key/value pair using the method `log_metrics()`"
"These results are referred to as metrics, which you store as key-value pairs using the method `log_metrics()`"
]
},
{
@@ -695,7 +785,7 @@
"metrics = {}\n",
"metrics[\"test_acc\"] = 98.7\n",
"metrics[\"train_acc\"] = 99.3\n",
"aip.log_metrics(metrics)"
"aiplatform.log_metrics(metrics)"
]
},
{
@@ -717,36 +807,11 @@
},
"outputs": [],
"source": [
"EXPERIMENT_NAME = \"example\"\n",
"\n",
"experiment_df = aip.get_experiment_df()\n",
"experiment_df = aiplatform.get_experiment_df()\n",
"experiment_df = experiment_df[experiment_df.experiment_name == EXPERIMENT_NAME]\n",
"experiment_df.T"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "delete_experiment"
},
"source": [
"### Delete the experiment\n",
"\n",
"Next, delete the experiment. You will need to get the context via the metadata to delete it."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "delete_experiment"
},
"outputs": [],
"source": [
"c = aiplatform.metadata._Context(EXPERIMENT_NAME)\n",
"c.delete()"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -760,15 +825,9 @@
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"### Delete the experiment\n",
"\n",
"Next, delete the experiment. You will need to get the context via the metadata to delete it."
]
},
{
@@ -779,61 +838,8 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"c = aiplatform.metadata._Context(EXPERIMENT_NAME)\n",
"c.delete()"
]
}
],
File diff suppressed because it is too large Load Diff
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -29,9 +29,14 @@
"id": "title:generic,gcp"
},
"source": [
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Tensorboard\n",
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex AI Tensorboard\n",
"\n",
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_tensorboard.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_tensorboard.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
@@ -39,8 +44,9 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_tensorboard.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/notebook_template.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -56,7 +62,7 @@
"## Overview\n",
"\n",
"\n",
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 2 : experimentation: get started with Vertex Tensorboard."
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 2 : experimentation: get started with Vertex AI Tensorboard."
]
},
{
@@ -81,6 +87,68 @@
"- Using Vertex AI TensorBoard with Vertex AI Training."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b132d4ef86d6"
},
"source": [
"### Costs \n",
"\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"* Vertex AI\n",
"* Cloud Storage\n",
"\n",
"Learn about [Vertex AI\n",
"pricing](https://cloud.google.com/vertex-ai/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
"Calculator](https://cloud.google.com/products/calculator/)\n",
"to generate a cost estimate based on your projected usage."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "56cb7f08a9e8"
},
"source": [
"### Set up your local development environment\n",
"\n",
"**If you are using Colab or Google Cloud Notebooks**, your environment already meets\n",
"all the requirements to run this notebook. You can skip this step.\n",
"\n",
"**Otherwise**, make sure your environment meets this notebook's requirements.\n",
"You need the following:\n",
"\n",
"* The Google Cloud SDK\n",
"* Git\n",
"* Python 3\n",
"* virtualenv\n",
"* Jupyter notebook running in a virtual environment with Python 3\n",
"\n",
"The Google Cloud guide to [Setting up a Python development\n",
"environment](https://cloud.google.com/python/setup) and the [Jupyter\n",
"installation guide](https://jupyter.org/install) provide detailed instructions\n",
"for meeting these requirements. The following steps provide a condensed set of\n",
"instructions:\n",
"\n",
"1. [Install and initialize the Cloud SDK.](https://cloud.google.com/sdk/docs/)\n",
"\n",
"1. [Install Python 3.](https://cloud.google.com/python/setup#installing_python)\n",
"\n",
"1. [Install\n",
" virtualenv](https://cloud.google.com/python/setup#installing_and_using_virtualenv)\n",
" and create a virtual environment that uses Python 3. Activate the virtual environment.\n",
"\n",
"1. To install Jupyter, run `pip3 install jupyter` on the\n",
"command-line in a terminal shell.\n",
"\n",
"1. To launch Jupyter, run `jupyter notebook` on the command-line in a terminal shell.\n",
"\n",
"1. Open this notebook in the Jupyter Notebook Dashboard.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -89,7 +157,7 @@
"source": [
"### Recommendations\n",
"\n",
"When doing E2E MLOps on Google Cloud, the following best practices for visualizing your training with TensorBoard.\n",
"When doing E2E MLOps on Google Cloud, the following are the best practices for visualizing your training with TensorBoard.\n",
"\n",
"#### Local TensorBoard\n",
"\n",
@@ -112,31 +180,32 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages for executing this notebook."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "install_mlops"
"id": "020040f91150"
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install -U tensorflow==2.8 $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG -q"
]
},
{
@@ -168,6 +237,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2721ef0202d9"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com). \n",
"\n",
"1. If you are running this notebook locally, you will need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -244,7 +339,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -271,6 +369,82 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2700e693f1b3"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already\n",
"authenticated. Skip this step."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "885395904904"
},
"source": [
"**If you are using Colab**, run the cell below and follow the instructions\n",
"when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"1. In the Cloud Console, go to the [**Create service account key**\n",
" page](https://console.cloud.google.com/apis/credentials/serviceaccountkey).\n",
"\n",
"2. Click **Create service account**.\n",
"\n",
"3. In the **Service account name** field, enter a name, and\n",
" click **Create**.\n",
"\n",
"4. In the **Grant this service account access to project** section, click the **Role** drop-down list. Type \"Vertex AI\"\n",
"into the filter box, and select\n",
" **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"5. Click *Create*. A JSON file that contains your key downloads to your\n",
"local environment.\n",
"\n",
"6. Enter the path to your service account key as the\n",
"`GOOGLE_APPLICATION_CREDENTIALS` variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "eff327d0552b"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -294,7 +468,7 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_URI = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
]
},
{
@@ -305,8 +479,8 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_URI = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
]
},
{
@@ -326,7 +500,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -346,7 +520,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -384,9 +558,16 @@
" or SERVICE_ACCOUNT is None\n",
" or SERVICE_ACCOUNT == \"[your-service-account]\"\n",
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" # Get your service account from gcloud\n",
" if not IS_COLAB:\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
"\n",
" if IS_COLAB:\n",
" shell_output = ! gcloud projects describe $PROJECT_ID\n",
" project_number = shell_output[-1].split(\":\")[1].strip().replace(\"'\", \"\")\n",
" SERVICE_ACCOUNT = f\"{project_number}-compute@developer.gserviceaccount.com\"\n",
"\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
@@ -410,7 +591,7 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
"import google.cloud.aiplatform as aiplatform"
]
},
{
@@ -454,7 +635,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -484,13 +665,15 @@
},
"outputs": [],
"source": [
"import os\n",
"\n",
"if os.getenv(\"IS_TESTING_TRAIN_GPU\"):\n",
" TRAIN_GPU, TRAIN_NGPU = (\n",
" aip.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" aiplatform.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" int(os.getenv(\"IS_TESTING_TRAIN_GPU\")),\n",
" )\n",
"else:\n",
" TRAIN_GPU, TRAIN_NGPU = (aip.gapic.AcceleratorType.NVIDIA_TESLA_K80, 1)"
" TRAIN_GPU, TRAIN_NGPU = (aiplatform.gapic.AcceleratorType.NVIDIA_TESLA_K80, 1)"
]
},
{
@@ -663,9 +846,9 @@
"\n",
"You can upload your TensorBoard logs and share with others using `tensorboard dev` command. Once uploaded, a URL is returned to open up the TensorBoard instance in a brower for visualizing.\n",
"\n",
"*Note:* Your TensorBoard instance is publicly visable.\n",
"*Note:* Your TensorBoard instance is publicly visible.\n",
"\n",
"*Note:* In this example, while running within a notebook, the command will freeze since it is waiting for an interactive yes/no input. You can kill the command with a Ctrl C or kernel interupt.\n",
"*Note:* This cell is for demonstration purposes and must be ran in a terminal shell. In this example, while running within a notebook, the command will freeze since it is waiting for an interactive yes/no input. You can kill the command with a Ctrl C or kernel interupt.\n",
"\n",
"Learn more about [What is TensorBoard.dev](https://tensorboard.dev/)."
]
@@ -678,7 +861,7 @@
},
"outputs": [],
"source": [
"! tensorboard dev upload --logdir {LOG_DIR} \\\n",
"! tensorboard dev upload --logdir logs \\\n",
" --name \"Simple experiment with MNIST\" \\\n",
" --description \"Training results\" \\\n",
" --one_shot"
@@ -706,7 +889,7 @@
"outputs": [],
"source": [
"TENSORBOARD_DISPLAY_NAME = \"example\"\n",
"tensorboard = aip.Tensorboard.create(display_name=TENSORBOARD_DISPLAY_NAME)\n",
"tensorboard = aiplatform.Tensorboard.create(display_name=TENSORBOARD_DISPLAY_NAME)\n",
"tensorboard_resource_name = tensorboard.gca_resource.name\n",
"print(\"TensorBoard resource name:\", tensorboard_resource_name)"
]
@@ -746,9 +929,9 @@
"\n",
"url = output[1].split(' ')[-1]\n",
"\n",
"print(url)\n",
"#print(url)\n",
"\n",
"from IPython.core.display import display, HTML\n",
"from IPython.display import display, HTML\n",
"display(HTML(\"<a href='\" + url + \"'>click here for TensorBoard instance</a>\"))"
]
},
@@ -953,7 +1136,7 @@
"! rm -f custom.tar custom.tar.gz\n",
"! tar cvf custom.tar custom\n",
"! gzip custom.tar\n",
"! gsutil cp custom.tar.gz $BUCKET_NAME/trainer_example.tar.gz"
"! gsutil cp custom.tar.gz $BUCKET_URI/trainer_example.tar.gz"
]
},
{
@@ -985,7 +1168,7 @@
},
"outputs": [],
"source": [
"job = aip.CustomTrainingJob(\n",
"job = aiplatform.CustomTrainingJob(\n",
" display_name=\"example_\" + TIMESTAMP,\n",
" script_path=\"custom/trainer/task.py\",\n",
" container_uri=TRAIN_IMAGE,\n",
@@ -1021,7 +1204,7 @@
},
"outputs": [],
"source": [
"MODEL_DIR = \"{}/{}\".format(BUCKET_NAME, TIMESTAMP)\n",
"MODEL_DIR = \"{}/{}\".format(BUCKET_URI, TIMESTAMP)\n",
"\n",
"EPOCHS = 20\n",
"STEPS = 100\n",
@@ -1143,14 +1326,8 @@
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
]
},
@@ -1162,61 +1339,14 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"# Delete the custom training job\n",
"job.delete()\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Set this to true only if you'd like to delete your bucket\n",
"delete_bucket = False\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if delete_bucket or os.getenv(\"IS_TESTING\"):\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
@@ -29,7 +29,7 @@
"id": "title:generic,gcp"
},
"source": [
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Training\n",
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex AI Training\n",
"\n",
"<table align=\"left\">\n",
" <td>\n",
@@ -39,8 +39,14 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_training.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_training.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage2/get_started_vertex_training.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -127,7 +133,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the packages required for executing this notebook"
]
},
{
@@ -138,20 +144,20 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q"
]
},
{
@@ -173,8 +179,6 @@
},
"outputs": [],
"source": [
"import os\n",
"\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" # Automatically restart kernel after installs\n",
" import IPython\n",
@@ -183,6 +187,36 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "before_you_begin"
},
"source": [
"## Before you begin\n",
"\n",
"### GPU runtime\n",
"\n",
"*Make sure you're running this notebook in a GPU runtime if you have that option. In Colab, select* **Runtime > Change Runtime Type > GPU**\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"2. [Make sure that billing is enabled for your project.](https://cloud.google.com/billing/docs/how-to/modify-project)\n",
"\n",
"3. [Enable the following APIs: Vertex AI APIs, Compute Engine APIs, and Cloud Storage.](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,compute_component,storage-component.googleapis.com)\n",
"\n",
"4. If you are running this notebook locally, you will need to install the [Cloud SDK]((https://cloud.google.com/sdk)).\n",
"\n",
"5. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$`."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -259,7 +293,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -286,6 +323,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gcp_authenticate"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"**Click Create service account**.\n",
"\n",
"In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex\" into the filter box, and select **Vertex Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gcp_authenticate"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -309,7 +407,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -320,8 +419,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -341,7 +441,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -361,7 +461,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -384,7 +484,7 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
"import google.cloud.aiplatform as aiplatform"
]
},
{
@@ -406,7 +506,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -441,7 +541,7 @@
"source": [
"if os.getenv(\"IS_TESTING_TRAIN_GPU\"):\n",
" TRAIN_GPU, TRAIN_NGPU = (\n",
" aip.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" aiplatform.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" int(os.getenv(\"IS_TESTING_TRAIN_GPU\")),\n",
" )\n",
"else:\n",
@@ -449,7 +549,7 @@
"\n",
"if os.getenv(\"IS_TESTING_DEPLOY_GPU\"):\n",
" DEPLOY_GPU, DEPLOY_NGPU = (\n",
" aip.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" aiplatform.gapic.AcceleratorType.NVIDIA_TESLA_K80,\n",
" int(os.getenv(\"IS_TESTING_DEPLOY_GPU\")),\n",
" )\n",
"else:\n",
@@ -484,7 +584,7 @@
"if os.getenv(\"IS_TESTING_TF\"):\n",
" TF = os.getenv(\"IS_TESTING_TF\")\n",
"else:\n",
" TF = \"2.1\".replace(\".\", \"-\")\n",
" TF = \"2.5\".replace(\".\", \"-\")\n",
"\n",
"if TF[0] == \"2\":\n",
" if TRAIN_GPU:\n",
@@ -602,7 +702,7 @@
"DISPLAY_NAME = \"boston_\" + TIMESTAMP\n",
"REQUIREMENTS = [\"tensorflow==2.3\"]\n",
"\n",
"job = aip.CustomTrainingJob(\n",
"job = aiplatform.CustomTrainingJob(\n",
" display_name=DISPLAY_NAME,\n",
" script_path=\"task.py\",\n",
" requirements=REQUIREMENTS,\n",
@@ -623,7 +723,7 @@
"In summary:\n",
"\n",
"- Get the directory where to save the model artifacts from the command line (`--model_dir`), and if not specified, then from the environment variable `AIP_MODEL_DIR`.\n",
"- Open a file \"test.txt\" in the directory where to sace the model artifacts.\n",
"- Open a file \"test.txt\" in the directory where to save the model artifacts.\n",
"- Write \"hello world\" to the file."
]
},
@@ -693,12 +793,12 @@
"outputs": [],
"source": [
"CMDARGS = [\n",
" \"--model-dir=\" + BUCKET_NAME,\n",
" \"--model-dir=\" + BUCKET_URI,\n",
"]\n",
"\n",
"job.run(args=CMDARGS, replica_count=1, machine_type=TRAIN_COMPUTE, sync=True)\n",
"\n",
"! gsutil cat {BUCKET_NAME}/test.txt"
"! gsutil cat {BUCKET_URI}/test.txt"
]
},
{
@@ -768,9 +868,9 @@
"source": [
"DISPLAY_NAME = \"boston_\" + TIMESTAMP\n",
"\n",
"job = aip.CustomPythonPackageTrainingJob(\n",
"job = aiplatform.CustomPythonPackageTrainingJob(\n",
" display_name=DISPLAY_NAME,\n",
" python_package_gcs_uri=f\"{BUCKET_NAME}/trainer_boston.tar.gz\",\n",
" python_package_gcs_uri=f\"{BUCKET_URI}/trainer_boston.tar.gz\",\n",
" python_module_name=\"trainer.task\",\n",
" container_uri=TRAIN_IMAGE,\n",
")"
@@ -848,7 +948,7 @@
"\n",
"- Get the directory where to save the model artifacts from the command line (`--model_dir`), and if not specified, then from the environment variable `AIP_MODEL_DIR`.\n",
"- Get the number of epochs to run from the command line (`--model_dir`).\n",
"- Open a file \"test.txt\" in the directory where to sace the model artifacts.\n",
"- Open a file \"test.txt\" in the directory where to save the model artifacts.\n",
"- Repeat appending \"hello world\" to the file, one per epoch."
]
},
@@ -900,7 +1000,7 @@
"! rm -f custom.tar custom.tar.gz\n",
"! tar cvf custom.tar custom\n",
"! gzip custom.tar\n",
"! gsutil cp custom.tar.gz $BUCKET_NAME/trainer_boston.tar.gz"
"! gsutil cp custom.tar.gz $BUCKET_URI/trainer_boston.tar.gz"
]
},
{
@@ -922,11 +1022,11 @@
},
"outputs": [],
"source": [
"CMDARGS = [\"--model-dir=\" + BUCKET_NAME, \"--epochs=5\"]\n",
"CMDARGS = [\"--model-dir=\" + BUCKET_URI, \"--epochs=5\"]\n",
"\n",
"job.run(args=CMDARGS, replica_count=1, machine_type=TRAIN_COMPUTE, sync=True)\n",
"\n",
"! gsutil cat {BUCKET_NAME}/test.txt"
"! gsutil cat {BUCKET_URI}/test.txt"
]
},
{
@@ -1045,7 +1145,7 @@
"\n",
"- Get the directory where to save the model artifacts from the command line (`--model_dir`), and if not specified, then from the environment variable `AIP_MODEL_DIR`.\n",
"- Get the number of epochs to run from the command line (`--model_dir`).\n",
"- Open a file \"test.txt\" in the directory where to sace the model artifacts.\n",
"- Open a file \"test.txt\" in the directory where to save the model artifacts.\n",
"- Repeat appending \"hello world\" to the file, one per epoch."
]
},
@@ -1151,7 +1251,11 @@
},
"outputs": [],
"source": [
"! docker build custom -t $TRAIN_IMAGE"
"if not IS_COLAB:\n",
" ! docker build custom -t $TRAIN_IMAGE\n",
"else:\n",
" # install docker daemon\n",
" ! apt-get -qq install docker.io"
]
},
{
@@ -1173,7 +1277,8 @@
},
"outputs": [],
"source": [
"! docker run $TRAIN_IMAGE --epochs=5 --model-dir=./"
"if not IS_COLAB:\n",
" ! docker run $TRAIN_IMAGE --epochs=5 --model-dir=./"
]
},
{
@@ -1195,7 +1300,38 @@
},
"outputs": [],
"source": [
"! docker push $TRAIN_IMAGE"
"if not IS_COLAB:\n",
" ! docker push $TRAIN_IMAGE"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f50e9c553fb7"
},
"source": [
"*Executes in Colab*"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a7e8c98f1e56"
},
"outputs": [],
"source": [
"%%bash -s $IS_COLAB $TRAIN_IMAGE\n",
"if [ $1 == \"False\" ]; then\n",
" exit 0\n",
"fi\n",
"set -x\n",
"dockerd -b none --iptables=0 -l warn &\n",
"for i in $(seq 5); do [ ! -S \"/var/run/docker.sock\" ] && sleep 2 || break; done\n",
"docker build custom -t $2\n",
"docker run $2 --epochs=5 --model-dir=./\n",
"docker push $2\n",
"kill $(jobs -p)"
]
},
{
@@ -1229,7 +1365,7 @@
},
"outputs": [],
"source": [
"job = aip.CustomContainerTrainingJob(\n",
"job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=\"boston_\" + TIMESTAMP,\n",
" container_uri=TRAIN_IMAGE,\n",
" command=[\"python3\", \"trainer/task.py\"],\n",
@@ -1257,11 +1393,11 @@
},
"outputs": [],
"source": [
"CMDARGS = [\"--model-dir=\" + BUCKET_NAME, \"--epochs=5\"]\n",
"CMDARGS = [\"--model-dir=\" + BUCKET_URI, \"--epochs=5\"]\n",
"\n",
"job.run(args=CMDARGS, replica_count=1, machine_type=TRAIN_COMPUTE, sync=True)\n",
"\n",
"! gsutil cat {BUCKET_NAME}/test.txt"
"! gsutil cat {BUCKET_URI}/test.txt"
]
},
{
@@ -1466,7 +1602,7 @@
"! rm -f custom.tar custom.tar.gz\n",
"! tar cvf custom.tar custom\n",
"! gzip custom.tar\n",
"! gsutil cp custom.tar.gz $BUCKET_NAME/trainer_boston.tar.gz"
"! gsutil cp custom.tar.gz $BUCKET_URI/trainer_boston.tar.gz"
]
},
{
@@ -1496,7 +1632,7 @@
"if os.getenv(\"IS_TESTING_TF\"):\n",
" TF = os.getenv(\"IS_TESTING_TF\")\n",
"else:\n",
" TF = \"2.1\".replace(\".\", \"-\")\n",
" TF = \"2.5\".replace(\".\", \"-\")\n",
"\n",
"if TF[0] == \"2\":\n",
" if TRAIN_GPU:\n",
@@ -1551,9 +1687,9 @@
"source": [
"DISPLAY_NAME = \"boston_\" + TIMESTAMP\n",
"\n",
"job = aip.CustomPythonPackageTrainingJob(\n",
"job = aiplatform.CustomPythonPackageTrainingJob(\n",
" display_name=DISPLAY_NAME,\n",
" python_package_gcs_uri=f\"{BUCKET_NAME}/trainer_boston.tar.gz\",\n",
" python_package_gcs_uri=f\"{BUCKET_URI}/trainer_boston.tar.gz\",\n",
" python_module_name=\"trainer.task\",\n",
" container_uri=TRAIN_IMAGE,\n",
" model_serving_container_image_uri=DEPLOY_IMAGE,\n",
@@ -1587,12 +1723,12 @@
},
"outputs": [],
"source": [
"MODEL_DIR = \"{}/{}\".format(BUCKET_NAME, TIMESTAMP)\n",
"MODEL_DIR = \"{}/{}\".format(BUCKET_URI, TIMESTAMP)\n",
"\n",
"EPOCHS = 20\n",
"STEPS = 100\n",
"\n",
"DIRECT = True\n",
"DIRECT = False\n",
"if DIRECT:\n",
" CMDARGS = [\n",
" \"--model-dir=\" + MODEL_DIR,\n",
@@ -1758,17 +1894,7 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"Otherwise, you can delete the individual resources you created in this tutorial."
]
},
{
@@ -1779,61 +1905,24 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"delete_bucket = False\n",
"delete_model = True\n",
"delete_job = True\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
"if delete_model:\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
"if delete_job:\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if delete_bucket or os.getenv(\"IS_TESTING\"):\n",
" ! gsutil rm -rf {BUCKET_URI}"
]
}
],
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -29,7 +29,7 @@
"id": "title:generic,gcp"
},
"source": [
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Vizier\n",
"# E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex AI Vizier\n",
"\n",
"<table align=\"left\">\n",
" <td>\n",
@@ -39,10 +39,16 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_vizier.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" </a>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_vizier.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage2/get_started_vertex_vizier.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td> \n",
"</table>\n",
"<br/><br/><br/>"
]
@@ -136,31 +142,31 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the packages required for executing this notebook."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "install_mlops"
"id": "1fd00fa70a2a"
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG"
]
},
{
@@ -192,6 +198,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2721ef0202d9"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com). \n",
"\n",
"1. If you are running this notebook locally, you will need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -268,7 +300,9 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type:\"string\"}\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -295,6 +329,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gcp_authenticate"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"**Click Create service account**.\n",
"\n",
"In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex\" into the filter box, and select **Vertex Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gcp_authenticate"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -318,7 +413,7 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_URI = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
]
},
{
@@ -329,8 +424,8 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_URI = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
]
},
{
@@ -350,7 +445,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -370,7 +465,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -415,7 +510,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -808,7 +903,7 @@
"! rm -f custom.tar custom.tar.gz\n",
"! tar cvf custom.tar custom\n",
"! gzip custom.tar\n",
"! gsutil cp custom.tar.gz $BUCKET_NAME/trainer_boston.tar.gz"
"! gsutil cp custom.tar.gz $BUCKET_URI/trainer_boston.tar.gz"
]
},
{
@@ -916,7 +1011,7 @@
"outputs": [],
"source": [
"JOB_NAME = \"custom_job_\" + TIMESTAMP\n",
"MODEL_DIR = \"{}/{}\".format(BUCKET_NAME, JOB_NAME)\n",
"MODEL_DIR = \"{}/{}\".format(BUCKET_URI, JOB_NAME)\n",
"\n",
"if not TRAIN_NGPU or TRAIN_NGPU < 2:\n",
" TRAIN_STRATEGY = \"single\"\n",
@@ -948,7 +1043,7 @@
" \"disk_spec\": disk_spec,\n",
" \"python_package_spec\": {\n",
" \"executor_image_uri\": TRAIN_IMAGE,\n",
" \"package_uris\": [BUCKET_NAME + \"/trainer_boston.tar.gz\"],\n",
" \"package_uris\": [BUCKET_URI + \"/trainer_boston.tar.gz\"],\n",
" \"python_module\": \"trainer.task\",\n",
" \"args\": CMDARGS,\n",
" },\n",
@@ -1577,14 +1672,6 @@
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
]
},
@@ -1596,61 +1683,10 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"delete_bucket = False\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if os.getenv(\"IS_TESTING\"):\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff

Some files were not shown because too many files have changed in this diff Show More