Compare commits

...
Author SHA1 Message Date
Andrew FerlitschandGitHub ccd89d1384 fix: replace os.environ with os.getenv 2022-03-18 15:45:23 -07:00
Andrew FerlitschandGitHub 0980f4e1b7 fix: replace os.environ with os.getenv 2022-03-18 15:42:23 -07:00
Andrew FerlitschandGitHub e5bbae8023 fix: replace os.environ with os.getenv 2022-03-18 15:41:43 -07:00
Andrew FerlitschandGitHub efaa340a98 fix: replace os.environ with os.getenv 2022-03-18 15:40:50 -07:00
Andrew FerlitschandGitHub a132f83e30 fix: replace os.environ with os.getenv 2022-03-18 15:40:07 -07:00
Andrew FerlitschandGitHub e338d7187b fix: replace os.environ with os.getenv 2022-03-18 15:39:11 -07:00
Andrew FerlitschandGitHub 78e3cb6170 fix: replace os.environ with os.getenv 2022-03-18 15:37:56 -07:00
Andrew FerlitschandGitHub 77f81441eb fix: replace os.environ with os.getenv 2022-03-18 15:36:50 -07:00
Andrew FerlitschandGitHub 3b7ca24a9c fix: replace os.environ with os.getenv 2022-03-18 15:35:31 -07:00
daa64efd40 fix: replace os.environ with os.getenv (#393)
* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-18 16:44:34 -05:00
Andrew FerlitschandGitHub a37deabe27 Update README.md 2022-03-18 13:15:34 -07:00
Andrew FerlitschandGitHub 6009ef0def Update README.md 2022-03-18 13:14:34 -07:00
Andrew FerlitschandGitHub edc644b0d0 Update README.md 2022-03-18 13:13:15 -07:00
Andrew FerlitschandGitHub 1297af8baf Create README.md 2022-03-18 13:11:38 -07:00
Andrew FerlitschandGitHub b8b1b6675b Update README.md 2022-03-18 13:09:51 -07:00
Andrew FerlitschandGitHub 7d3b7abc44 fix: review updates (#395)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl

* review: edits per Erwin review

* review: edits per Erwin review
2022-03-18 12:09:53 -07:00
Rajesh ThallamandGitHub 9a572f298e [community-content] Notebook to demo NVIDIA Triton Inference Server on Vertex AI Prediction (#391)
* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Fixes based on feedback to NVIDIA Triton on Vertex AI Prediction community notebook
2022-03-18 11:31:01 -05:00
b53ca9e678 Tabnet (#375)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-17 17:20:01 -05:00
Andrew FerlitschandGitHub 9aceec161a Update README.md 2022-03-17 14:50:24 -07:00
Andrew FerlitschandGitHub 98b186ed55 feat: notebook for bqml+automl combined (#390)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl
2022-03-17 14:46:29 -07:00
sudarshan-SpringMLandGitHub f23ee1b5a8 Made small changes to Get started vertex vizier notebook (#389)
* modified notebook

* ran linter test

* modified notebook changed copyright licence year

* ran linter test
2022-03-17 10:03:19 -05:00
c6d779f1fc Featurestore colab update (#387)
* update featurestore colab comment

* delete some changes

* delete some changes 2

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-16 21:31:22 -05:00
Andrew FerlitschandGitHub 8908b27b08 feat: finish CPR notebook (#388)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook
2022-03-16 14:00:03 -07:00
Andrew FerlitschandGitHub 8947c9b116 feat: more CPR (#385)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook
2022-03-15 11:56:29 -07:00
Andrew FerlitschandGitHub 9464caac6e Update README.md 2022-03-14 17:40:15 -07:00
Andrew FerlitschandGitHub 98ce91c575 feat: add CPR notebook (#384)
* feat: add CPR notebook

* feat: add CPR notebook
2022-03-14 17:38:47 -07:00
Andrew FerlitschandGitHub 07f8feda3d Update README.md 2022-03-14 11:19:31 -07:00
Andrew FerlitschandGitHub a4e0496ff5 feat: CMEK training (#383)
* feat: add FS from panda

* feat: add FS from panda

* feat: add CMEK example

* feat: add CMEK example
2022-03-14 11:15:35 -07:00
cf162c02c8 chore(deps): update dependency pyupgrade to v2.31.1 (#381)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:34:58 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
831aae94df build(deps): bump pillow (#378)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:33:36 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
3fd9f28778 build(deps): bump pillow (#379)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:32:20 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a656e8e2a8 build(deps): bump pillow (#380)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-03-14 09:30:19 -05:00
Morgan DuandGitHub 2f02152703 fix: pip install google-cloud-aiplatform (#376) 2022-03-10 12:00:08 -06:00
9d08f8ce67 Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components (#372)
* Using BQML 1st-party components and 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML components and upgrade to 1.0.0 of GCPC

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:34:12 -06:00
ec6d508793 adds automl-text-sentiment-analysis-online notebook (#293)
* adds automl-text-sentiment-analysis-online notebook

* adds the cleaned up automl-text-sentiment-analysis notebook after running linter test

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* deletes the source file from the community/sdk folder

* updates the colab, git & workbench links in the notebook

* ran linter test

* updates the license year to 2022 and simplifies the clean-up step for bucket-deletion

* ran linter test

* adds TESTING env condition while deleting the buckets

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:09:10 -06:00
WhiteSource RenovateandGitHub 772e35ea75 chore(deps): update dependency nbqa to v1.3.1 (#374) 2022-03-09 08:24:16 -06:00
Andrew FerlitschandGitHub 1d28f886c8 feat: add example of FS values from dataframe (#373)
* feat: add FS from panda

* feat: add FS from panda
2022-03-08 17:44:59 -08:00
Andrew FerlitschandGitHub d3dc8aeb9a fix: missing create dataset schema (#371)
* fix: missing dataset create

* fix: missing dataset create
2022-03-07 11:53:39 -08:00
WhiteSource RenovateandGitHub a07d762934 chore(deps): update dependency nbqa to v1.3.0 (#368) 2022-03-07 09:53:42 -06:00
Andrew FerlitschandGitHub 85ac9e127d update: v1 (#366)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* update: v1

* update: v1
2022-03-04 17:47:56 -08:00
Gal ZahaviandGitHub 011c2823ff Update CODEOWNERS (#361) 2022-03-04 22:43:10 +02:00
Karl WeinmeisterandGitHub f28a94f03f docs: Add visualization of repo structure to README.md (#364) 2022-03-04 12:46:26 -06:00
5ecfc80cb9 Adds minor changes(license year and clean-up step) to Sdk automl video action recognition batch notebook (#355)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

* updates the license year to 2022 and simplifies the lean-up step for bucket created

* ran linter test

* removes the file from the community folder

* adds the TESTING env condition while deleting the buckets

* ran linter test successfully

* adds TESTING env condition while deleting the bucket

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-04 12:44:39 -06:00
Andrew FerlitschandGitHub e5e36ba050 fix: upgrades to v1 (#360)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 20:05:36 -08:00
Andrew FerlitschandGitHub 0ad9116d6a fix: v1 upgrades (#359)
* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 17:49:45 -08:00
0516032443 Update CODEOWNERS (#354)
* Update CODEOWNERS

* Update CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:23:19 -06:00
95d211c90f Fixing minor issues in sdk_automl_text_entity_extraction_online.ipynb (#329)
* modified colab,github,vertexAI links and added vertex logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:17:48 -06:00
12d6a75ef7 Fixing minor issues in sdk_automl_video_object_tracking_batch.ipynb (#328)
* changed master to main for links and added vertex AI logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:07:50 -06:00
Andrew FerlitschandGitHub 06153dc373 Update README.md 2022-03-02 11:45:01 -08:00
Andrew FerlitschandGitHub 02afa91fc3 Ml ops 6v3 (#352)
* fix: eval comp improvement

* fix: eval comp improvement

* feat: add to KFP get started
2022-03-02 10:38:42 -08:00
Karl WeinmeisterandGitHub c8b212789f Revert "ci: Apply filter to format_and_lint_job (#348)" (#351)
This reverts commit 95256d3fcf.
2022-03-02 09:44:03 -06:00
Karl WeinmeisterandGitHub 95256d3fcf ci: Apply filter to format_and_lint_job (#348)
* ci: Apply filter to format_and_lint_job

Only run when PR contains a notebook file

* Minor fix
2022-03-02 09:29:38 -06:00
Karl WeinmeisterandGitHub 8a6d174c99 Create README.md for notebooks folder 2022-03-01 19:44:41 -06:00
WhiteSource RenovateandGitHub d36cf7f662 chore(deps): update actions/setup-python action to v3 (#337) 2022-03-01 19:04:32 -06:00
WhiteSource RenovateandGitHub 1b02a542c8 chore(deps): update actions/checkout action to v3 (#347) 2022-03-01 19:02:39 -06:00
Ivan CheungandGitHub 45430bb010 Fixed minor issues (#345) 2022-03-01 14:56:50 -06:00
Ivan CheungandGitHub be2a139ade Delete notebooks/community/feature_store/assets directory 2022-02-28 20:21:17 -05:00
70d77b24f6 feature store e2e with assets (#343)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)

* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>

* Added files in their old folder

* Deleted unneeded file

* Ran linter

* Fixed CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-28 19:23:15 -05:00
Ivan CheungandGitHub 50c25d6d7b Revert "A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)" (#338)
This reverts commit 5bcdc0bc64.
2022-02-28 11:01:39 -05:00
5bcdc0bc64 A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-28 07:47:26 -08:00
eff0f95b58 Automl links fix (#330)
* fixing links to open notebook - main and images

* linter test changes

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:57:25 -06:00
50b53d31bd Jfacevedo endpoints tfhub obj detect (#319)
* Deploying TF Hub object detection model using Vertex endpoints

* Add user to codeowners

* fix path in CODEOWNERS

* clear all outputs

* run linter

* manual lint fix

* fix more linting errors

* order imports in alphabetical order

* run linter

* made changes requested on feedback

* automate fetching endpoint model id

* fix hardcoded value in bash command

* generalize region endpoint and project in bash cell

* retrieve endpoint and model ids programatically

* fix formatting

* run linter

* Remove pipfile

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:55:54 -06:00
Andrew FerlitschandGitHub b5a56852f3 fix: automl eval component improvement (#333)
* fix: eval comp improvement

* fix: eval comp improvement
2022-02-25 12:07:06 -08:00
b7486e34ad Sdk automl video action recognition batch (#310)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 11:31:19 -06:00
3edc5f1425 Notebook template (#326)
* modified vertex AI link

* minor change

* changed master to main and added vertex logo

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 10:16:34 -06:00
65b4b73cb5 Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook (#288)
* Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook.ipynb

* format with linter

* add import for tensorflow when in the testing environment

* linter

* fix dependency issues for testing env

* address comments

* eval component  does not output gcp_resources yet, still in experimental

* added location to aip.init

* add deletion for model and batch prediction jobs

* typo, missed a comma.

* linter

* Remove tensorflow import + use gsutil to check if artifacts exist.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 15:36:35 -08:00
Ivan CheungandGitHub 186c08e8c3 Update sdk_matching_engine_for_indexing.ipynb 2022-02-24 17:47:53 -05:00
Ivan CheungandGitHub 7721aa0def Added matching engine with SDK notebook (#327)
* Matching engine

* Added notebook

* Updated CODEOWNERS

* Fixed links

* Added logo

* Renamed Workbench
2022-02-24 14:57:16 -05:00
4987c60e03 updating gcloud usage because a flag was renamed (#320)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 09:33:33 -06:00
Andrew FerlitschandGitHub cd845f7fdd feat: start on model eval notebook (#325)
* fix: bqml export format

* fix: bqml export format

* feat: start on custom model eval

* feat: start on custom model eval
2022-02-23 12:56:01 -08:00
Andrew FerlitschandGitHub 9e84d9e782 fix: bqml doc for exporting model (#324)
* fix: bqml export format

* fix: bqml export format
2022-02-23 12:44:43 -08:00
nayaknishantandGitHub 23c7fcc97f fix: changed bucket URL from pantheon to console (#323)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console
2022-02-23 13:17:12 -06:00
e4024efbc7 feat: add community notebook for Vertex AI SDK Feature Store with Pandas (#311)
* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* fix: lint

* fix: addressed feedback

* fix: format

* fix: lint

* Linted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-23 10:22:28 -08:00
Ivan CheungandGitHub c4d53108af Matching Engine: Updated location for data (#322)
Switched to gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5
2022-02-23 12:03:48 -05:00
be8fe3564d Sdk automl video classification batch (#295)
* notebook refresh from vertex ai sdk project batch 1

* successfully ran linter test

* removed global variable import file

* update with linter test changes

* removing community version of dk_automl_video_classification_batch.ipynb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:11:42 -08:00
1f95775057 Sdk automl text entity extraction online (#283)
* added notebook

* ran linter

* fix aip not defined error

* ran lint

* resolved git comments

* ran linter

* deleted file in community folder and removed globals

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:07:55 -08:00
f2a4dd875e Sdk automl video object tracking batch (#281)
* added notebook

* changed folder

* reinstalled linter

* ran linter

* pulled new changes and merged

* resolved comments

* resolved comments

* ran linter

* deleted file in community folder and removed globals in file

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-22 21:06:52 -08:00
Aaron DietzandGitHub 67dd2300c8 updating text (#309) 2022-02-22 17:17:00 -05:00
Aaron DietzandGitHub b5391b06b4 Pricing optimization update (#308)
* updating text

* rename

* rename
2022-02-22 17:13:16 -05:00
Aaron DietzandGitHub 54f2c71c13 updating text (#307) 2022-02-22 16:51:54 -05:00
Aaron DietzandGitHub 6697900126 updating text (#306) 2022-02-22 16:39:46 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
9ff3400b44 build(deps): bump tensorflow (#316)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 13:01:06 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
3ff0726ebf build(deps): bump tensorflow (#315)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 08:54:19 -06:00
Amy WuandGitHub c96c939dfe Fix RL samples (#270)
* Update step_by_step sample

* Update mlops sample and fix worker_pool_specs issue for thr trainer component

* Fix lint

* Fix lint

* Fix lint

* Fix import order

* Fix nbfmt

* Update component.yaml

* Format notebook

* Update component.yaml url

* Lint
2022-02-17 16:37:52 -08:00
719cf280c9 Updating markdown text to meet higher standard (#305)
* Updating markdown text to meet higher standard

* formatted nb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-17 17:45:15 -06:00
4ec6e2df04 [community-content] PyTorch on Google Cloud Vertex AI - Fixes based on feedback (#290)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

* PyTorch on Vertex - fixes based on review

* PyTorch on Vertex - linter fixes

* PyTorch on Vertex - fixes based on feedback

* PyTorch on Vertex - fixes based on feedback

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 17:41:48 -06:00
031a9190c3 automl-tabular-classification.ipynb: Added missing code and removed unneeded text (#255)
* Added missing code and removed unneeded text

* Ran linter

* Ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 08:03:16 -08:00
5204dcf327 update training and batch predict notebook with importer (#303)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:56 -08:00
cad623ef84 update hp tuning sample to use importer (#302)
* update hp tuning sample to use importer

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:23 -08:00
a59f58f8b6 Use importer for the bqml (#299)
* Use importer for the bqml

* Update get_started_with_bqml_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:00:44 -08:00
nayaknishantandGitHub d89c613f5d moving REGION up (#300)
* moving REGION up

* moving REGION up and csv file name
2022-02-16 17:11:46 -08:00
Andrew FerlitschandGitHub fa265ddb2f feat: fix for sklearn XAI (#301)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1

* fix: XAI for sklearn

* fix: XAI for sklearn
2022-02-16 17:00:16 -08:00
ec3dd04935 SDK Featurestore notebook (#284)
* SDK Featurestore notebook

* fixed issues, tried to make notebook more readable, style

* removed previous notebook

* moved sdk-feature-store to community (for now)

* made fixes

* moved BQ output table cells down

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-02-16 16:04:43 -08:00
Andrew FerlitschandGitHub 0c83e81410 fix: 0.3.0 breaking change 2022-02-16 14:13:57 -08:00
Andrew FerlitschandGitHub 7808a843cc fix: breaking 0.3.0 change 2022-02-16 14:02:36 -08:00
Andrew FerlitschandGitHub 615d7706af fix: breaking change in 0.3.0 2022-02-16 13:53:35 -08:00
Ivan CheungandGitHub f05ca4d06a Added project to BQ client instantiation (#285) 2022-02-16 16:27:08 -05:00
Andrew FerlitschandGitHub cb4145e2b6 test: fix for testing (#298)
* test: fixes for testing

* test: fixes for testing
2022-02-16 11:23:45 -08:00
6917c9aa7b adding initial sample notebook for Tensorboard (#286)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 09:45:01 -08:00
Andrew FerlitschandGitHub c1d2451656 feat: update to v1 (#294)
* feat: update to v1

* feat: update to v1

* feat: update to v1

* feat: update to v1
2022-02-16 09:35:41 -08:00
Ivan CheungandGitHub c41ec1fabd Cleaned up cleanup section (#291) 2022-02-16 10:28:42 -05:00
Ivan CheungandGitHub 273c91882e Delete setup_env.md 2022-02-15 20:45:06 -05:00
Ivan CheungandGitHub ad6b5e5830 Update test_notebook_vm.txt 2022-02-15 18:17:11 -05:00
Ivan CheungandGitHub d441eb9d7a Update test_notebook_vm.txt 2022-02-15 18:14:37 -05:00
Andrew FerlitschandGitHub 139d805c9f feat: update to v1 (#292)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1
2022-02-15 11:20:22 -08:00
Andrew FerlitschandGitHub 783347fc8e feat: update FS notebook to use SDK (#287)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK
2022-02-14 13:21:28 -08:00
6d722d081d Fix links (#274)
* Fixes and renames link to launch automl-text-classification.pynb in Vertex AI Workbench

* Fixes and renames link to launch sdk_automl_tabular_forecasting_batch.pynb in Vertex AI Workbench

* Fixes links for launching notebook in Vertex AI Workbench for Explainable AI samples

* Fixes link for launching notebook in Vertex AI Workbench for model monitoring sample

* Fixes links to launch pipelines notebook samples

* Fixed lint problem in automl-text-classification.ipynb

* Autofixed lint errors

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-14 11:48:41 -05:00
Andrew FerlitschandGitHub 33a8c6ca0e feat: add create component example (#279)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example
2022-02-10 14:23:22 -08:00
Karl WeinmeisterandGitHub ae043400f5 Add survey to README.md (#272) 2022-02-10 14:52:33 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
e41f96b31f build(deps): bump tensorflow (#275)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:37:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
7220f15158 build(deps): bump tensorflow (#276)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:33:59 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
b8d7eaa767 build(deps): bump tensorflow (#278)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:31:20 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a612b463a8 build(deps): bump tensorflow (#277)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-10 09:16:10 -06:00
Andrew FerlitschandGitHub 493e7e81b5 Update README.md 2022-02-09 10:19:58 -08:00
Andrew FerlitschandGitHub b6cf0dbefd feat: XAI with sklearn (#273)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn
2022-02-09 10:17:16 -08:00
Brian KangandGitHub 5d5c08f9e7 Pytorch lightning sdk example - Missed Notebook added (#269)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Revert "Adjust Tensorboard to TensorBoard"

This reverts commit 9aac52e358b4ccc27a9a5a9e3bc5ef3305553462.

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard and and run lint
2022-02-08 16:36:30 -08:00
Andrew FerlitschandGitHub bfdfac0f81 feat: XAI notebook (#271)
* feat: get started XAI

* feat: get started XAI
2022-02-08 14:13:05 -08:00
Andrew FerlitschandGitHub 9c72b7e3e7 Update README.md 2022-02-08 12:57:22 -08:00
Andrew FerlitschandGitHub 46519e5c64 Update README.md 2022-02-08 12:26:57 -08:00
Brian KangandGitHub 0ff961e203 Pytorch lightning sdk example (#268)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model
2022-02-07 17:36:40 -08:00
Andrew FerlitschandGitHub cbc17c6832 feat: use gcsfuse (#265)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU

* feat: use gcsfuse

* feat: use gcsfuse
2022-02-04 11:17:51 -08:00
Andrew FerlitschandGitHub 93e5b15cba Update README.md 2022-02-04 11:09:31 -08:00
Andrew FerlitschandGitHub 081e65d076 Update README.md 2022-02-04 10:09:45 -08:00
Ivan CheungandGitHub 4ab2cfb713 feat: Added test_notebook_vm.txt to only test fast-running notebooks. Also fix private_pool not being used for tests. (#248)
* feat: Added test_notebook_vm.txt

* Propagate private pool to child builds

* Fixed workerpool issue

* Removed private pool requirement

* Added default pool

* Fixed private pool region issue

* Added comment

* Made private_pool_id arg optionally present

* Fixed when private pool is optional

* Fix regional issue bug

* Fixed pandas requirement

* Removed flaky notebook
2022-02-03 15:48:40 -05:00
Andrew FerlitschandGitHub a73335c0af feat: add batch and TPU (#262)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU
2022-02-02 17:45:31 -08:00
0f3e257773 Pricingoptimization (#249)
* added notebook

* ran lint

* updated main

* ran lint

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-02 13:25:41 -05:00
Andrew FerlitschandGitHub 57d734d84f fix: spelling (#260)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling
2022-02-01 17:07:10 -08:00
Andrew FerlitschandGitHub 07f2e9c999 Update README.md 2022-02-01 12:15:31 -08:00
Andrew FerlitschandGitHub 401883cae3 feat: add R notebook (#259)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook
2022-02-01 12:11:26 -08:00
7bc92e1e3c Update google_cloud_pipeline_components_automl_images.ipynb (#252)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-02-01 13:33:22 -06:00
de5f8b0653 Removed unneeded lines in linter (#257)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-01 12:19:19 -05:00
cfa73ed53b chore(deps): update dependency black to v22 (#254)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-31 13:50:57 -06:00
Andrew FerlitschandGitHub 67370bb1c7 Update README.md 2022-01-31 10:39:28 -08:00
Andrew FerlitschandGitHub f60593255a feat: add Pytorch notebook (#256)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook
2022-01-31 10:38:28 -08:00
Andrew FerlitschandGitHub c6f9b97615 test: rm caching of components (#247)
* fix: testing

* fix: testing

* fix: not installing pandas
2022-01-31 13:33:18 -05:00
Andrew FerlitschandGitHub 6161a394c2 fix: predict on exported BQML model (#250)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML
2022-01-27 10:35:20 -08:00
ivanmkc b35cd42015 Added exception check for deletion method 2022-01-27 11:54:29 -05:00
Ivan CheungandGitHub 5e323993db [WIP] Relax requirements for DLVM's (#238)
* Update requirements.txt

* Relax all CI requirements
2022-01-26 16:47:09 -05:00
Andrew FerlitschandGitHub f1623e419e Update README.md 2022-01-26 12:10:16 -08:00
Andrew FerlitschandGitHub a3047fb1bb feat: xgboost notebook (#246)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training
2022-01-26 12:09:07 -08:00
Karl WeinmeisterandGitHub b4d02f486e Update CODEOWNERS with new community blog post (#244) 2022-01-26 09:16:48 -08:00
9e24893b9b feat: Add sentiment analysis notebook (#195)
* added notebook

* ran lint

* resolved comments

* ran lint

* resolved comments

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-26 08:56:40 -06:00
47dec6ecef chore(deps): update dependency pyupgrade to v2.31.0 (#241)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:53:32 -06:00
059fea672c chore(deps): update dependency nbqa to v1.2.3 (#240)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:49:47 -06:00
389e804426 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#236)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:46:09 -06:00
Andrew FerlitschandGitHub 087a638c18 Update README.md 2022-01-25 22:16:55 -08:00
Andrew FerlitschandGitHub 97757c74ca feat: sklearn training (#243)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn
2022-01-25 22:15:51 -08:00
Andrew FerlitschandGitHub 08f3ad583b feat: finish hpt components notebook (#239)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook
2022-01-25 10:02:28 -08:00
Karl WeinmeisterandGitHub 16f01d31d3 chore: Update notebook template license date to 2022 (#237)
* chore: Update notebook template license date to 2022

* chore: Add extra space to address lint error
2022-01-25 11:20:00 -06:00
e0f6c66351 chore(deps): update dependency pandas to v1.4.0 (#233)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-24 13:58:50 -06:00
Ivan CheungandGitHub 3733b28772 Updated requirements (#235) 2022-01-24 14:54:31 -05:00
24f8912134 feat: Add inventory prediction notebook (#216)
* made changes

* made changes

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-24 14:07:42 -05:00
WhiteSource RenovateandGitHub cdc8847f9b chore(deps): update dependency papermill to v2.3.4 (#234) 2022-01-24 10:46:31 -06:00
Andrew FerlitschandGitHub 25bd4b9eb5 Update README.md 2022-01-21 19:05:35 -08:00
Andrew FerlitschandGitHub d476191252 feat: add notebooks (#232)
* feat: friday update

* feat: friday update
2022-01-21 17:14:31 -08:00
nicainandGitHub bf35d6a07c Add metadata to hide cells (#226) 2022-01-21 14:57:24 -08:00
5378d38a05 chore(deps): update dependency ipython to v8.0.1 (#222)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-21 11:15:14 -06:00
Ivan CheungandGitHub 85984f1173 Fixed broken Colab link 2022-01-20 17:52:56 -05:00
Ivan CheungandGitHub 92bb40349f Cleaned up cloud build by renaming files and moving methods around (#219)
* Cleaned up cloud build

* Fixed bug

* More renaming and comment cleanup

* Added helper file

* Fixed missing return
2022-01-20 15:55:38 -05:00
Rajesh ThallamandGitHub fcee9bf738 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#227)
* PyTorch on Vertex - Adding pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook, clearing outputs

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - reverting serving Dockerfile changes

* PyTorch on Vertex - linting fixes

* PyTorch on Vertex - updates to README

* PyTorch on Vertex - linter related fixes
2022-01-20 13:20:00 -06:00
nicainandGitHub cc2f3408ad Update Run After --> Run Selected Cell and All Below (#228) 2022-01-20 08:07:31 -06:00
nicainandGitHub 89fb218041 Alphafold on gcp tutorial (#221)
* Original alphafold Dockerfile and notebook as a starting point

* Migrate dependencies from notebook into Dockerfile

* adding build_docker.sh script for building docker image

* remove cell, and replace with accelerator configuration cell. Also remove dependency on google.colab

* dockerfile remove redundant

* Changing text in launch button

* add vertexai.png

* update notebook, including permalink to vertexai.png

* updating notebook markdown and correcting the vertexai.png image display

* add div brackets and fix broken launch link

* table instead of div

* width=40

* resizing vertexai image

* updated FAQ

* updated Licence

* add back in the output_file zip

* launch button at top of notebook

* default workdir aligned with JuptyerLab home directory

* intro paragraph

* update CPU instructions

* exchange notebook title and launch header

* Dockerfile license

* collapsing cells

* splitting out sequences into un-collapsed cell

* Update licence

* update download instructions text

* Remove "double-click" text

* hide cells

* Increasing indent to pass linting for alphafold_on_gcp (#224)

* increasing indent to pass linting

* more linting

* wild

* AMBER relaxation f-string

* hidden cells

* wild commit

* move links to main
2022-01-19 18:47:21 -08:00
Andrew FerlitschandGitHub 4d0c3781e5 Update README.md 2022-01-19 12:30:01 -08:00
Andrew FerlitschandGitHub e2e319ac7f Update README.md 2022-01-19 11:08:55 -08:00
Andrew FerlitschandGitHub 63508cad3f feat: add ml metadata notebook (#223)
* weekly updates

* weekly updates

* feat: add metadata notebook

* feat: add metadata notebook
2022-01-19 10:58:03 -08:00
0b6eb6eed1 Updates to automl tabular beans pipeline (#220)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-18 15:34:57 -06:00
Polong LinandGitHub a41cfdeba5 Fix typo: Wikepedia --> Wikipedia (#217) 2022-01-18 08:28:04 -06:00
7a6763ca33 chore(deps): update dependency numpy to v1.22.1 (#214)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 17:10:52 -06:00
Sara RobinsonandGitHub 2a6e19e4f9 Update MLMD notebook to use pipeline submit() method (#215) 2022-01-14 17:09:45 -06:00
9f9526b722 Delete Dockerfile (#198)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 14:28:30 -05:00
Ivan CheungandGitHub 267684b7c3 Added private pool to cloud build config (#211) 2022-01-14 14:27:34 -05:00
Andrew FerlitschandGitHub b74dd3d576 Update README.md 2022-01-13 16:22:14 -08:00
Andrew FerlitschandGitHub 278ae48842 Update README.md 2022-01-13 16:21:28 -08:00
Andrew FerlitschandGitHub 189ca12627 Update README.md 2022-01-13 16:20:39 -08:00
Andrew FerlitschandGitHub 5108f57ba8 feat: weekly updates (#212)
* weekly updates

* weekly updates
2022-01-13 16:19:21 -08:00
154 changed files with 48229 additions and 5194 deletions
-194
View File
@@ -1,194 +0,0 @@
# Copyright 2020 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
# We want to use LTS ubuntu from our mirror because dockerhub has a
# rate limit.
# FROM mirror.gcr.io/library/ubuntu:18.04
# However, now the above image is not working, we're using our own cache
FROM gcr.io/cloud-devrel-kokoro-resources/ubuntu:20.04
ENV DEBIAN_FRONTEND noninteractive
# Ensure local Python is preferred over distribution Python.
ENV PATH /usr/local/bin:$PATH
# http://bugs.python.org/issue19846
# At the moment, setting "LANG=C" on a Linux system fundamentally breaks
# Python 3.
ENV LANG C.UTF-8
# Install dependencies.
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
apt-transport-https \
build-essential \
ca-certificates \
curl \
dirmngr \
git \
gcc \
gpg-agent \
graphviz \
libbz2-dev \
libdb5.3-dev \
libexpat1-dev \
libffi-dev \
liblzma-dev \
libmagickwand-dev \
libmemcached-dev \
libpython3-dev \
libreadline-dev \
libsnappy-dev \
libssl-dev \
libsqlite3-dev \
portaudio19-dev \
pkg-config \
redis-server \
software-properties-common \
ssh \
sudo \
systemd \
tcl \
tcl-dev \
tk \
tk-dev \
uuid-dev \
wget \
zlib1g-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install docker
RUN curl -fsSL https://download.docker.com/linux/ubuntu/gpg | sudo apt-key add -
RUN add-apt-repository \
"deb [arch=amd64] https://download.docker.com/linux/ubuntu \
$(lsb_release -cs) \
stable"
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
docker-ce \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Bazel for compiling Tink in Cloud SQL Client Side Encryption Samples
# TODO: Delete this section once google/tink#483 is resolved
RUN apt install -y curl gpgconf gpg \
&& curl -fsSL https://bazel.build/bazel-release.pub.gpg | gpg --dearmor > bazel.gpg \
&& mv bazel.gpg /etc/apt/trusted.gpg.d/ \
&& echo "deb [arch=amd64] https://storage.googleapis.com/bazel-apt stable jdk1.8" | sudo tee /etc/apt/sources.list.d/bazel.list \
&& apt update && apt install -y bazel \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Microsoft ODBC 17 Driver and unixodbc for testing SQL Server samples
RUN curl https://packages.microsoft.com/keys/microsoft.asc | apt-key add - \
&& curl https://packages.microsoft.com/config/ubuntu/20.04/prod.list > /etc/apt/sources.list.d/mssql-release.list \
&& apt-get update \
&& ACCEPT_EULA=Y apt-get install -y --no-install-recommends \
msodbcsql17 \
unixodbc-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
COPY fetch_gpg_keys.sh /tmp
# Install the desired versions of Python.
RUN set -ex \
&& export GNUPGHOME="$(mktemp -d)" \
&& echo "disable-ipv6" >> "${GNUPGHOME}/dirmngr.conf" \
&& /tmp/fetch_gpg_keys.sh \
&& for PYTHON_VERSION in 2.7.18 3.6.13 3.7.10 3.8.8 3.9.2; do \
wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz" \
&& wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz.asc "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz.asc" \
&& gpg --batch --verify python-${PYTHON_VERSION}.tar.xz.asc python-${PYTHON_VERSION}.tar.xz \
&& rm -r python-${PYTHON_VERSION}.tar.xz.asc \
&& mkdir -p /usr/src/python-${PYTHON_VERSION} \
&& tar -xJC /usr/src/python-${PYTHON_VERSION} --strip-components=1 -f python-${PYTHON_VERSION}.tar.xz \
&& rm python-${PYTHON_VERSION}.tar.xz \
&& cd /usr/src/python-${PYTHON_VERSION} \
&& ./configure \
--enable-shared \
# This works only on Python 2.7 and throws a warning on every other
# version, but seems otherwise harmless.
--enable-unicode=ucs4 \
--with-system-ffi \
--without-ensurepip \
&& make -j$(nproc) \
&& make install \
&& ldconfig \
; done \
&& rm -rf "${GNUPGHOME}" \
&& rm -rf /usr/src/python* \
&& rm -rf ~/.cache/
# Install pip on Python 3.6 only.
# If the environment variable is called "PIP_VERSION", pip explodes with
# "ValueError: invalid truth value '<VERSION>'"
ENV PYTHON_PIP_VERSION 20.2.4
RUN wget --no-check-certificate -O /tmp/get-pip.py 'https://bootstrap.pypa.io/get-pip.py' \
&& python3.6 /tmp/get-pip.py "pip==$PYTHON_PIP_VERSION" \
# we use "--force-reinstall" for the case where the version of pip we're trying to install is the same as the version bundled with Python
# ("Requirement already up-to-date: pip==8.1.2 in /usr/local/lib/python3.6/site-packages")
# https://github.com/docker-library/python/pull/143#issuecomment-241032683
&& pip3 install --no-cache-dir --upgrade --force-reinstall "pip==$PYTHON_PIP_VERSION" \
# then we use "pip list" to ensure we don't have more than one pip version installed
# https://github.com/docker-library/python/pull/100
&& [ "$(pip list |tac|tac| awk -F '[ ()]+' '$1 == "pip" { print $2; exit }')" = "$PYTHON_PIP_VERSION" ]
# Ensure Pip for python3
RUN python3 /tmp/get-pip.py
RUN rm /tmp/get-pip.py
# Install "virtualenv", since the vast majority of users of this image
# will want it.
RUN pip install --no-cache-dir virtualenv
# Setup Cloud SDK
ENV CLOUD_SDK_VERSION 339.0.0
# Use system python for cloud sdk.
ENV CLOUDSDK_PYTHON python3.6
RUN wget https://dl.google.com/dl/cloudsdk/channels/rapid/downloads/google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN tar xzf google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN /google-cloud-sdk/install.sh
ENV PATH /google-cloud-sdk/bin:$PATH
# Enable redis-server on boot.
RUN sudo systemctl enable redis-server.service
# Create a user and allow sudo
# kbuilder uid on the default Kokoro image
ARG UID=1000
ARG USERNAME=kbuilder
# Add a new user to the container image.
# This is needed for ssh and sudo access.
# Add a new user with the caller's uid and the username.
RUN useradd -d /h -u ${UID} ${USERNAME}
# Allow nopasswd sudo
RUN echo "${USERNAME} ALL=(ALL) NOPASSWD:ALL" >> /etc/sudoers
CMD ["python3.6"]
+25 -22
View File
@@ -1,42 +1,45 @@
from typing import List
from resource_cleanup_manager import (
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
)
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
for manager in managers:
type_name = manager.type_name
for manager in managers:
type_name = manager.type_name
print(f"Fetching {type_name}'s...")
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
print(f"Fetching {type_name}'s...")
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
manager.delete(resource)
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
try:
manager.delete(resource)
except Exception as exception:
print(exception)
print("")
print("")
is_dry_run = False
if is_dry_run:
print("Starting cleanup in dry run mode...")
print("Starting cleanup in dry run mode...")
# List of all cleanup managers
managers = [
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
]
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
+107
View File
@@ -0,0 +1,107 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
import argparse
import pathlib
import execute_changed_notebooks_helper
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--private_pool_id",
type=str,
help="The private pool id.",
required=False,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
)
execute_changed_notebooks_helper.process_and_execute_notebooks(
notebooks=notebooks,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
private_pool_id=args.private_pool_id if not "default" else None,
should_parallelize=args.should_parallelize,
)
@@ -13,7 +13,6 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import concurrent
import dataclasses
import datetime
@@ -32,17 +31,6 @@ from utils import util, NotebookProcessors
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
def format_timedelta(delta: datetime.timedelta) -> str:
"""Formats a timedelta duration to [N days] %H:%M:%S format"""
seconds = int(delta.total_seconds())
@@ -115,12 +103,13 @@ def _create_tag(filepath: str) -> str:
return tag
def execute_notebook(
def process_and_execute_notebook(
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
notebook: str,
should_get_tail_logs: bool = False,
) -> NotebookExecutionResult:
@@ -162,6 +151,8 @@ def execute_notebook(
notebook_output_uri=notebook_output_uri,
container_uri=container_uri,
tag=tag,
region=variable_region,
private_pool_id=private_pool_id,
)
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
@@ -202,41 +193,13 @@ def execute_notebook(
return result
def run_changed_notebooks(
def get_changed_notebooks(
test_paths_file: str,
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
should_parallelize: bool,
base_branch: Optional[str] = None,
):
) -> List[str]:
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
Get the notebooks that exist under the folders defined in the test_paths_file.
It only returns notebooks that have differences from the Git base_branch.
"""
test_paths = []
@@ -266,6 +229,45 @@ def run_changed_notebooks(
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
return notebooks
def process_and_execute_notebooks(
notebooks: List[str],
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
private_pool_id: Optional[str],
should_parallelize: bool,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
It only runs notebooks that have differences from the Git base_branch.
The executed notebooks are saved in the artifacts_bucket.
Variables are also injected into the notebooks such as the variable_project_id and variable_region.
Args:
test_paths_file (str):
Required. The new-line delimited file to folders and files that need checking.
Folders are checked recursively.
base_branch (str):
Optional. If provided, only the files that have changed from the base_branch will be checked.
If not provided, all files will be checked.
staging_bucket (str):
Required. The GCS staging bucket to write source code to.
artifacts_bucket (str):
Required. The GCS staging bucket to write executed notebooks to.
variable_project_id (str):
Required. The value for PROJECT_ID to inject into notebooks.
variable_region (str):
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
"""
notebook_execution_results: List[NotebookExecutionResult] = []
if len(notebooks) > 0:
@@ -279,24 +281,26 @@ def run_changed_notebooks(
notebook_execution_results = list(
executor.map(
functools.partial(
execute_notebook,
process_and_execute_notebook,
container_uri,
staging_bucket,
artifacts_bucket,
variable_project_id,
variable_region,
private_pool_id,
),
notebooks,
)
)
else:
notebook_execution_results = [
execute_notebook(
process_and_execute_notebook(
container_uri=container_uri,
staging_bucket=staging_bucket,
artifacts_bucket=artifacts_bucket,
variable_project_id=variable_project_id,
variable_region=variable_region,
private_pool_id=private_pool_id,
notebook=notebook,
)
for notebook in notebooks
@@ -341,67 +345,3 @@ def run_changed_notebooks(
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
run_changed_notebooks(
test_paths_file=args.test_paths_file,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
should_parallelize=args.should_parallelize,
base_branch=args.base_branch,
)
+6 -4
View File
@@ -13,10 +13,12 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import ExecuteNotebook
"""A CLI to download (optional) and run a single notebook locally"""
parser = argparse.ArgumentParser(description="Run changed notebooks.")
import argparse
import execute_notebook_helper
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
parser.add_argument(
"--notebook_source",
type=str,
@@ -31,7 +33,7 @@ parser.add_argument(
)
args = parser.parse_args()
ExecuteNotebook.execute_notebook(
execute_notebook_helper.execute_notebook(
notebook_source=args.notebook_source,
output_file_or_uri=args.output_file_or_uri,
should_log_output=True,
@@ -13,6 +13,8 @@
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook locally"""
import sys
import os
import errno
@@ -30,6 +32,7 @@ def execute_notebook(
output_file_or_uri: str,
should_log_output: bool,
):
"""Execute a single notebook using Papermill"""
file_name = os.path.basename(os.path.normpath(notebook_source))
# Download notebook if it's a GCS URI
+42 -13
View File
@@ -1,3 +1,21 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook on Google Cloud Build"""
from re import sub
from google.protobuf import duration_pb2
from yaml.loader import FullLoader
@@ -9,10 +27,12 @@ from typing import Optional
import yaml
from google.cloud.aiplatform import utils
from google.api_core import operation
from google.api_core import operation, client_options
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
TIMEOUT_IN_SECONDS = 86400
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
def execute_notebook_remote(
@@ -20,20 +40,12 @@ def execute_notebook_remote(
notebook_uri: str,
notebook_output_uri: str,
container_uri: str,
region: str,
private_pool_id: Optional[str],
tag: Optional[str],
) -> operation.Operation:
"""Create and execute a simple Google Cloud Build configuration,
print the in-progress status and print the completed status."""
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient()
build = cloudbuild_v1.Build()
# The following build steps will output "hello world"
# For more information on build configuration, see
# https://cloud.google.com/build/docs/configuring-builds/create-basic-configuration
"""Create and execute a single notebook on Google Cloud Build"""
# Load build steps from YAML
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
substitutions = {
@@ -42,6 +54,23 @@ def execute_notebook_remote(
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
}
build = cloudbuild_v1.Build()
options: Optional[client_options.ClientOptions] = None
if private_pool_id:
substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
build.options = cloudbuild_config["options"]
# Switch to the regional endpoint of the pool
options = client_options.ClientOptions(
api_endpoint=f"{region}-{SERVICE_BASE_PATH}"
)
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
(
source_archived_file_gcs_bucket,
source_archived_file_gcs_object,
@@ -26,3 +26,6 @@ steps:
env:
- 'IS_TESTING=1'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
@@ -5,10 +5,6 @@ steps:
args:
- -c
- 'gcloud config list'
# # Clone the Git repo
# - name: ${_PYTHON_IMAGE}
# entrypoint: git
# args: ['clone', "${_GIT_REPO}", "--branch", "${_GIT_BRANCH_NAME}", "."]
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
@@ -28,11 +24,15 @@ steps:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
# Install Python dependencies and run testing script
# TODO: Only pass in private_pool_id if it is set
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`'
env:
- 'IS_TESTING=1'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
+7 -7
View File
@@ -1,10 +1,10 @@
ipython==8.0.0
jupyter==1.0.0
nbconvert==6.4.0
papermill==2.3.3
numpy==1.22.0
pandas==1.3.5
matplotlib==3.5.1
ipython
numpy
jupyter
nbconvert
papermill
pandas
matplotlib
tabulate
google-cloud-aiplatform
google-cloud-storage
+5
View File
@@ -0,0 +1,5 @@
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/matching_engine/intro-swivel.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
+2 -2
View File
@@ -11,7 +11,7 @@ import uuid
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
"""Copies a remote GCS file to a local path."""
"""Copies a remote GCS file to a local path"""
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
subprocess.check_output(
@@ -25,7 +25,7 @@ def upload_file(
local_file_path: str,
remote_file_path: str,
) -> str:
"""Copies a local file to a GCS path."""
"""Copies a local file to a GCS path"""
subprocess.check_output(
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
)
+2 -2
View File
@@ -7,9 +7,9 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Set up Python
uses: actions/setup-python@v2
uses: actions/setup-python@v3
- name: Fetch pull request branch
uses: actions/checkout@v2
uses: actions/checkout@v3
with:
fetch-depth: 0
- name: Fetch base main branch
+3 -3
View File
@@ -2,8 +2,8 @@ git+https://github.com/tensorflow/docs
ipython
jupyter
nbconvert
black==21.10b0
pyupgrade==2.29.1
black==22.1.0
pyupgrade==2.31.1
isort==5.10.1
flake8==4.0.1
nbqa==1.2.2
nbqa==1.3.1
+4 -4
View File
@@ -84,19 +84,19 @@ if [ ${#notebooks[@]} -gt 0 ]; then
FLAKE8_RTN=$?
else
echo "Running black..."
python3 -m nbqa black "$notebook" --nbqa-mutate
python3 -m nbqa black "$notebook"
BLACK_RTN=$?
echo "Running pyupgrade..."
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
python3 -m nbqa pyupgrade "$notebook"
PYUPGRADE_RTN=$?
echo "Running isort..."
python3 -m nbqa isort "$notebook" --nbqa-mutate
python3 -m nbqa isort "$notebook"
ISORT_RTN=$?
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
NBFMT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291 --nbqa-mutate
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
FLAKE8_RTN=$?
fi
+17 -1
View File
@@ -6,7 +6,19 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
## Overview
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [Community Content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
## Repository structure
```bash
├── community-content - Sample code and tutorials contributed by the community
├── notebooks
│ ├── community - Notebooks contributed by the community
│ ├── official - Notebooks demonstrating use of each Vertex AI service
│ │ ├── automl
│ │ ├── custom
│ │ ├── ...
```
## Contributing
@@ -19,3 +31,7 @@ Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-sa
## Disclaimer
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
## Feedback
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
+2 -1
View File
@@ -1,4 +1,5 @@
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
@@ -0,0 +1,824 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "pc5-mbsX9PZC"
},
"source": [
"# AlphaFold On Vertex AI Workbench\n",
"\n",
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
"\n",
"## ![](https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/alphafold_on_workbench/vertexai_40.png) [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
"\n",
"**Differences to AlphaFold v2.1.0**\n",
"\n",
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
"\n",
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
"\n",
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
"\n",
"**Citing this work**\n",
"\n",
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
"\n",
"**Licenses**\n",
"\n",
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
"\n",
"\n",
"**More information**\n",
"\n",
"You can find more information about how AlphaFold works in the following papers:\n",
"\n",
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
"\n",
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b7a02613eb1a"
},
"source": [
"## Download AlphaFold Data"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "woIxeCPygt7K"
},
"outputs": [],
"source": [
"import os\n",
"import subprocess\n",
"import sys\n",
"\n",
"import alphafold.common\n",
"import tqdm.notebook\n",
"from IPython.utils import io\n",
"\n",
"TQDM_BAR_FORMAT = (\n",
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
")\n",
"\n",
"SOURCE_URL = (\n",
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
")\n",
"PARAMS_DIR = \"alphafold/data/params\"\n",
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
"\n",
"try:\n",
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" with io.capture_output() as captured:\n",
"\n",
" # Download and store stereo_chemical_props.txt\n",
" !mkdir -p ~/content/alphafold/alphafold/common\n",
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
" pbar.update(18)\n",
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
"\n",
" # Download alphafold_params_colab_2021-10-27.tar\n",
" !mkdir --parents \"{PARAMS_DIR}\"\n",
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
" pbar.update(27)\n",
"\n",
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
" # !rm \"{PARAMS_PATH}\"\n",
" pbar.update(55)\n",
"\n",
"except subprocess.CalledProcessError:\n",
" print(captured)\n",
" raise"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d8926b7d5529"
},
"source": [
"## Configure GPU Acceleration"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "VzJ5iMjTtoZw"
},
"outputs": [],
"source": [
"# Confirm accelerator configuration\n",
"import jax\n",
"\n",
"if jax.local_devices()[0].platform == \"tpu\":\n",
" raise RuntimeError(\n",
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
" )\n",
"elif jax.local_devices()[0].platform == \"cpu\":\n",
" print(\n",
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
" )\n",
"else:\n",
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
"\n",
"# Make sure all necessary environment variables are set.\n",
"import os\n",
"\n",
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "W4JpOs6oA-QS"
},
"source": [
"## Making a prediction\n",
"\n",
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
"\n",
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
"\n",
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
"\n",
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b310d44229d0"
},
"outputs": [],
"source": [
"# Input sequences (type: str)\n",
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
"sequence_2 = \"\"\n",
"sequence_3 = \"\"\n",
"sequence_4 = \"\"\n",
"sequence_5 = \"\"\n",
"sequence_6 = \"\"\n",
"sequence_7 = \"\"\n",
"sequence_8 = \"\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "rowN0bVYLe9n"
},
"outputs": [],
"source": [
"from alphafold.notebooks import notebook_utils\n",
"\n",
"input_sequences = (\n",
" sequence_1,\n",
" sequence_2,\n",
" sequence_3,\n",
" sequence_4,\n",
" sequence_5,\n",
" sequence_6,\n",
" sequence_7,\n",
" sequence_8,\n",
")\n",
"\n",
"# If folding a complex target and all the input sequences are\n",
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
"# otherwise or if the origin is unknown.\n",
"\n",
"is_prokaryote = False # @param {type:\"boolean\"}\n",
"\n",
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
"MAX_MULTIMER_LENGTH = 2500\n",
"\n",
"# Validate the input.\n",
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
" input_sequences=input_sequences,\n",
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "db551d4877ea"
},
"source": [
"## Search against genetic databases\n",
"\n",
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "2tTeTTsLKPjB"
},
"outputs": [],
"source": [
"import collections\n",
"import copy\n",
"import random\n",
"from concurrent import futures\n",
"from urllib import request\n",
"\n",
"import matplotlib.pyplot as plt\n",
"import numpy as np\n",
"import py3Dmol\n",
"from alphafold.common import protein\n",
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
" pipeline_multimer)\n",
"from alphafold.data.tools import jackhmmer\n",
"from alphafold.model import config, data, model\n",
"from alphafold.relax import relax, utils\n",
"from IPython import display\n",
"from ipywidgets import GridspecLayout, Output\n",
"\n",
"# Color bands for visualizing plddt\n",
"PLDDT_BANDS = [\n",
" (0, 50, \"#FF7D45\"),\n",
" (50, 70, \"#FFDB13\"),\n",
" (70, 90, \"#65CBF3\"),\n",
" (90, 100, \"#0053D6\"),\n",
"]\n",
"\n",
"# --- Find the closest source ---\n",
"test_url_pattern = (\n",
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
")\n",
"ex = futures.ThreadPoolExecutor(3)\n",
"\n",
"\n",
"def fetch(source):\n",
" request.urlretrieve(test_url_pattern.format(source))\n",
" return source\n",
"\n",
"\n",
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
"source = None\n",
"for f in futures.as_completed(fs):\n",
" source = f.result()\n",
" ex.shutdown()\n",
" break\n",
"\n",
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
"# The z_value is the number of sequences in a database.\n",
"MSA_DATABASES = [\n",
" {\n",
" \"db_name\": \"uniref90\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 59,\n",
" \"z_value\": 135_301_051,\n",
" },\n",
" {\n",
" \"db_name\": \"smallbfd\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
" \"num_streamed_chunks\": 17,\n",
" \"z_value\": 65_984_053,\n",
" },\n",
" {\n",
" \"db_name\": \"mgnify\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
" \"num_streamed_chunks\": 71,\n",
" \"z_value\": 304_820_129,\n",
" },\n",
"]\n",
"\n",
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
" MSA_DATABASES.extend(\n",
" [\n",
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
" {\n",
" \"db_name\": \"uniprot\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 98,\n",
" \"z_value\": 219_174_961 + 565_254,\n",
" },\n",
" ]\n",
" )\n",
"\n",
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
"\n",
"MAX_HITS = {\n",
" \"uniref90\": 10_000,\n",
" \"smallbfd\": 5_000,\n",
" \"mgnify\": 501,\n",
" \"uniprot\": 50_000,\n",
"}\n",
"\n",
"\n",
"def get_msa(fasta_path):\n",
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
"\n",
" # Run the search against chunks of genetic databases.\n",
" raw_msa_results = collections.defaultdict(list)\n",
" with tqdm.notebook.tqdm(\n",
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
" ) as pbar:\n",
"\n",
" def jackhmmer_chunk_callback(i):\n",
" pbar.update(n=1)\n",
"\n",
" for db_config in MSA_DATABASES:\n",
" db_name = db_config[\"db_name\"]\n",
" pbar.set_description(f\"Searching {db_name}\")\n",
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
" binary_path=JACKHMMER_BINARY_PATH,\n",
" database_path=db_config[\"db_path\"],\n",
" get_tblout=True,\n",
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
" streaming_callback=jackhmmer_chunk_callback,\n",
" z_value=db_config[\"z_value\"],\n",
" )\n",
" # Group the results by database name.\n",
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
"\n",
" return raw_msa_results\n",
"\n",
"\n",
"features_for_chain = {}\n",
"raw_msa_results_for_sequence = {}\n",
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
"\n",
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
" with open(fasta_path, \"wt\") as f:\n",
" f.write(f\">query\\n{sequence}\")\n",
"\n",
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
" if sequence not in raw_msa_results_for_sequence:\n",
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
" else:\n",
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
"\n",
" # Extract the MSAs from the Stockholm files.\n",
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
" single_chain_msas = []\n",
" uniprot_msa = None\n",
" for db_name, db_results in raw_msa_results.items():\n",
" merged_msa = notebook_utils.merge_chunked_msa(\n",
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
" )\n",
" if merged_msa.sequences and db_name != \"uniprot\":\n",
" single_chain_msas.append(merged_msa)\n",
" msa_size = len(set(merged_msa.sequences))\n",
" print(\n",
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
" )\n",
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
" uniprot_msa = merged_msa\n",
"\n",
" notebook_utils.show_msa_info(\n",
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
" )\n",
"\n",
" # Turn the raw data into model features.\n",
" feature_dict = {}\n",
" feature_dict.update(\n",
" pipeline.make_sequence_features(\n",
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
" )\n",
" )\n",
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
" feature_dict.update(\n",
" notebook_utils.empty_placeholder_template_features(\n",
" num_templates=0, num_res=len(sequence)\n",
" )\n",
" )\n",
"\n",
" # Construct the all_seq features only for heteromers, not homomers.\n",
" if (\n",
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
" and len(set(sequences)) > 1\n",
" ):\n",
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
" \"msa_uniprot_accession_identifiers\",\n",
" \"msa_species_identifiers\",\n",
" )\n",
" all_seq_features = {\n",
" f\"{k}_all_seq\": v\n",
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
" if k in valid_feats\n",
" }\n",
" feature_dict.update(all_seq_features)\n",
"\n",
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
"\n",
"\n",
"# Do further feature post-processing depending on the model type.\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
"\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" all_chain_features = {}\n",
" for chain_id, chain_features in features_for_chain.items():\n",
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
" chain_features, chain_id\n",
" )\n",
"\n",
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
"\n",
" np_example = feature_processing.pair_and_merge(\n",
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
" )\n",
"\n",
" # Pad MSA to avoid zero-sized extra_msa.\n",
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9640643486bd"
},
"source": [
"## Run AlphaFold\n",
"\n",
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "XUo6foMQxwS2"
},
"outputs": [],
"source": [
"run_relax = True\n",
"\n",
"# --- Run the model ---\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
"\n",
"output_dir = \"prediction\"\n",
"os.makedirs(output_dir, exist_ok=True)\n",
"\n",
"plddts = {}\n",
"ranking_confidences = {}\n",
"pae_outputs = {}\n",
"unrelaxed_proteins = {}\n",
"\n",
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" for model_name in model_names:\n",
" pbar.set_description(f\"Running {model_name}\")\n",
"\n",
" cfg = config.model_config(model_name)\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" cfg.data.eval.num_ensemble = 1\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" cfg.model.num_ensemble_eval = 1\n",
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
" model_runner = model.RunModel(cfg, params)\n",
" processed_feature_dict = model_runner.process_features(\n",
" np_example, random_seed=0\n",
" )\n",
" prediction = model_runner.predict(\n",
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
" )\n",
"\n",
" mean_plddt = prediction[\"plddt\"].mean()\n",
"\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" if \"predicted_aligned_error\" in prediction:\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
" else:\n",
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
" # should never get selected.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" # Multimer models are sorted by pTM+ipTM.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
"\n",
" # Set the b-factors to the per-residue plddt.\n",
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
" unrelaxed_protein = protein.from_prediction(\n",
" processed_feature_dict,\n",
" prediction,\n",
" b_factors=b_factors,\n",
" remove_leading_feature_dimension=(\n",
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
" ),\n",
" )\n",
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
"\n",
" # Delete unused outputs to save memory.\n",
" del model_runner\n",
" del params\n",
" del prediction\n",
" pbar.update(n=1)\n",
"\n",
" # --- AMBER relax the best model ---\n",
"\n",
" # Find the best model according to the mean pLDDT.\n",
" best_model_name = max(\n",
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
" )\n",
"\n",
" if run_relax:\n",
" pbar.set_description(\"AMBER relaxation\")\n",
" amber_relaxer = relax.AmberRelaxation(\n",
" max_iterations=0,\n",
" tolerance=2.39,\n",
" stiffness=10.0,\n",
" exclude_residues=[],\n",
" max_outer_iterations=3,\n",
" )\n",
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
" prot=unrelaxed_proteins[best_model_name]\n",
" )\n",
" else:\n",
" print(\"Warning: Running without the relaxation stage.\")\n",
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
" pbar.update(n=1) # Finished AMBER relax.\n",
"\n",
"# Construct multiclass b-factors to indicate confidence bands\n",
"# 0=very low, 1=low, 2=confident, 3=very high\n",
"banded_b_factors = []\n",
"for plddt in plddts[best_model_name]:\n",
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
" if plddt >= min_val and plddt <= max_val:\n",
" banded_b_factors.append(idx)\n",
" break\n",
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
"\n",
"\n",
"# Write out the prediction\n",
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
"with open(pred_output_path, \"w\") as f:\n",
" f.write(relaxed_pdb)\n",
"\n",
"\n",
"# --- Visualise the prediction & confidence ---\n",
"show_sidechains = True\n",
"\n",
"\n",
"def plot_plddt_legend():\n",
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
" thresh = [\n",
" \"Very low (pLDDT < 50)\",\n",
" \"Low (70 > pLDDT > 50)\",\n",
" \"Confident (90 > pLDDT > 70)\",\n",
" \"Very high (pLDDT > 90)\",\n",
" ]\n",
"\n",
" colors = [x[2] for x in PLDDT_BANDS]\n",
"\n",
" plt.figure(figsize=(2, 2))\n",
" for c in colors:\n",
" plt.bar(0, 0, color=c)\n",
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
" plt.xticks([])\n",
" plt.yticks([])\n",
" ax = plt.gca()\n",
" ax.spines[\"right\"].set_visible(False)\n",
" ax.spines[\"top\"].set_visible(False)\n",
" ax.spines[\"left\"].set_visible(False)\n",
" ax.spines[\"bottom\"].set_visible(False)\n",
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
" return plt\n",
"\n",
"\n",
"# Show the structure coloured by chain if the multimer model has been used.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" multichain_view = py3Dmol.view(width=800, height=600)\n",
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
" multichain_view.zoomTo()\n",
" multichain_view.show()\n",
"\n",
"# Color the structure by per-residue pLDDT\n",
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
"view = py3Dmol.view(width=800, height=600)\n",
"view.addModelsAsFrames(to_visualize_pdb)\n",
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
"if show_sidechains:\n",
" style[\"stick\"] = {}\n",
"view.setStyle({\"model\": -1}, style)\n",
"view.zoomTo()\n",
"\n",
"grid = GridspecLayout(1, 2)\n",
"out = Output()\n",
"with out:\n",
" view.show()\n",
"grid[0, 0] = out\n",
"\n",
"out = Output()\n",
"with out:\n",
" plot_plddt_legend().show()\n",
"grid[0, 1] = out\n",
"\n",
"display.display(grid)\n",
"\n",
"# Display pLDDT and predicted aligned error (if output by the model).\n",
"if pae_outputs:\n",
" num_plots = 2\n",
"else:\n",
" num_plots = 1\n",
"\n",
"plt.figure(figsize=[8 * num_plots, 6])\n",
"plt.subplot(1, num_plots, 1)\n",
"plt.plot(plddts[best_model_name])\n",
"plt.title(\"Predicted LDDT\")\n",
"plt.xlabel(\"Residue\")\n",
"plt.ylabel(\"pLDDT\")\n",
"\n",
"if num_plots == 2:\n",
" plt.subplot(1, 2, 2)\n",
" pae, max_pae = list(pae_outputs.values())[0]\n",
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
" plt.colorbar(fraction=0.046, pad=0.04)\n",
"\n",
" # Display lines at chain boundaries.\n",
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
" chain_ids = best_unrelaxed_prot.chain_index\n",
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
" if chain_boundary.size:\n",
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
"\n",
" plt.title(\"Predicted Aligned Error\")\n",
" plt.xlabel(\"Scored residue\")\n",
" plt.ylabel(\"Aligned residue\")\n",
"\n",
"# Save the predicted aligned error (if it exists).\n",
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
"if pae_outputs:\n",
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
" with open(pae_output_path, \"w\") as f:\n",
" f.write(pae_data)\n",
"\n",
"!zip -q -r {output_dir}.zip {output_dir}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lUQAn5LYC5n4"
},
"source": [
"### Interpreting the prediction\n",
"\n",
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
"\n",
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jeb2z8DIA4om"
},
"source": [
"## FAQ & Troubleshooting\n",
"\n",
"\n",
"* How do I get a predicted protein structure for my protein?\n",
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
"* How long will this take?\n",
" * The search against genetic databases can take minutes to hours.\n",
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
"* My notebook no longer seems to be doing anything, what should I do?\n",
" * Some steps may take minutes to hours to complete.\n",
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
"* How does this compare to the open-source version of AlphaFold?\n",
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
"* Does this tool install anything on my computer?\n",
" * No, everything happens in the VM instance within your Google Cloud project.\n",
"* How should I share feedback and bug reports?\n",
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
"\n",
"\n",
"## Related work\n",
"\n",
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
"\n",
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "YfPhvYgKC81B"
},
"source": [
"# License and Disclaimer\n",
"\n",
"This is not an officially-supported Google product.\n",
"\n",
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
"\n",
"Copyright 2021 DeepMind Technologies Limited.\n",
"\n",
"\n",
"## AlphaFold Code License\n",
"\n",
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
"\n",
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
"\n",
"## Model Parameters License\n",
"\n",
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
"\n",
"\n",
"## Third-party software\n",
"\n",
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
"\n",
"\n",
"## Mirrored Databases\n",
"\n",
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
]
}
],
"metadata": {
"accelerator": "GPU",
"colab": {
"collapsed_sections": [],
"name": "AlphaFold.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,82 @@
# Copyright 2022 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
ARG CUDA_MAJOR=11
ARG CUDA_MINOR=0
FROM gcr.io/deeplearning-platform-release/base-cu110
ARG CUDA_MAJOR
ARG CUDA_MINOR
SHELL ["/bin/bash", "-c"]
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
build-essential \
cmake \
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
git \
hmmer \
kalign \
tzdata \
wget \
&& rm -rf /var/lib/apt/lists/*
# Compile HHsuite from source.
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
&& mkdir /tmp/hh-suite/build \
&& pushd /tmp/hh-suite/build \
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
&& make -j 4 && make install \
&& ln -s /opt/hhsuite/bin/* /usr/bin \
&& popd \
&& rm -rf /tmp/hh-suite
ENV PATH="/opt/conda/bin:$PATH"
RUN conda update -qy conda \
&& conda install -y -c conda-forge \
openmm=7.5.1 \
cudatoolkit==${CUDA_VERSION} \
pdbfixer \
pip \
python=3.7
COPY . /app/alphafold
# Install pip packages.
RUN pip3 install --upgrade pip \
&& pip3 install -r /app/alphafold/requirements.txt \
&& pip3 install py3Dmol tqdm \
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
https://storage.googleapis.com/jax-releases/jax_releases.html
# Install alphafold.
WORKDIR /app/alphafold
RUN python setup.py install
# Apply OpenMM patch.
WORKDIR /opt/conda/lib/python3.7/site-packages
RUN patch -p0 < /app/alphafold/docker/openmm.patch
# Creating a tmp location for jackhmmr; not mounting through to host though.
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
# details.
# ENTRYPOINT does not support easily running multiple commands, so instead we
# write a shell script to wrap them up.
WORKDIR /home/jupyter
RUN echo '#!/bin/bash\nldconfig\n\'
+20
View File
@@ -0,0 +1,20 @@
#!/usr/bin/env bash
set -e
# Prod (Publicly viewable)
PROJECT=cloud-devrel-public-resources
REPOSITORY=alphafold
LOCAL_IMAGE=alphafold-on-gcp
REMOTE_IMAGE=${LOCAL_IMAGE?}
TAG=latest
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
git clone https://github.com/deepmind/alphafold.git
cp Dockerfile alphafold/docker/Dockerfile
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
sudo docker push ${REGISTRY?}
Binary file not shown.

After

Width:  |  Height:  |  Size: 3.1 KiB

@@ -1,6 +1,6 @@
# PyTorch on Google Cloud: Text Classification
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
@@ -9,6 +9,7 @@ This tutorial on text classification shows how to train a PyTorch based text cla
| <h4>Notebook</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
## Folders
@@ -1,6 +1,7 @@
# Use pytorch GPU base image
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
# set working directory
WORKDIR /app
@@ -22,15 +22,18 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
# BUCKET_NAME: Change to your bucket name.
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# JOB_NAME: the name of your job running on AI Platform.
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# This can be a GCS location to a zipped and uploaded package
PACKAGE_PATH=./trainer
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
# or use the default '`us-central1`'. The region is where the job will be run.
REGION="us-central1"
@@ -41,11 +44,8 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
# IMAGE_TAG: an easily identifiable tag for your docker image
IMAGE_TAG=latest
# IMAGE_URI: the complete URI location for Cloud Container Registry
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
# Build the docker image
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
@@ -53,11 +53,19 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
# Deploy the docker image to Cloud Container Registry
docker push ${CUSTOM_TRAIN_IMAGE_URI}
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
Binary file not shown.

After

Width:  |  Height:  |  Size: 45 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 37 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 248 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 38 KiB

@@ -2,10 +2,13 @@
FROM pytorch/torchserve:latest-cpu
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
USER model-server
# copy model artifacts, custom handler and other dependencies
COPY ./custom_text_handler.py /home/model-server/
COPY ./custom_handler.py /home/model-server/
COPY ./index_to_name.json /home/model-server/
COPY ./model/finetuned-bert-classifier/ /home/model-server/
@@ -21,7 +24,7 @@ EXPOSE 7080
EXPOSE 7081
# create model archive file packaging model artifacts and dependencies
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
# run Torchserve HTTP serve to respond to prediction requests
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
@@ -0,0 +1,37 @@
FROM pytorch/torchserve:latest-cpu
USER root
# run and update some basic packages software packages, including security libs
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
# Install gcloud tools for gsutil as well as debugging
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
USER model-server
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
ARG MODEL_NAME=finetuned-bert-classifier
ENV MODEL_NAME="${MODEL_NAME}"
# health and prediction listener ports
ARG AIP_HTTP_PORT=7080
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
ARG MODEL_MGMT_PORT=7081
# expose health and prediction listener ports from the image
EXPOSE "${AIP_HTTP_PORT}"
EXPOSE "${MODEL_MGMT_PORT}"
EXPOSE 8080 8081 8082 7070 7071
# create torchserve configuration file
USER root
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
USER model-server
# run Torchserve HTTP serve to respond to prediction requests
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
@@ -52,7 +52,8 @@ class TransformersClassifierHandler(BaseHandler):
with open(mapping_file_path) as f:
self.mapping = json.load(f)
else:
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
logger.warning('Missing the index_to_name.json file. Inference output will default.')
self.mapping = {"0": "Negative", "1": "Positive"}
self.initialized = True
@@ -88,4 +89,3 @@ class TransformersClassifierHandler(BaseHandler):
def postprocess(self, inference_output):
return inference_output
@@ -19,13 +19,19 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
# BUCKET_NAME: Change to your bucket name
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# The PyTorch image provided by Vertex AI Training.
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
# JOB_NAME: the name of your job running on Vertex AI.
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
@@ -35,19 +41,21 @@ REGION="us-central1"
# JOB_DIR: Where to store prepared package and upload output model.
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
executor-image-uri=${IMAGE_URI},\
python-module=trainer.task,\
local-package-path=../python_package/"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--python-package-uris=${PACKAGE_PATH} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
@@ -122,6 +122,9 @@ def run(args):
# Train / Test the model
trainer = train(args, text_classifier, train_dataset, test_dataset)
metrics = trainer.evaluate(eval_dataset=test_dataset)
trainer.save_metrics("all", metrics)
# Export the trained model
trainer.save_model(os.path.join("/tmp", args.model_name))
@@ -63,20 +63,20 @@
"- [Training](#Training)\n",
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
"- [Tuning](#Hyperparameter-Tuning) \n",
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
"- [Deploying](#Deploying)\n",
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
"\n",
"### Costs \n",
"\n",
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
"\n",
"* [Notebooks](https://cloud.google.com/notebooks)\n",
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Cloud Storage](https://cloud.google.com/storage)\n",
"* [Container Registry](https://cloud.google.com/container-registry)\n",
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
@@ -202,9 +202,9 @@
"id": "e0c1dcadc2c8"
},
"source": [
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"\n",
"#### Install Vertex SDK for Python"
"#### Install Vertex AI SDK for Python"
]
},
{
@@ -1199,7 +1199,7 @@
"source": [
"### Run predictions locally with sample examples\n",
"\n",
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
]
},
{
@@ -1382,7 +1382,7 @@
"id": "f7466d414a0e"
},
"source": [
"### Run Custom Job on Vertex Training with a pre-built container"
"### Run Custom Job on Vertex AI Training with a pre-built container"
]
},
{
@@ -1395,7 +1395,7 @@
"\n",
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
"\n",
"![Training with Prebuilt Containers on Vertex Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
"![Training with Prebuilt Containers on Vertex AI Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
]
},
{
@@ -1569,7 +1569,7 @@
"source": [
"#### **Run custom training job on Vertex AI**\n",
"\n",
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
]
},
{
@@ -1578,7 +1578,7 @@
"id": "5d2957ef04fd"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1598,7 +1598,7 @@
"id": "6b0fed34b728"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**"
"##### **Configure and submit Custom Job to Vertex AI Training service**"
]
},
{
@@ -1609,7 +1609,7 @@
"source": [
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
]
},
{
@@ -1686,7 +1686,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job.png)"
]
},
{
@@ -1798,7 +1798,7 @@
"id": "c170d386492b"
},
"source": [
"### Run Custom Job on Vertex Training with custom container"
"### Run Custom Job on Vertex AI Training with custom container"
]
},
{
@@ -1807,7 +1807,7 @@
"id": "035227b6e581"
},
"source": [
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
"\n",
"![Training with custom containers on Vertex AI](./images/training-with-custom-containers-on-vertex-training.png)"
]
@@ -1834,7 +1834,7 @@
"%%writefile ./custom_container/Dockerfile\n",
"\n",
"# Use pytorch GPU base image\n",
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
"\n",
"# set working directory\n",
"WORKDIR /app\n",
@@ -1968,7 +1968,7 @@
"id": "a23e5e34bea9"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1988,11 +1988,11 @@
"id": "abf1fa4085cb"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**\n",
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
"\n",
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
]
},
{
@@ -2044,7 +2044,7 @@
},
"outputs": [],
"source": [
"# submit the custom job to Vertex training service\n",
"# submit the custom job to Vertex AI training service\n",
"model = job.run(\n",
" replica_count=1,\n",
" machine_type=\"n1-standard-8\",\n",
@@ -2065,7 +2065,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job-container.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job-container.png)"
]
},
{
@@ -2148,11 +2148,11 @@
"id": "ba6122f929e3"
},
"source": [
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
"\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"\n",
"![Hyperparameter Tuning with Custom Containers on Vertex Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
"![Hyperparameter Tuning with Custom Containers on Vertex AI Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
]
},
{
@@ -2163,7 +2163,7 @@
"source": [
"### How hyperparameter tuning works in Vertex AI?\n",
"\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
"\n",
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
@@ -2297,7 +2297,7 @@
"source": [
"### Run Hyperparameter Tuning Job on Vertex AI\n",
"\n",
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
]
},
{
@@ -2326,7 +2326,7 @@
"id": "f60fab07d67c"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -2346,7 +2346,7 @@
"id": "6652aa63ddff"
},
"source": [
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
"\n",
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
"\n",
@@ -2374,7 +2374,7 @@
"id": "9d46db3a8b23"
},
"source": [
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
]
},
{
@@ -2548,7 +2548,7 @@
"\n",
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor hyperparameter tuning job progress in Vertex Training](./images/vertex-training-monitor-hptuning-job-container.png)"
"![Monitor hyperparameter tuning job progress in Vertex AI Training](./images/vertex-training-monitor-hptuning-job-container.png)"
]
},
{
@@ -2557,7 +2557,7 @@
"id": "ba934b434f03"
},
"source": [
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
]
},
{
@@ -2612,7 +2612,7 @@
"id": "5dbccb2b7d32"
},
"source": [
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
]
},
{
@@ -2701,8 +2701,8 @@
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
"\n",
"# BUCKET_NAME: Change to your bucket name\n",
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
"# BUCKET_NAME is a required parameter to run the cell.\n",
"BUCKET_NAME=$1\n",
"\n",
"# APP_NAME: get application name\n",
"APP_NAME=$2\n",
@@ -2711,7 +2711,7 @@
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
"\n",
"# custom container image URI\n",
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"\n",
"# ========================================================\n",
"# create hyperparameter tuning configuration file\n",
@@ -2772,20 +2772,20 @@
"source": [
"## Deploying\n",
"\n",
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
"\n",
"### Deploying model on Vertex Predictions with custom container\n",
"### Deploying model on Vertex AI Predictions with custom container\n",
"\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
"\n",
"![Serving with Custom Containers on Vertex Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"![Serving with Custom Containers on Vertex AI Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"\n",
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
"\n",
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
]
},
{
@@ -2815,7 +2815,7 @@
},
"outputs": [],
"source": [
"%%writefile predictor/custom_text_handler.py\n",
"%%writefile predictor/custom_handler.py\n",
"\n",
"import os\n",
"import json\n",
@@ -2870,7 +2870,8 @@
" with open(mapping_file_path) as f:\n",
" self.mapping = json.load(f)\n",
" else:\n",
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
"\n",
" self.initialized = True\n",
"\n",
@@ -3047,10 +3048,13 @@
"FROM pytorch/torchserve:latest-cpu\n",
"\n",
"# install dependencies\n",
"RUN python3 -m pip install --upgrade pip\n",
"RUN pip3 install transformers\n",
"\n",
"USER model-server\n",
"\n",
"# copy model artifacts, custom handler and other dependencies\n",
"COPY ./custom_text_handler.py /home/model-server/\n",
"COPY ./custom_handler.py /home/model-server/\n",
"COPY ./index_to_name.json /home/model-server/\n",
"COPY ./model/$APP_NAME/ /home/model-server/\n",
"\n",
@@ -3070,7 +3074,7 @@
" --model-name=$APP_NAME \\\n",
" --version=1.0 \\\n",
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
" --handler=/home/model-server/custom_text_handler.py \\\n",
" --handler=/home/model-server/custom_handler.py \\\n",
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
" --export-path=/home/model-server/model-store\n",
"\n",
@@ -3129,7 +3133,7 @@
"source": [
"#### **Run the container locally** ***[Optional]***\n",
"\n",
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
]
},
{
@@ -3267,9 +3271,9 @@
"id": "69477b3a00c0"
},
"source": [
"#### **Deploying the serving container to Vertex Predictions**\n",
"#### **Deploying the serving container to Vertex AI Predictions**\n",
"\n",
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
]
},
{
@@ -3300,7 +3304,7 @@
"id": "a3da91e19af4"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -3437,7 +3441,7 @@
"id": "bc4673478269"
},
"source": [
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
]
},
{
@@ -3487,7 +3491,7 @@
"source": [
"##### **Formatting input for online prediction**\n",
"\n",
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
"\n",
"```\n",
"[\n",
@@ -3560,9 +3564,9 @@
},
"source": [
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"\n",
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
]
},
{
@@ -3653,12 +3657,12 @@
},
"outputs": [],
"source": [
"delete_custom_job = True\n",
"delete_hp_tuning_job = True\n",
"delete_custom_job = False\n",
"delete_hp_tuning_job = False\n",
"delete_endpoint = True\n",
"delete_model = True\n",
"delete_bucket = True\n",
"delete_image = True"
"delete_model = False\n",
"delete_bucket = False\n",
"delete_image = False"
]
},
{
@@ -3686,7 +3690,7 @@
"\n",
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
"\n",
"# Initialize Vertex SDK\n",
"# Initialize Vertex AI SDK\n",
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
]
},
@@ -3924,7 +3928,7 @@
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" print(\n",
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
" )\n",
@@ -3932,7 +3936,7 @@
" # uncomment below line to delete contents of the bucket\n",
" # ! gsutil rm -r $BUCKET_NAME\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" if float(shell_output[0].split()[0]) > 0:\n",
" print(\n",
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
@@ -188,11 +188,14 @@
},
"outputs": [],
"source": [
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
"! pip3 install {USER_FLAG} --upgrade kfp\n",
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow"
"! pip3 install {USER_FLAG} numpy\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
"! pip3 install {USER_FLAG} --upgrade pillow\n",
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
"! pip3 install {USER_FLAG} --upgrade fastapi"
]
},
{
@@ -287,7 +290,7 @@
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
@@ -518,6 +521,7 @@
"import os\n",
"import sys\n",
"\n",
"from google.cloud import aiplatform\n",
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"from kfp.v2 import compiler, dsl\n",
"from kfp.v2.google.client import AIPlatformClient"
@@ -561,13 +565,34 @@
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
"id": "895ac243c125"
},
"outputs": [],
"source": [
"# Dataset parameters\n",
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
"\n",
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "62bfb9a820f6"
},
"outputs": [],
"source": [
"# Download the sample data into your RAW_DATA_PATH\n",
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
},
"outputs": [],
"source": [
"# Pipeline parameters\n",
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
@@ -635,7 +660,7 @@
"source": [
"#### Run unit tests on the Generator component\n",
"\n",
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
]
},
{
@@ -713,12 +738,12 @@
"TRAINING_ARTIFACTS_DIR = (\n",
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
")\n",
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
"TRAINING_MACHINE_TYPE = (\n",
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
")\n",
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -769,8 +794,12 @@
"TRAINED_POLICY_DISPLAY_NAME = (\n",
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
")\n",
"TRAFFIC_SPLIT = {\"0\": 100}\n",
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -900,16 +929,17 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
"from kfp.components import load_component_from_url\n",
"\n",
"generate_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
")\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -978,7 +1008,7 @@
" bigquery_location=bigquery_location,\n",
" bigquery_table_id=bigquery_table_id,\n",
" )\n",
"\n",
" \n",
" # Run the Ingester component.\n",
" ingest_task = ingest_op(\n",
" project_id=project_id,\n",
@@ -988,7 +1018,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -996,28 +1035,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1034,11 +1055,14 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" traffic_split=TRAFFIC_SPLIT,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -1053,12 +1077,11 @@
"# Compile the authored pipeline.\n",
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
"\n",
"# Createa Vertex AI client.\n",
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
"\n",
"# Create a pipeline run job.\n",
"response = api_client.create_run_from_job_spec(\n",
" job_spec_path=PIPELINE_SPEC_PATH,\n",
"job = aiplatform.PipelineJob(\n",
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
" template_path=PIPELINE_SPEC_PATH,\n",
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" # Pipeline configs\n",
" \"project_id\": PROJECT_ID,\n",
@@ -1070,7 +1093,9 @@
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
" },\n",
" enable_caching=ENABLE_CACHING,\n",
")"
")\n",
"\n",
"job.run()"
]
},
{
@@ -1111,7 +1136,11 @@
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
")"
")\n",
"# TF-Agents RL configs\n",
"BATCH_SIZE = 8\n",
"RANK_K = 20\n",
"NUM_ACTIONS = 20"
]
},
{
@@ -1221,7 +1250,7 @@
},
"outputs": [],
"source": [
"endpoints = ! gcloud beta ai endpoints list \\\n",
"endpoints = ! gcloud ai endpoints list \\\n",
" --region=$REGION \\\n",
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
"print(\"\\n\".join(endpoints), \"\\n\")\n",
@@ -1424,13 +1453,11 @@
},
"outputs": [],
"source": [
"from kfp.components import load_component_from_url\n",
"\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -1481,7 +1508,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -1489,28 +1525,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1527,11 +1545,13 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -39,14 +39,15 @@ outputs:
- {name: bigquery_table_id, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
- sh
- -ec
- |
@@ -296,7 +297,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -20,7 +20,7 @@ outputs:
- {name: tfrecord_file, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
@@ -187,7 +187,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -1,3 +1,4 @@
google-cloud-bigquery==2.20.0
tensorflow==2.5.2
tensorflow==2.5.3
pillow==9.0.1
tf-agents==0.8.0
@@ -1,2 +1,4 @@
google-cloud-pubsub==2.5.0
pillow==9.0.1
tf-agents==0.8.0
tensorflow==2.5.2
tensorflow==2.5.3
@@ -0,0 +1,5 @@
dataclasses==0.6
google-cloud-aiplatform==1.8.1
tensorflow==2.5.3
pillow==9.0.1
tf-agents==0.8.0
@@ -27,14 +27,14 @@ outputs:
- {name: training_artifacts_dir, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
- sh
- -ec
- |
@@ -270,7 +270,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -22,13 +22,13 @@ from src.training import task
# Paths and configurations
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
"[your-file-name].json") # FILL IN
"result.json") # FILL IN
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
# Hyperparameters
@@ -1 +1 @@
tensorflow==2.5.2
tensorflow==2.5.3
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -113,8 +113,8 @@
},
"outputs": [],
"source": [
"! gcloud beta ai custom-jobs local-run \\\n",
" --base-image=$BASE_IMAGE_URI \\\n",
"! gcloud ai custom-jobs local-run \\\n",
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
+5
View File
@@ -0,0 +1,5 @@
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product.
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that aren't officially supported by Google.
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
+13 -10
View File
@@ -3,16 +3,19 @@
# @global-owner1 and @global-owner2 will be requested for
# review when someone opens a pull request.
/sdk/sdk_* @aferlitsch
/gapic @aferlitsch
/ml_ops @aferlitsch
/model_monitoring/* @mco
/sdk/sdk_* @andrewferlitsch
/gapic @andrewferlitsch
/ml_ops @andrewferlitsch
/model_monitoring/* @mco-gh
/structured_data/rapid_prototyping_* @rafael-carvalho
/managed_notebooks/ @notebooks-team
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/managed_notebooks/
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
/sdk/SDK_AutoML_Forecasting_Model_Training_Example.ipynb @thehardikv
/sdk/sdk_automl_forecasting_evaluating_a_model.ipynb @thehardikv
/matching_engine @yinghsienwu
/neo4j @benofben @htappen
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
/tensorboard @yfang1
/feature_store @nayaknishant @morgandu
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
Binary file not shown.

After

Width:  |  Height:  |  Size: 153 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 138 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 88 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 182 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 142 KiB

File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -6,16 +6,17 @@
"id": "c8c4e360024a"
},
"source": [
"# Taxi fare prediction using chicago taxi-cab dataset\n",
"# Taxi fare prediction using the Chicago Taxi Trips dataset\n",
"\n",
"## Table of contents\n",
"\n",
"* [Overview](#section-1)\n",
"* [Dataset](#section-2)\n",
"* [Objective](#section-3)\n",
"* [Costs](#section-4)\n",
"* [Data analysis](#section-5)\n",
"* [Fit a simple linear regression model](#section-6)\n",
"* [Save the model and upload to a GCS bucket](#section-7)\n",
"* [Save the model and upload to a Cloud Storage bucket](#section-7)\n",
"* [Deploy the model on Vertex AI with support for Vertex Explainable AI](#section-8)\n",
"* [Get explanations from the deployed model](#section-9)\n",
"* [Clean up](#section-10)\n",
@@ -23,23 +24,23 @@
"## Overview\n",
"<a name=\"section-1\"></a>\n",
"\n",
"This notebooks demonstrates analysis, feature selection, model building and deployment with Vertex Explainable AI configured on Vertex AI on a subset of the Chicago Taxi-cab dataset for Taxi-fare prediction problem.\n",
"This notebook demonstrates analysis, feature selection, model building, and deployment with Vertex Explainable AI configured on Vertex AI, using a subset of the Chicago Taxi Trips dataset for taxi-fare prediction.\n",
"\n",
"Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python(Local) kernel. Some components of this notebook may not work in other notebook environments.\n",
"*Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
"\n",
"## Dataset\n",
"<a name=\"section-2\"></a>\n",
"\n",
"The Chicago Taxi-cab dataset includes taxi trips from 2013 to the present, reported to the City of Chicago in its role as a regulatory agency. To protect privacy but allow for aggregate analyses, the Taxi ID is consistent for any given taxi medallion number but does not show the number, Census Tracts are suppressed in some cases, and times are rounded to the nearest 15 minutes. Due to the data reporting process, not all trips are reported but the City believes that most are. This dataset is publicly available on Bigquery under the public datasets with the Table ID : `bigquery-public-data.chicago_taxi_trips.taxi_trips` and also as public dataset on Kaggle Datasets at : [Chicago Taxi Trips Dataset](https://www.kaggle.com/chicago/chicago-taxi-trips-bq).\n",
"The Chicago Taxi Trips dataset includes taxi trips from 2013 to the present, reported to the city of Chicago in its role as a regulatory agency. To protect privacy but allow for aggregate analyses, the taxi ID is consistent for any given taxi medallion number but does not show the number, census tracts are suppressed in some cases, and times are rounded to the nearest 15 minutes. Due to the data reporting process, not all trips are reported but the city believes that most are. This dataset is publicly available on BigQuery as a public dataset with the table ID `bigquery-public-data.chicago_taxi_trips.taxi_trips` and also as a public dataset on Kaggle at [Chicago Taxi Trips](https://www.kaggle.com/chicago/chicago-taxi-trips-bq).\n",
"\n",
" For more information about this dataset and how it was created, please refer [Chicago Digital website](http://digital.cityofchicago.org/index.php/chicago-taxi-data-released).\n",
"For more information about this dataset and how it was created, see the [Chicago Digital website](http://digital.cityofchicago.org/index.php/chicago-taxi-data-released).\n",
"\n",
"## Objective\n",
"<a name=\"section-3\"></a>\n",
"\n",
"The goal of this notebook is to provide an overview on the latest Vertex AI features like Explainable AI and Bigquery in Notebook by trying to solve a Taxi-fare prediction problem. The steps followed in this notebook include : \n",
"The goal of this notebook is to provide an overview on the latest Vertex AI features like Explainable AI and \"BigQuery in Notebooks\" by trying to solve a taxi fare prediction problem. The steps followed in this notebook include: \n",
"\n",
"- Loading the dataset using `Bigquery in Notebooks`.\n",
"- Loading the dataset using \"BigQuery in Notebooks\".\n",
"- Performing exploratory data analysis on the dataset.\n",
"- Feature selection and preprocessing.\n",
"- Building a linear regression model using scikit-learn.\n",
@@ -54,12 +55,12 @@
"This tutorial uses the following billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Bigquery\n",
"- BigQuery\n",
"- Cloud Storage\n",
"\n",
"\n",
"Learn about [Vertex AI\n",
"pricing](https://cloud.google.com/vertex-ai/pricing), [Bigquery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/vertex-ai/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
"Calculator](https://cloud.google.com/products/calculator/)\n",
"to generate a cost estimate based on your projected usage."
@@ -71,7 +72,9 @@
"id": "5ed1f5e85640"
},
"source": [
"#### Set your project ID\n",
"## Before you begin\n",
"\n",
"### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
@@ -84,6 +87,8 @@
},
"outputs": [],
"source": [
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
@@ -120,11 +125,11 @@
"id": "fed4b24ea061"
},
"source": [
"## Select or Create Cloud Storage Bucket for storing the model\n",
"## Select or create a Cloud Storage bucket for storing the model\n",
"\n",
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket uri of the model where the model is stored. Using the model saved, you can then create Vertex AI model and endpoint resources in order to serve online predictions.\n",
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket uri of the model where the model is stored. Using the model saved, you can then create a Vertex AI model and endpoint resources in order to serve online predictions.\n",
"\n",
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets.You may also change the REGION variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets. You may also change the `LOCATION` variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
]
},
{
@@ -148,7 +153,9 @@
},
"outputs": [],
"source": [
"# Set a default bucketname in case bucket name is not given\n",
"from datetime import datetime\n",
"\n",
"# Set a default bucket name in case bucket name is not given\n",
"if BUCKET_NAME == \"\" or BUCKET_NAME == \"[your-bucket-name]\" or BUCKET_NAME is None:\n",
"\n",
" TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")\n",
@@ -165,15 +172,6 @@
"<b>Only if your bucket doesn't already exist</b>: Run the following cell to create your Cloud Storage bucket."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "95702536e547"
},
"source": [
"## Import the required libraries and define constants"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -205,6 +203,15 @@
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2e52fd6d4854"
},
"source": [
"## Import the required libraries and define constants"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -231,12 +238,14 @@
"id": "5166f42557ad"
},
"source": [
"The dataset is quite a large and noisy one and so data from a specific date range will be used. Based on various blogs and resources that are available online, many of them seem to have used the data from around May-2018 which gave some really good results compared to the other date ranges. While there are also some complicated research models propsed for the same problem like considering the weather data, holidays and seasons etc., the current notebook only explores a simple linear regression model as our main objective is to demonstrate the model deployment with Vertex Explainable AI configured on Vertex AI.\n",
"The dataset is quite a large and noisy one, so data from a specific date range will be used. Based on various blogs and resources that are available online, many of them seem to have used the data from around May 2018 which gave some really good results compared to the other date ranges. While there are also some complicated research models proposed for the same problem, like considering the weather data, holidays and seasons, the current notebook only explores a simple linear regression model, as our main objective is to demonstrate the model deployment with Vertex Explainable AI configured on Vertex AI.\n",
"\n",
"## Accessing the data through Bigquery in Notebooks\n",
"`Bigquery in Notebooks` feature of Vertex AI's managed notebooks allows us to use Bigquery and its features from the notebook itself eliminating the need to switch between tabs everytime. For every cell in the notebook, there is an option for Bigquery integration at the top right selecting which would enable us to compose a SQL query that can be executed in Bigquery. \n",
"## Accessing the data through \"BigQuery in Notebooks\"\n",
"\n",
"The \"BigQuery in Notebooks\" feature of Vertex AI Workbench managed notebooks lets you use BigQuery and its features from the notebook itself eliminating the need to switch between tabs everytime. For every cell in the notebook, there is an option for the BigQuery integration at the top right, and selecting it enables you to compose an SQL query that can be executed in BigQuery. \n",
"\n",
"The chosen dataset consists of the following fields:\n",
"\n",
"The chosen dataset consists of the following fields :\n",
"- `unique_key` : Unique identifier for the trip.\n",
"- `taxi_id` : A unique identifier for the taxi.\n",
"- `trip_start_timestamp`: When the trip started, rounded to the nearest 15 minutes.\n",
@@ -261,12 +270,12 @@
"- `dropoff_longitude`: The longitude of the center of the dropoff census tract or the community area if the census tract has been hidden for privacy.\n",
"- `dropoff_location`: The location of the center of the dropoff census tract or the community area if the census tract has been hidden for privacy.\n",
"\n",
"Among the available fields in the dataset, only the fields that seem common and relevant for analysis and modeling like `taxi_id`, `trip_start_timestamp`, `trip_seconds`, `trip_miles`, `payment_type` and `trip_total` are selected. Further, the field `trip_total` is treated as the target variable that would be predicted by the machine learning model. Apparently, this field is a summation of `fare`,`tips`,`tolls` and `extras` fields and so because of their correlation with the target variable, they are being excluded for modeling. Due to the volume of the data, a subset of the dataset over the course of one week i.e., 12-May-2018 to 18-May-2018 is being considered. Within this date range itself, the datapoints can be noisy and so a few conditions like the following are considered : \n",
"Among the available fields in the dataset, only the fields that seem common and relevant for analysis and modeling like `taxi_id`, `trip_start_timestamp`, `trip_seconds`, `trip_miles`, `payment_type` and `trip_total` are selected. Further, the field `trip_total` is treated as the target variable that would be predicted by the machine learning model. Apparently, this field is a summation of the `fare`,`tips`,`tolls` and `extras` fields and so because of their correlation with the target variable, they are being excluded for modeling. Due to the volume of the data, a subset of the dataset over the course of one week, 12-May-2018 to 18-May-2018 is being considered. Within this date range itself, the datapoints can be noisy and so a few conditions like the following are considered: \n",
"\n",
"- Time taken for the trip > 0.\n",
"- Distance covered during the trip > 0.\n",
"- Total trip charges > 0 and\n",
"- Pickup and dropoff areas are valid(not empty)."
"- Pickup and dropoff areas are valid (not empty)."
]
},
{
@@ -301,7 +310,7 @@
"id": "781341730c28"
},
"source": [
"The Bigquery integration also allows us to load the queried data into a pandas dataframe using the `Query and load as DataFrame` button. Clicking the button adds a new cell below that provides a code snippet to load the data into a dataframe."
"The BigQuery integration also lets you load the queried data into a pandas dataframe using the `Query and load as DataFrame` button. Clicking the button adds a new cell below that provides a code snippet to load the data into a dataframe."
]
},
{
@@ -343,7 +352,7 @@
"id": "96d61011e159"
},
"source": [
"Check the fields in the data and the shape."
"Check the fields in the data and their shape."
]
},
{
@@ -426,7 +435,7 @@
"id": "f0feadc628e4"
},
"source": [
"Depending on the percentage of null values in the data, one can choose to either drop them or impute them with mean/median(for numerical values) and mode(for categorical values). In the current data, there doesn't seem to be any null values."
"Depending on the percentage of null values in the data, one can choose to either drop them or impute them with mean/median (for numerical values) and mode (for categorical values). In the current data, there doesn't seem to be any null values."
]
},
{
@@ -480,7 +489,7 @@
"## Analyze numerical data\n",
"<a name=\"section-5\"></a>\n",
"\n",
"To further anaylyze the data, there are various plots that can be used on numerical and categorical fields. In case of numerical data, one can use histograms and box-plots while bar charts are suited for categorical data to better understand the distribution of the data and the outliers in the data."
"To further anaylyze the data, there are various plots that can be used on numerical and categorical fields. In case of numerical data, one can use histograms and box plots while bar charts are suited for categorical data to better understand the distribution of the data and the outliers in the data."
]
},
{
@@ -489,7 +498,7 @@
"id": "fa2d6258b509"
},
"source": [
"Plot Histograms and Box-plots on the numerical fields."
"Plot histograms and box plots on the numerical fields."
]
},
{
@@ -515,7 +524,7 @@
"id": "c3672976d67b"
},
"source": [
"The field `trip_seconds` describes the time taken for the trip in seconds. Optionally, it can be converted into hours for an easier understanding."
"The field `trip_seconds` describes the time taken for the trip in seconds. Optionally, it can be converted into hours."
]
},
{
@@ -557,7 +566,7 @@
"id": "58d57879aa8a"
},
"source": [
"So far we've only considered to look at the univariate plots. To better understand the relationship between the variables, a pair-plot can be plotted."
"So far you've only looked at the univariate plots. To better understand the relationship between the variables, a pair-plot can be plotted."
]
},
{
@@ -580,7 +589,7 @@
"id": "b69e8094ba39"
},
"source": [
"From the box-plots and the histograms plotted so far, it is evident that there are some outliers causing skewness in the data which perhaps could be removed. Also, we can certainly see some linear relationship between the independent variables considered in the pair-plot i.e., `trip_seconds` and `trip_miles` and the dependant variable `trip_total`."
"From the box plots and the histograms visualized so far, it is evident that there are some outliers causing skewness in the data which perhaps could be removed. Also, you can see some linear relationships between the independent variables considered in the pair-plot, for example, `trip_seconds` and `trip_miles` and the dependant variable `trip_total`."
]
},
{
@@ -627,7 +636,7 @@
"id": "341b581e2155"
},
"source": [
"## Analyze Categorical data\n",
"## Analyze categorical data\n",
"\n",
"Further, explore the categorical data by plotting the distribution of all the levels in each field."
]
@@ -653,9 +662,9 @@
"id": "a40a4b2d9d6a"
},
"source": [
"From the above analysis, one can see that almost 99% of the transaction types are Cash and Credit Card. While there are also other type of transactions, their distribution is very less. In such a case, the lower distribution levels can be dropped. On the other hand, total number of pickup and dropoff community areas both seem to have the same levels which make sense. In this case also, one can choose to omit the lower distribution levels but it has to be made sure that both the fields have the same levels afterwards. In the current notebook, we'd keep them as is and proceed with the modeling.\n",
"From the above analysis, one can see that almost 99% of the transaction types are Cash and Credit Card. While there are also other type of transactions, their distribution is negligible. In such a case, the lower distribution levels can be dropped. On the other hand, the total number of pickup and dropoff community areas both seem to have the same levels which make sense. In this case also, one can choose to omit the lower distribution levels but you'd have to make sure that both the fields have the same levels afterward. In the current notebook, keep them as is and proceed with the modeling.\n",
"\n",
"The relationships between the target variable and the categorical fields can be represented through boxplots. For each level, the corresponding distribution of the target variable can be identified."
"The relationships between the target variable and the categorical fields can be represented through box plots. For each level, the corresponding distribution of the target variable can be identified."
]
},
{
@@ -680,7 +689,7 @@
"id": "f49125a8a866"
},
"source": [
"There seems to be one case where the `trip_total` is over 3000 and has the same pickup and dropoff community area i.e., 28 which is clearly an outlier compared to the rest of the points. This datapoint can be removed."
"There seems to be one case where the `trip_total` is over 3000 and has the same pickup and dropoff community area: 28 is clearly an outlier compared to the rest of the points. This datapoint can be removed."
]
},
{
@@ -725,7 +734,7 @@
"id": "58a1d9f0a122"
},
"source": [
"There are also timestamp fields in the data that can prove to be useful. `trip_start_timestamp` represents the start timestamp of the taxi-trip and fields like what day of week it was and what hour it was can be dervied from it."
"There are also useful timestamp fields in the data. `trip_start_timestamp` represents the start timestamp of the taxi trip and fields like what day of week it was and what hour it was can be derived from it."
]
},
{
@@ -747,7 +756,7 @@
"id": "30ae02a15aa1"
},
"source": [
"Since the current dataset is considered only for a week, if there isn't much variation in the newly dervied fields with respect to the target variable, they can be dropped.\n",
"Since the current dataset is limited to only a week, if there isn't much variation in the newly derived fields with respect to the target variable, they can be dropped.\n",
"\n",
"Plot sum and average of the `trip_total` with respect to the `dayofweek`."
]
@@ -804,9 +813,9 @@
"id": "739e985af704"
},
"source": [
"As these plots don't seem to have constant figures with respect to the target variable across their levels, they can be considered for training. In fact, to simplify things these dervied features can be bucketed into less number of levels.\n",
"As these plots don't seem to have constant figures with respect to the target variable across their levels, they can be considered for training. In fact, to simplify things these derived features can be bucketed into fewer levels.\n",
"\n",
"`dayofweek` field can be bucketed into a binary field considering whether or not it was a weekend. If it is a weekday, the record can be assigned 1, else 0. Similarly, `hour` field can also be bucketed and encoded. The normal working hours in Chicago can be assumed to be between *8AM*-*10PM* and if the value falls in between the working hours, it can be encoded as 1, else 0."
"The `dayofweek` field can be bucketed into a binary field considering whether or not it was a weekend. If it is a weekday, the record can be assigned 1, else 0. Similarly, the `hour` field can also be bucketed and encoded. The normal working hours in Chicago can be assumed to be between *8AM*-*10PM* and if the value falls in between the working hours, it can be encoded as 1, else 0."
]
},
{
@@ -848,7 +857,7 @@
"id": "fe87612faa94"
},
"source": [
"## Divide the data in Train and Test sets\n",
"## Divide the data into train and test sets\n",
"\n",
"Split the preprocessed dataset into train and test sets so that the linear regression model can be validated on the test set."
]
@@ -887,10 +896,10 @@
"id": "5b7e470de1da"
},
"source": [
"## Fit a Simple Linear Regression model\n",
"## Fit a simple linear regression model\n",
"<a name=\"section-6\"></a>\n",
"\n",
"Fit a linear regression model using Sklearn's LinearRegression method on the train data."
"Fit a linear regression model using scikit-learn's LinearRegression method on the train data."
]
},
{
@@ -940,7 +949,7 @@
"id": "2ef6b44f0f93"
},
"source": [
"A low RMSE error and a train and test R2 score of 0.93 suggests that the model has fitted well on the data. Further, the coefficients learned by the model for each of its independent variables can also be checked by checking the `coef_` attribute of the sklearn model. \n",
"A low RMSE error and a train and test R2 score of 0.93 suggests that the model is fitted well. Further, the coefficients learned by the model for each of its independent variables can also be checked by checking the `coef_` attribute of the sklearn model. \n",
"\n",
"Check the coefficients learned by the model."
]
@@ -963,7 +972,7 @@
"id": "bcaed0b52e60"
},
"source": [
"## Save the model and upload to a GCS bucket.\n",
"## Save the model and upload to a Cloud Storage bucket\n",
"<a name=\"section-7\"></a>\n",
"\n",
"To deploy the model on Vertex AI, the model needs to be stored in a Cloud Storage bucket first."
@@ -999,10 +1008,10 @@
"id": "9f8ecfa6a19b"
},
"source": [
"## Deploy the Model on Vertex AI with support for Vertex Explainable AI\n",
"## Deploy the model on Vertex AI with support for Vertex Explainable AI\n",
"<a name=\"section-8\"></a>\n",
"\n",
"Configure the Vertex Explainable AI before deploying the model. For further details, see [Configuring Vertex Explainable AI in Vertex AI models](https://cloud.google.com/vertex-ai/docs/explainable-ai/configuring-explanations#scikit-learn-and-xgboost-pre-built-containers)."
"Configure Vertex Explainable AI before deploying the model. For further details, see [Configuring Vertex Explainable AI in Vertex AI models](https://cloud.google.com/vertex-ai/docs/explainable-ai/configuring-explanations#scikit-learn-and-xgboost-pre-built-containers)."
]
},
{
@@ -1114,7 +1123,7 @@
"id": "9eaab1c54d66"
},
"source": [
"Deploy the model to the created endpoint with the required machine-type."
"Deploy the model to the created endpoint with the required machine type."
]
},
{
@@ -1167,7 +1176,7 @@
"id": "b751978ff665"
},
"source": [
"## Get explanations from the deployed model.\n",
"## Get explanations from the deployed model\n",
"<a name=\"section-9\"></a>\n",
"\n",
"For testing the deployed online model, select two instances from the test data as payload."
@@ -1191,7 +1200,7 @@
"id": "01532047a99e"
},
"source": [
"Call the endpoint with the payload request and parse the response for explanations. The explanations consists of attributions on the independent variables used for training the model which are based on the configured attribution method. In this case, we've used the `Sampled Shapely` method which assigns credit for the outcome to each feature, and considers different permutations of the features. This method provides a sampling approximation of exact Shapley values. Further information on the attribution methods for explantions can be found at [Overview of ExplainableAI](https://cloud.google.com/vertex-ai/docs/explainable-ai/overview) page."
"Call the endpoint with the payload request and parse the response for explanations. The explanations consists of attributions on the independent variables used for training the model which are based on the configured attribution method. In this case, we've used the `Sampled Shapely` method which assigns credit for the outcome to each feature, and considers different permutations of the features. This method provides a sampling approximation of exact Shapely values. Further information on the attribution methods for explanations can be found at [Overview of Explainable AI](https://cloud.google.com/vertex-ai/docs/explainable-ai/overview)."
]
},
{
@@ -1266,9 +1275,9 @@
"id": "87cf259efb64"
},
"source": [
"## Next Steps\n",
"## Next steps\n",
"\n",
"Since the Chicago-Taxicab dataset is continuously updating, one can preform the same kind of analysis and model training every time a new set of data is available. The date range can also be increased from a week to a month or more depending on the quality of data. Most of the steps followed in this notebook would still be valid and can be applied over the new data unless the data is too noisy. Perhaps, the notebook itself can be scheduled to run at the specified times to retrain the model using the scheduling option of the [Vertex AI workbench's Executor](https://console.cloud.google.com/vertex-ai/workbench/list/executions) feature. "
"Since the Chicago Taxi Trips dataset is continuously updating, one can preform the same kind of analysis and model training every time a new set of data is available. The date range can also be increased from a week to a month or more depending on the quality of the data. Most of the steps followed in this notebook would still be valid and can be applied over the new data unless the data is too noisy. Perhaps, the notebook itself can be scheduled to run at the specified times to retrain the model using the scheduling option of [Vertex AI Workbench's executor](https://console.cloud.google.com/vertex-ai/workbench/list/executions). "
]
},
{
@@ -1277,7 +1286,7 @@
"id": "eae8d94e3641"
},
"source": [
"## Clean Up\n",
"## Clean up\n",
"<a name=\"section-10\"></a>\n",
"\n",
"Delete the resources created in this notebook.\n",
Binary file not shown.

After

Width:  |  Height:  |  Size: 382 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 445 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 63 KiB

@@ -7,49 +7,53 @@
},
"source": [
"# Predictive Maintenance \n",
"\n",
"## Table of contents\n",
"* [Overview](#section-1)\n",
"* [Dataset](#section-2)\n",
"* [Objective](#section-3)\n",
"* [Costs](#section-4)\n",
"* [Data Analysis](#section-5)\n",
"* [Fit a Regression model](#section-6)\n",
"* [Data analysis](#section-5)\n",
"* [Fit a regression model](#section-6)\n",
"* [Evaluate the trained model](#section-7)\n",
"* [Save the model](#section-8)\n",
"* [Running a notebook end-to-end using **Executor**](#section-9)\n",
"* [Running a notebook end-to-end using the executor](#section-9)\n",
"* [Hosting the model on Vertex AI](#section-10)\n",
" * [Create an Endpoint](#section-11)\n",
" * [Deploy the model to the created Endpoint](#section-12)\n",
" * [Test calling the endpoint](#section-13)\n",
" * [Create an endpoint](#section-11)\n",
" * [Deploy the model to the created endpoint](#section-12)\n",
" * [Test calling the endpoint](#section-13)\n",
"* [Clean up](#section-14)\n",
"\n",
"\n",
"## Overview\n",
"<a name=\"section-1\"></a>\n",
"This notebook demonstrates performing predictive maintenance on industrial data using machine learning techniques, deploying the machine learning model on Vertex-AI and automating the workflow using executor feature of Vertex-AI.\n",
"\n",
"<b>Note</b>: This notebook is designed to run on managed notebooks instance of Vertex AI Workbench. Some components of this notebook may not work in other notebook environments.\n",
"This notebook demonstrates how to perform predictive maintenance on industrial data using machine learning techniques, deploy the machine learning model on Vertex AI, and automate the workflow using the executor feature of Vertex AI Workbench.\n",
"\n",
"*Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the XGBoost (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
"\n",
"## Dataset\n",
"<a name=\"section-2\"></a>\n",
"The dataset used in this notebook is a part of the [NASA Turbofan Engine Degradation Dataset](https://ti.arc.nasa.gov/tech/dash/groups/pcoe/prognostic-data-repository/) which consists of simulated time-series data for four sets of fleet-engines under different combinations of operational conditions and fault modes. In this notebook, only one of the engine's simulated data(FD001) has been considered to analyze and train a model that can predict the engine's remaining useful life.\n",
"\n",
"## Objective\n",
"The dataset used in this notebook is a part of the [NASA Turbofan Engine Degradation Simulation dataset](https://ti.arc.nasa.gov/tech/dash/groups/pcoe/prognostic-data-repository/), which consists of simulated time-series data for four sets of fleet engines under different combinations of operational conditions and fault modes. In this notebook, only one of the engine's simulated data (FD001) has been used to analyze and train a model that can predict the engine's remaining useful life.\n",
"\n",
"## Objectives\n",
"<a name=\"section-3\"></a>\n",
"In this notebook :\n",
"\n",
"- Loading the required dataset from Cloud Storage bucket.\n",
"The objectives of this notebook include:\n",
"\n",
"- Loading the required dataset from a Cloud Storage bucket.\n",
"- Analyzing the fields present in the dataset.\n",
"- Selecting the required data for the predictive maintenance model.\n",
"- Training an XGBoost regression model for predicting the remaining useful life.\n",
"- Evaluating the model.\n",
"- Running the notebook end-to-end as a training job using Executor.\n",
"- Deploying the model on Vertex-AI.\n",
"- Deploying the model on Vertex AI.\n",
"- Clean up.\n",
"\n",
"\n",
"## Costs\n",
"<a name=\"section-4\"></a>\n",
"\n",
"This tutorial uses the following billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
@@ -68,8 +72,10 @@
"id": "5b15a97278df"
},
"source": [
"## Kernel selection\n",
"Select <b>XGBoost</b> kernel while running this notebook on Vertex-AIs managed instances or ensure that the following libraries are installed in the environment where this notebook is being run.\n",
"## Before you begin\n",
"\n",
"### Kernel selection\n",
"Select <b>XGBoost</b> kernel while running this notebook on Vertex AI Workbench managed notebooks instances or ensure that the following libraries are installed in the environment where this notebook is being run.\n",
"- XGBoost\n",
"- Pandas\n",
"- Seaborn\n",
@@ -80,7 +86,9 @@
"- google.cloud.aiplatform\n",
"- google.cloud.storage\n",
"\n",
"## Set your project ID"
"### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
@@ -91,7 +99,36 @@
},
"outputs": [],
"source": [
"PROJECT_ID = \"[your-project-id]\""
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "750bf2883c2d"
},
"source": [
"Otherwise, set your project ID here."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3c6db1ca88b9"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
@@ -124,11 +161,11 @@
"id": "ea53caa30628"
},
"source": [
"## Select or Create Cloud Storage Bucket for storing the model\n",
"## Select or Create a Cloud Storage Bucket for storing the model\n",
"\n",
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket URI of the model where the model is stored. Using the model saved, you can then create Vertex AI model and endpoint resources in order to serve online predictions.\n",
"\n",
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets.You may also change the REGION variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets. You may also change the `REGION` variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
]
},
{
@@ -263,7 +300,7 @@
"id": "8cfc304d35b5"
},
"source": [
"The data itself doesn't contain any feature names and thus needs its columns to be re-named. The data source already provides us with some data description. Apparently, the <b>ID</b> column represents the unit-number of the fleet-engine and <b>Cycle</b> represents the time in cycles. <b>OpSet1</b>,<b>Opset2</b> & <b>Opset3</b> represent the three operational settings that are described in the original data source and have a substantial effect on engine performance. The rest of the fields show sensor readings collected from 21 different sensors."
"The data itself doesn't contain any feature names and thus needs its columns to be renamed. The data source already provides some data description. Apparently, the <b>ID</b> column represents the unit-number of the fleet-engine and <b>Cycle</b> represents the time in cycles. <b>OpSet1</b>,<b>Opset2</b> & <b>Opset3</b> represent the three operational settings that are described in the original data source and have a substantial effect on engine performance. The rest of the fields show sensor readings collected from 21 different sensors."
]
},
{
@@ -336,7 +373,7 @@
"id": "43c3f01352ad"
},
"source": [
"On an average, there seems to be around 225 cycles per each ID in the dataset. Further, lets check the data-types of the fields and the number of null records in the data."
"On an average, there seem to be around 225 cycles per each ID in the dataset. Next, lets check the data types of the fields and the number of null records in the data."
]
},
{
@@ -418,7 +455,7 @@
"id": "284debdf4294"
},
"source": [
"Fields **SensorMeasure7**, **SensorMeasure12**, **SensorMeasure20** & **SensorMeasure21** correlate highly with many other fields. These fields can be omitted. Further, **SensorMeasure8**, **SensorMeasure11** and **SensorMeasure4** seem highly correlated with each other and so any one of them, say **SensorMeasure4** can be kept and the rest can be omitted."
"Fields **SensorMeasure7**, **SensorMeasure12**, **SensorMeasure20** & **SensorMeasure21** correlate highly with many other fields. These fields can be omitted. Further, **SensorMeasure8**, **SensorMeasure11** and **SensorMeasure4** seem highly correlated with each other and so any one of them, for example, **SensorMeasure4**, can be kept and the rest can be omitted."
]
},
{
@@ -455,7 +492,7 @@
"id": "8197cdef2cff"
},
"source": [
"As the current objective is to predict the remaining useful life(RUL) of each unit(ID), the target variable needs to be identified. Since we're dealing with a timeseries data that represents the lifetime of a unit, remaining useful life of a unit can be calculated by subtracting the current cycle from the maximum cycle of that unit.\n",
"As the current objective is to predict the remaining useful life (RUL) of each unit (ID), the target variable needs to be identified. Since we're dealing with a timeseries data that represents the lifetime of a unit, remaining useful life of a unit can be calculated by subtracting the current cycle from the maximum cycle of that unit.\n",
"\n",
"\t\t\t\t\tRUL = Max. Cycle - Current Cycle \n",
"## RUL calculation and Feature selection"
@@ -518,7 +555,7 @@
"id": "fc3b82355cdc"
},
"source": [
"The above plot suggests that the RUL i.e., the remaining cycles is decreasing as the current cycle increases which is expected. Further, lets see the how the other fields relate to RUL in the current dataset."
"The above plot suggests that the RUL, in other words, the remaining cycles, is decreasing as the current cycle increases which is expected. Further, lets see the how the other fields relate to RUL in the current dataset."
]
},
{
@@ -557,7 +594,7 @@
"- Fields **SensorMeasure5** and **SensorMeasure16** don't show much variance with the RUL and seem constant all the time. Hence, they can be removed.\n",
"- Fields **SensorMeasure2**, **SensorMeasure3**, **SensorMeasure4**, **SensorMeasure13**, **SensorMeasure15** & **SensorMeasure17** show a similar rising trend.\n",
"- **SensorMeasure9** and **SensorMeasure14** show a similar trend.\n",
"- **SensorMeasure6** shows flatline most of the time except at a very few places and therefore can be ignored."
"- **SensorMeasure6** shows a flatline most of the time except in a very few places and therefore can be ignored."
]
},
{
@@ -583,7 +620,7 @@
"id": "cae198bd96ef"
},
"source": [
"## Split the data into Train and Test\n",
"## Split the data into train and test\n",
"\n",
"Divide the dataset with the selected features into train and test sets."
]
@@ -613,9 +650,10 @@
"id": "43a26d74c687"
},
"source": [
"## Fit a Regression model\n",
"## Fit a regression model\n",
"<a name=\"section-6\"></a>\n",
"Initialize and train a regression model using XGBoost library with the calculated RUL as the target feature."
"\n",
"Initialize and train a regression model using the XGBoost library with the calculated RUL as the target feature."
]
},
{
@@ -769,23 +807,25 @@
"id": "4bd88d7f4bbb"
},
"source": [
"## Running a notebook end-to-end using **Executor**\n",
"## Running a notebook end-to-end using executor\n",
"<a name=\"section-9\"></a>\n",
"\n",
"### Automating the notebook execution\n",
"All the steps followed till now can be run as a training job without using any additional code using the Notebook executor. Notebook executor can help you run a notebook file from start to end, with your choice of the environment, machine type, input parameters, and other characteristics. After setting up an execution, the notebook is executed as a job in Vertex AI custom training. Your jobs can be monitored from the Notebook Executor pane in the menu on the left.\n",
"All the steps followed until now can be run as a training job without using any additional code using the Vertex AI Workbench executor. The executor can help you run a notebook file from start to end, with your choice of the environment, machine type, input parameters, and other characteristics. After setting up an execution, the notebook is executed as a job in Vertex AI custom training. Your jobs can be monitored from the Executor pane in the left sidebar.\n",
"\n",
"<img src=\"images/executor.PNG\">\n",
"\n",
"Executor also lets you choose the environment and machine type while automating the runs similar to Vertex AI training jobs without switching to the training jobs UI. Apart from the custom container that replicates the existing kernel by default, pre-built environments like TensorFlow Enterprise, PyTorch, and others can also be selected to run the notebook. Furthermore the required compute power can be specified by choosing from the list of machine types available, including GPUs.\n",
"The executor also lets you choose the environment and machine type while automating the runs similar to Vertex AI training jobs without switching to the training jobs UI. Apart from the custom container that replicates the existing kernel by default, pre-built environments like TensorFlow Enterprise, PyTorch, and others can also be selected to run the notebook. The required compute power can be specified by choosing from the list of machine types available, including GPUs.\n",
"\n",
"## Scheduled runs on executor\n",
"\n",
"Notebook runs can also be scheduled recurringly with the executor. To do so, select Schedule-based recurring executions as the run type instead of One-time execution. The frequency of the job and the time when it executes is provided when you create the execution.\n",
"\n",
"<img src=\"https://storage.googleapis.com/gweb-cloudblog-publish/images/7_Vertex_AI_Workbench.max-1100x1100.jpg\">\n",
"\n",
"## Parameterizing the variables\n",
"Executor lets you run a notebook with different sets of input parameters.If you’ve added parameter tags to any of your notebook cells, you can pass in your parameter values to the executor. More about how to use this feature can be found on this [blog](https://cloud.google.com/blog/products/ai-machine-learning/schedule-and-execute-notebooks-with-vertex-ai-workbench).\n",
"\n",
"The executor lets you run a notebook with different sets of input parameters. If you’ve added parameter tags to any of your notebook cells, you can pass in your parameter values to the executor. More about how to use this feature can be found on this [blog](https://cloud.google.com/blog/products/ai-machine-learning/schedule-and-execute-notebooks-with-vertex-ai-workbench).\n",
"\n",
"<img src=\"https://storage.googleapis.com/gweb-cloudblog-publish/images/6_Vertex_AI_Workbench.max-700x700.jpg\">\n"
]
@@ -944,7 +984,7 @@
"## Clean up\n",
"<a name=\"section-14\"></a>\n",
"\n",
"Undeploy the model from endpoint."
"Undeploy the model from the endpoint."
]
},
{
@@ -1022,7 +1062,7 @@
],
"metadata": {
"colab": {
"name": "Predictive_maintenance_usecase.ipynb",
"name": "predictive_maintenance_usecase.ipynb",
"toc_visible": true
},
"kernelspec": {
@@ -0,0 +1,823 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "d1cc1c1fa076"
},
"source": [
"# Pricing Optimization \n",
"## Table of contents\n",
"* [Overview](#section-1)\n",
"* [Dataset](#section-2)\n",
"* [Objective](#section-3)\n",
"* [Costs](#section-4)\n",
"* [Create a BigQuery dataset](#section-5)\n",
"* [Load the dataset from Cloud Storage](#section-6)\n",
"* [Data analysis](#section-7)\n",
"* [Preprocess the data for training](#section-8)\n",
"* [Train the model using BigQuery ML](#section-9)\n",
"* [Generate forecasts from the model](#section-10)\n",
"* [Interpret the results to choose the best price](#section-11)\n",
"* [Clean up](#section-12)\n",
"\n",
"## Overview\n",
"<a name=\"section-1\"></a>\n",
"\n",
"This notebook demonstrates analysis of pricing optimization on [CDM Pricing Data](https://github.com/trifacta/trifacta-google-cloud/tree/main/design-pattern-pricing-optimization) and automating the workflow using Vertex AI Workbench managed notebooks.\n",
"\n",
"*Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
"\n",
"## Dataset\n",
"<a name=\"section-2\"></a>\n",
"\n",
"The dataset used in this notebook is a part of the [CDM Pricing dataset](https://github.com/trifacta/trifacta-google-cloud/blob/main/design-pattern-pricing-optimization/CDM_Pricing_large_table.csv), which consists of product sales information on specified dates.\n",
"\n",
"## Objective\n",
"<a name=\"section-3\"></a>\n",
"\n",
"The objective of this notebook is to build a pricing optimization model using Vertex AI. The following steps have been followed: \n",
"\n",
"- Load the required dataset from a Cloud Storage bucket.\n",
"- Analyze the fields present in the dataset.\n",
"- Process the data to build a model.\n",
"- Build a BigQuery ML forecast model on the processed data.\n",
"- Get forecasted values from the BigQuery ML model.\n",
"- Interpret the forecasts to identify the best prices.\n",
"- Clean up.\n",
"\n",
"## Costs\n",
"<a name=\"section-4\"></a>\n",
"\n",
"This tutorial uses the following billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- BigQuery\n",
"- Cloud Storage\n",
"\n",
"\n",
"Learn about [Vertex AI\n",
"pricing](https://cloud.google.com/vertex-ai/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
"Calculator](https://cloud.google.com/products/calculator/)\n",
"to generate a cost estimate based on your projected usage.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5ed1f5e85640"
},
"source": [
"## Before you begin\n",
"\n",
"### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c3f30148b66d"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"PROJECT_ID = \"\"\n",
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "750bf2883c2d"
},
"source": [
"Otherwise, set your project ID here."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3c6db1ca88b9"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2a1c270c7d34"
},
"source": [
"### Import the required libraries and define constants\n"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "acc6fac1fa55"
},
"outputs": [],
"source": [
"import matplotlib.pyplot as plt\n",
"import pandas as pd\n",
"import seaborn as sns\n",
"from google.cloud import bigquery\n",
"from google.cloud.bigquery import Client"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a06006dff8f9"
},
"outputs": [],
"source": [
"DATASET = \"[your-bigquery-dataset-id]\" # set the BigQuery dataset-id\n",
"TRAINING_DATA_TABLE = \"[your-bigquery-table-id-to-store-the-training-data]\" # set the BigQuery table-id to store the training data"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "016c3d47cc69"
},
"source": [
"## Create a BigQuery dataset\n",
"<a name=\"section-5\"></a>\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "12ccd8d7956e"
},
"source": [
"#@bigquery\n",
"-- create a dataset in BigQuery\n",
"\n",
"CREATE SCHEMA pricing_optimization\n",
"OPTIONS(\n",
" location=\"us\"\n",
" )"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "c106b978a79b"
},
"source": [
"## Load the dataset from Cloud Storage\n",
"<a name=\"section-6\"></a>\n"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "8aeae9da9796"
},
"outputs": [],
"source": [
"DATA_LOCATION = \"gs://cloud-samples-data/ai-platform-unified/datasets/tabular/cdm_pricing_large_table.csv\"\n",
"df = pd.read_csv(DATA_LOCATION)\n",
"print(df.shape)\n",
"df.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "7b98d5f09842"
},
"source": [
"You will build a forecast model on this data and thus determine the best price for a product. For this type of model, you will not be using many fields: only the sales and price related ones. For the current execrcise, focus on the following fields:\n",
"\n",
"- `Product_ID`\n",
"- `Customer_Hierarchy`\n",
"- `Fiscal_Date`\n",
"- `List_Price_Converged`\n",
"- `Invoiced_quantity_in_Pieces`\n",
"- `Net_Sales`\n",
"\n",
"## Data Analysis\n",
"<a name=\"section-7\"></a>\n",
"\n",
"First, explore the data and distributions.\n",
"\n",
"Select the required columns from the dataframe."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "af4b41c5eb1f"
},
"outputs": [],
"source": [
"id_col = \"Product_ID\"\n",
"date_col = \"Fiscal_Date\"\n",
"categ_cols = [\"Customer_Hierarchy\"]\n",
"num_cols = [\"List_Price_Converged\", \"Invoiced_quantity_in_Pieces\", \"Net_Sales\"]\n",
"\n",
"df = df[[id_col, date_col] + categ_cols + num_cols].copy()\n",
"df.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3d780043ee5b"
},
"source": [
"Check the column types and null values in the dataframe."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f54c445a1288"
},
"outputs": [],
"source": [
"df.info()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cd817b414c4d"
},
"source": [
"This data description reveals that there are no null values in the data. Also, the field `Fiscal_Date` which is a date field is loaded as an object type. \n",
"\n",
"Change the type of the date field to datetime."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b160fac085c8"
},
"outputs": [],
"source": [
"df[\"Fiscal_Date\"] = pd.to_datetime(df[\"Fiscal_Date\"], infer_datetime_format=True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fb4778578064"
},
"source": [
"Plot the distributions for the categorical fields."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "dd0467cd57c3"
},
"outputs": [],
"source": [
"for i in categ_cols:\n",
" df[i].value_counts(normalize=True).plot(kind=\"bar\")\n",
" plt.title(i)\n",
" plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "145deed255e0"
},
"source": [
"Plot the distributions for the numerical fields."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f934137c6d82"
},
"outputs": [],
"source": [
"for i in num_cols:\n",
" _, ax = plt.subplots(1, 2, figsize=(10, 4))\n",
" df[i].plot(kind=\"box\", ax=ax[0])\n",
" df[i].plot(kind=\"hist\", ax=ax[1])\n",
" ax[0].set_title(i + \"-Boxplot\")\n",
" ax[1].set_title(i + \"-Histogram\")\n",
" plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f9b9c2e58380"
},
"source": [
"Check the maximum date and minimum date in Fiscal_Date column."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2a10aa689f9d"
},
"outputs": [],
"source": [
"print(df[\"Fiscal_Date\"].max())\n",
"print(df[\"Fiscal_Date\"].min())"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "4834f63e2e59"
},
"source": [
"Check the product distribution across each category."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4664877f5304"
},
"outputs": [],
"source": [
"grp_cols = [\"Customer_Hierarchy\", \"Product_ID\"]\n",
"grp_df = df[grp_cols].groupby(by=grp_cols).count().reset_index()\n",
"grp_df.groupby(\"Customer_Hierarchy\").nunique()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "01ed02b9c8fd"
},
"source": [
"Check the percentage changes in the orders based on the percentage changes in the price."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b2c428cb135"
},
"outputs": [],
"source": [
"# aggregate the data\n",
"df_aggr = (\n",
" df.groupby([\"Product_ID\", \"List_Price_Converged\"])\n",
" .agg({\"Fiscal_Date\": min, \"Invoiced_quantity_in_Pieces\": sum, \"Net_Sales\": sum})\n",
" .reset_index()\n",
")\n",
"# rename the aggregated columns\n",
"df_aggr.rename(\n",
" columns={\n",
" \"Fiscal_Date\": \"First_price_date\",\n",
" \"Invoiced_quantity_in_Pieces\": \"Total_ordered_pieces\",\n",
" \"Net_Sales\": \"Total_net_sales\",\n",
" },\n",
" inplace=True,\n",
")\n",
"\n",
"# sort values chronologically\n",
"df_aggr.sort_values(by=[\"Product_ID\", \"First_price_date\"], inplace=True)\n",
"df_aggr.reset_index(drop=True, inplace=True)\n",
"\n",
"# add columns for previous values\n",
"df_aggr[\"Previous_List\"] = df_aggr.groupby([\"Product_ID\"])[\n",
" \"List_Price_Converged\"\n",
"].shift()\n",
"df_aggr[\"Previous_Total_ordered_pieces\"] = df_aggr.groupby([\"Product_ID\"])[\n",
" \"Total_ordered_pieces\"\n",
"].shift()\n",
"\n",
"# average price change across sku's\n",
"df_aggr[\"price_change_perc\"] = (\n",
" (df_aggr[\"List_Price_Converged\"] - df_aggr[\"Previous_List\"])\n",
" / df_aggr[\"Previous_List\"].fillna(0)\n",
" * 100\n",
")\n",
"df_aggr[\"order_change_perc\"] = (\n",
" (df_aggr[\"Total_ordered_pieces\"] - df_aggr[\"Previous_Total_ordered_pieces\"])\n",
" / df_aggr[\"Previous_Total_ordered_pieces\"].fillna(0)\n",
" * 100\n",
")\n",
"\n",
"# plot a scatterplot to visualize the changes\n",
"sns.scatterplot(\n",
" x=\"price_change_perc\",\n",
" y=\"order_change_perc\",\n",
" data=df_aggr,\n",
" hue=\"Product_ID\",\n",
" legend=False,\n",
")\n",
"plt.title(\"Percentage of change in price vs order\")\n",
"plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8259e916fe25"
},
"source": [
"For most of the products, the percentage change in orders are high where the percentage changes in the prices are low. This suggests that too much change in the prices can affect the number of orders. \n",
"\n",
"**Note**: There seem to be some outliers in the data as percentage changes greater than 800 are found. In the current exercise, do not take any manual measures to deal with outliers as you will create a BigQuery ML timeseries model that already deals with outliers.\n",
"\n",
"## Preprocess the data for training\n",
"<a name=\"section-8\"></a>\n",
"\n",
"Check which `Product_ID`'s have the maximum orders."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f5cbc7709c6a"
},
"outputs": [],
"source": [
"df_orders = df.groupby([\"Product_ID\", \"Customer_Hierarchy\"], as_index=False)[\n",
" \"Invoiced_quantity_in_Pieces\"\n",
"].sum()\n",
"df_orders.loc[\n",
" df_orders.groupby(\"Customer_Hierarchy\")[\"Invoiced_quantity_in_Pieces\"].idxmax()\n",
"]"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fd6d227e513e"
},
"source": [
"From the above result, you can infer the following:\n",
"\n",
"- Under the **Food** category, **SKU 62** has the maximum orders.\n",
"- Under the **Manufacturing** category, **SKU 17** has the maximum orders.\n",
"- Under the **Paper** category, **SKU 107** has the maximum orders.\n",
"- Under the **Publishing** category, **SKU 8** has the maximum orders.\n",
"- Under the **Utilities** category, **SKU 140** has the maximum orders.\n",
"\n",
"Given that there are too many ids and only a few records for most of them, consider only the above `Product_ID`s for which there are a maximum number of orders. \n",
"\n",
"**Note**: The `Invoiced_quantity_in_Pieces` field seems to be a *float* type rather than an *int* type as it should be. This could be because the data itself might be averaged in the first place."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "2dbc0d64d157"
},
"source": [
"Check the various prices available for these `Product_ID`s."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "acc1dbd2d838"
},
"outputs": [],
"source": [
"df_type_food = df[(df[\"Product_ID\"] == \"SKU 62\") & (df[\"Customer_Hierarchy\"] == \"Food\")]\n",
"print(\"Food :\")\n",
"print(df_type_food[\"List_Price_Converged\"].value_counts())\n",
"df_type_manuf = df[\n",
" (df[\"Product_ID\"] == \"SKU 17\") & (df[\"Customer_Hierarchy\"] == \"Manufacturing\")\n",
"]\n",
"print(\"Manufacturing :\")\n",
"print(df_type_manuf[\"List_Price_Converged\"].value_counts())\n",
"df_type_paper = df[\n",
" (df[\"Product_ID\"] == \"SKU 107\") & (df[\"Customer_Hierarchy\"] == \"Paper\")\n",
"]\n",
"print(\"Paper :\")\n",
"print(df_type_paper[\"List_Price_Converged\"].value_counts())\n",
"df_type_pub = df[\n",
" (df[\"Product_ID\"] == \"SKU 8\") & (df[\"Customer_Hierarchy\"] == \"Publishing\")\n",
"]\n",
"print(\"Publishing :\")\n",
"print(df_type_pub[\"List_Price_Converged\"].value_counts())\n",
"df_type_util = df[\n",
" (df[\"Product_ID\"] == \"SKU 140\") & (df[\"Customer_Hierarchy\"] == \"Utilities\")\n",
"]\n",
"print(\"Utilities :\")\n",
"print(df_type_util[\"List_Price_Converged\"].value_counts())"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f023af578c0f"
},
"source": [
"In the publishing category, `Product_ID` `SKU 8` and `SKU 17` are less than or equal to two different prices in the entire data and so you will exclude them and consider the rest for building the forecast model. The idea here is to train a forecast model on the timeseries data for products with different prices.\n",
"\n",
"Join the data for all the `Product_ID`s into one dataframe and remove duplicate records."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a44771cc4c20"
},
"outputs": [],
"source": [
"df_final = pd.concat([df_type_food, df_type_paper, df_type_util])\n",
"df_final = (\n",
" df_final[\n",
" [\n",
" \"Product_ID\",\n",
" \"Fiscal_Date\",\n",
" \"Customer_Hierarchy\",\n",
" \"List_Price_Converged\",\n",
" \"Invoiced_quantity_in_Pieces\",\n",
" ]\n",
" ]\n",
" .drop_duplicates()\n",
" .reset_index(drop=True)\n",
")\n",
"df_final.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "add5063df368"
},
"source": [
"Save the data to a BigQuery table."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fd82ba56571f"
},
"outputs": [],
"source": [
"bq_client = bigquery.Client(project=PROJECT_ID)\n",
"\n",
"job_config = bigquery.LoadJobConfig(\n",
" # Specify a (partial) schema. All columns are always written to the\n",
" # table. The schema is used to assist in data type definitions.\n",
" schema=[\n",
" bigquery.SchemaField(\"Product_ID\", bigquery.enums.SqlTypeNames.STRING),\n",
" bigquery.SchemaField(\"Fiscal_Date\", bigquery.enums.SqlTypeNames.DATE),\n",
" bigquery.SchemaField(\"List_Price_Converged\", bigquery.enums.SqlTypeNames.FLOAT),\n",
" bigquery.SchemaField(\n",
" \"Invoiced_quantity_in_Pieces\", bigquery.enums.SqlTypeNames.FLOAT\n",
" ),\n",
" ],\n",
" # Optionally, set the write disposition. BigQuery appends loaded rows\n",
" # to an existing table by default, but with WRITE_TRUNCATE write\n",
" # disposition it replaces the table with the loaded data.\n",
" write_disposition=\"WRITE_TRUNCATE\",\n",
")\n",
"\n",
"# save the dataframe to a table in the created dataset\n",
"job = bq_client.load_table_from_dataframe(\n",
" df_final,\n",
" \"{}.{}.{}\".format(PROJECT_ID, DATASET, TRAINING_DATA_TABLE),\n",
" job_config=job_config,\n",
") # Make an API request.\n",
"job.result() # Wait for the job to complete."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "fca77641b03b"
},
"source": [
"# Train the model using BigQuery ML\n",
"<a name=\"section-9\"></a>\n",
"\n",
"Train an [Arima-Plus](https://cloud.google.com/bigquery-ml/docs/reference/standard-sql/bigqueryml-syntax-create-time-series) model on the data using BigQuery ML."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cded27507891"
},
"source": [
"#@bigquery\n",
"create or replace model pricing_optimization.bqml_arima\n",
"options\n",
" (model_type = 'ARIMA_PLUS',\n",
" time_series_timestamp_col = 'Fiscal_Date',\n",
" time_series_data_col = 'Invoiced_quantity_in_Pieces',\n",
" time_series_id_col = 'ID'\n",
" ) as\n",
"select\n",
" Fiscal_Date,\n",
" Concat(Product_ID,\"_\" ,Cast(List_Price_Converged as string)) as ID,\n",
" Invoiced_quantity_in_Pieces\n",
"from\n",
" pricing_optimization.TRAINING_DATA\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "332fd11ff32b"
},
"source": [
"## Generate forecasts from the model\n",
"<a name=\"section-10\"></a>\n",
"\n",
"Predict the sales for the next 30 days for each id and save to a dataframe."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ef926cdbf28e"
},
"outputs": [],
"source": [
"client = Client()\n",
"\n",
"query = '''\n",
"DECLARE HORIZON STRING DEFAULT \"30\"; #number of values to forecast\n",
"DECLARE CONFIDENCE_LEVEL STRING DEFAULT \"0.90\"; ## required confidence level\n",
"\n",
"EXECUTE IMMEDIATE format(\"\"\"\n",
" SELECT\n",
" *\n",
" FROM \n",
" ML.FORECAST(MODEL pricing_optimization.bqml_arima, \n",
" STRUCT(%s AS horizon, \n",
" %s AS confidence_level)\n",
" )\n",
" \"\"\",HORIZON,CONFIDENCE_LEVEL)'''\n",
"job = client.query(query)\n",
"dfforecast = job.to_dataframe()\n",
"dfforecast.head()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "608c7de72dae"
},
"source": [
"## Interpret the results to choose the best price\n",
"<a name=\"section-11\"></a>\n",
"\n",
"Calculate average forecast values for the forecast duration."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e1e193680400"
},
"outputs": [],
"source": [
"dfforecast_avg = (\n",
" dfforecast[[\"ID\", \"forecast_value\"]].groupby(\"ID\", as_index=False).mean()\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5ce395d652a3"
},
"source": [
"Extract the ID and Price fields from the ID field."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "452c56fa58ed"
},
"outputs": [],
"source": [
"dfforecast_avg[\"Product_ID\"] = dfforecast_avg[\"ID\"].apply(lambda x: x.split(\"_\")[0])\n",
"dfforecast_avg[\"Price\"] = dfforecast_avg[\"ID\"].apply(lambda x: x.split(\"_\")[1])"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3cee67f4028f"
},
"source": [
"Plot the average forecasted sales vs. the price of the product."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fb351c8f383d"
},
"outputs": [],
"source": [
"for i in dfforecast_avg[\"Product_ID\"].unique():\n",
" dfforecast_avg[dfforecast_avg[\"Product_ID\"] == i].set_index(\"Price\").sort_values(\n",
" \"forecast_value\"\n",
" ).plot(kind=\"bar\")\n",
" plt.title(\"Price vs. Average Sales for \" + i)\n",
" plt.show()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "67ff3acc74a5"
},
"source": [
"Based on the plots for price vs. the average forecasted orders, it can be said that to use the maximum orders, each of the considered `Product_ID`s can follow the below prices:\n",
"\n",
"- SKU 107's price range can be from 4.44 - 4.73 units\n",
"- SKU 140's price can be 1.95 units\n",
"- SKU 62's price can be 4.23 units\n",
"\n",
"\n",
"## Clean Up\n",
"<a name=\"section-12\"></a>\n",
"\n",
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial. The following code deletes the entire dataset."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d78908b8134d"
},
"outputs": [],
"source": [
"# Construct a BigQuery client object.\n",
"client = bigquery.Client()\n",
"\n",
"# TODO(developer): Set model_id to the ID of the model to fetch.\n",
"dataset_id = \"{PROJECT}.{DATASET}\".format(PROJECT=PROJECT_ID, DATASET=DATASET)\n",
"\n",
"# Use the delete_contents parameter to delete a dataset and its contents.\n",
"# Use the not_found_ok parameter to not receive an error if the dataset has already been deleted.\n",
"client.delete_dataset(\n",
" dataset_id, delete_contents=True, not_found_ok=True\n",
") # Make an API request.\n",
"\n",
"print(\"Deleted dataset '{}'.\".format(dataset_id))"
]
}
],
"metadata": {
"colab": {
"name": "pricing-optimization.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -459,7 +459,7 @@
},
"outputs": [],
"source": [
"! gsutil cp gs://cloud-samples-data/ai-platform-unified/matching_engine/glove-100-angular.hdf5 ."
"! gsutil cp gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5 ."
]
},
{
File diff suppressed because it is too large Load Diff
+1 -1
View File
@@ -13,6 +13,6 @@ The purpose of this set of notebooks and markdown files is to demonstrate Google
3. [Formalization](stage3)
4. [Evaluation](stage4)
5. Deployment
6. Serving
6. [Serving](stage6)
7. Monitoring
8. Continuous Training
@@ -30,10 +30,66 @@ The first stage in MLOps is the collection and preparation for the purpose of de
[Get Started with BQ datasets](get_started_bq_datasets.ipynb)
```
The steps performed include:
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- compatible for `AutoML` training.
- Extract a copy of the dataset from `BigQuery` to a CSV file in Cloud Storage -- compatible for `AutoML` or custom training.
- Select rows from a `BigQuery` dataset into a `pandas` dataframe -- compatible for custom training.
- Select rows from a `BigQuery` dataset into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
- Select rows from extracted CSV files into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
- Create a `BigQuery` dataset from CSV files.
- Extract data from `BigQuery` table into a `DMatrix` -- compatible for custom training `XGBoost` models.
```
[Get Started with Vertex datasets](get_started_vertex_datasets.ipynb)
```
The steps performed include:
- Create a Vertex AI `Dataset` resource for:
- image data
- text data
- video data
- tabular data
- forecasting data
- Search `Dataset` resources using a filter.
- Read a sample of a `BigQuery` dataset into a dataframe.
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
- Detect anomalies in new data using TensorFlow Data Validation.
- Generate a TFRecord feature specification using TensorFlow Transform from the data schema.
- Export a dataset and convert to TFRecords.
```
[Get Started with Dataflow](get_started_dataflow.ipynb)
```
The steps performed include:
- Offline preprocessing of data:
- Serially - w/o dataflow
- Parallel - with dataflow
- Upstream preprocessing of data:
- tabular data
- image data
```
### E2E Stage Example
[Stage 1: Data Management](mlops_data_management.ipynb)
```
The steps performed include:
- Explore and visualize the data.
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- for AutoML training.
- Extract a copy of the dataset to a CSV file in Cloud Storage.
- Create a Vertex AI `Dataset` resource from CSV files -- alternative for AutoML training.
- Read a sample of the `BigQuery` dataset into a dataframe.
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
- Generate a TFRecord feature specification using TensorFlow Data Validation from the data schema.
- Preprocess a portion of the BigQuery data using `Dataflow` -- for custom training.
```
@@ -676,6 +676,31 @@
"dataframe[\"station_number\"] = pd.to_numeric(dataframe[\"station_number\"])"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bqml_create_dataset"
},
"source": [
"### Create BQ dataset resource\n",
"\n",
"First, you create an empty dataset resource in your project."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bqml_create_dataset"
},
"outputs": [],
"source": [
"BQ_MY_DATASET = 'samples'\n",
"BQ_MY_TABLE = 'gsod'\n",
"! bq --location=US mk -d \\\n",
"$PROJECT_ID:$BQ_MY_DATASET"
]
},
{
"cell_type": "code",
"execution_count": null,
+164 -2
View File
@@ -33,18 +33,180 @@ The second stage in MLOps is experimenting in developing one or more baseline mo
[Get Started with Vertex Experiments and Vertex ML Metadata](get_started_vertex_experiments.ipynb)
```
The steps performed include:
- Use Python logging to log training configuration/results locally.
- Use Google Cloud Logging to log training configuration/results in cloud storage.
- Create a Vertex AI `Experiment` resource.
- Instantiate an experiment run.
- Log parameters for the run.
- Log metrics for the run.
- Display the logged experiment run.
```
[Get Started with Vertex TensorBoard](get_started_vertex_tensorboard.ipynb)
[Get Started with Custom Training Packages](get_started_vertex_training.ipynb)
```
The steps performed include:
- Create a TensorBoard callback when training a model.
- Using Tensorboard with locally trained model.
- Using Vertex AI TensorBoard with Vertex AI Training.
```
[Get Started with Custom Training Packages (Tensorflow)](get_started_vertex_training.ipynb)
```
The steps performed include:
- Training using a single Python script.
- Training using a Python package.
- Training using a custom training image.
- Laying out a training package.
```
[Get Started with Custom Training Packages (Scikit-Learn)](get_started_vertex_training_sklearn.ipynb)
```
The steps performed include:
- Training using a Python package.
- Report accuracy when hyperparameter tuning.
- Save the model artifacts to Cloud Storage using GCSFuse.
- Create a `Vertex AI Model` resource.
```
[Get Started with Custom Training Packages (XGBoost)](get_started_vertex_training_xgboost.ipynb)
```
The steps performed include:
- Training using a Python package.
- Report accuracy when hyperparameter tuning.
- Save the model artifacts to Cloud Storage using GCSFuse.
- Create a `Vertex AI Model` resource.
```
[Get Started with Custom Training Packages (Pytorch)](get_started_vertex_training_pytorch.ipynb)
```
The steps performed include:
- Single node training using a Python package.
- Report accuracy when hyperparameter tuning.
- Save the model artifacts to Cloud Storage using GCSFuse.
- Create a `Vertex AI Model` resource.
```
[Get Started with Custom Training Packages (R)](get_started_vertex_training_r.ipynb)
```
The steps performed include:
- Locally train an R model in a notebook using %%R magic commands
- Create a deployment image with trained R model and serving functions.
- Test the deployment image locally.
- Create a `Vertex AI Model` resource for the deployment image with embedded R model.
- Deploy the deployment image with embedded R model to a `Vertex AI Endpoint` resource.
- Test the deployment image with embedded R model.
- Create a R-to-Python training package.
- Create a training image for training the model.
- Train a R model using `Vertex AI Trainingh` service with the R-to-Python training package.
```
[Get Started with Distributed Training](get_started_vertex_distributed_training.ipynb)
```
The steps performed include:
- `MirroredStrategy`: Train on a single VM with multiple GPUs.
- `MultiWorkerMirroredStrategy`: Train on multiple VMs with automatic setup of replicas.
- `MultiWorkerMirroredStrategy`: Train on multiple VMs with fine grain control of replicas.
- `ReductionServer`: Train on multiple VMS and sync updates across VMS with `Vertex AI Reduction Server`.
- `TPUTraining`: Train with multiple Cloud TPUs.
```
[Get Started with Vizier Hyperparameter Tuning](get_started_vertex_vizier.ipynb)
```
The steps performed include:
- Hyperparameter tuning with Random algorithm.
- Hyperparameter tuning with Vizier (Bayesian) algorithm.
```
[Get Started with AutoML Training](get_started_automl_training.ipynb)
[Get Started with BQML Training](get_started_bqml_training.ipyn)
```
The steps performed include:
- Train an image model.
- Export the image model as an edge model.
- Train a tabular model.
- Export the tabular model as a cloud model.
- Train a text model.
```
[Get Started with BQML Training](get_started_bqml_training.ipynb)
```
The steps performed include:
- Create a local BQ table in your project.
- Train a BQML model.
- Evaluate the BQML model.
- Export the BQML model as a cloud model.
- Upload the exported model as a Vertex AI Model resource.
- Hyperparameter tune a BQML model with Vertex AI Vizier.
```
[Get Started with Vertex Feature Store](get_started_vertex_feature_store.ipynb)
```
The steps performed include:
- Creating a Vertex AI `Featurestore` resource.
- Creating `EntityType` resources for the `Featurestore` resource.
- Creating `Feature` resources for each `EntityType` resource.
- Import feature values (entity data items) into `Featurestore` resource from Cloud Storage.
- Import feature values (entity data items) into `Featurestore` resource from pandas DataFrame.
- Perform online serving from a `Featurestore` resource.
- Perform batch serving from a `Featurestore` resource.
```
[Get Started with Google CMEK Training](get_started_with_cmek_training.ipynb)
```
The steps performed include:
- Creating a customer managed encryption key.
- Creating an image dataset with CMEK encryption.
- Train an AutoML model with CMEK encryption.
```
### E2E Stage Example
[Stage 2: Experimentation](mlops_experimentation.ipynb)
```
The steps performed include:
- Review the `Dataset` resource created during stage 1.
- Train an AutoML tabular binary classifier model in the background.
- Build the experimental model architecture.
- Construct a custom training package for the `Dataset` resource.
- Test the custom training package locally.
- Test the custom training package in the cloud with Vertex AI Training.
- Hyperparameter tune the model training with Vertex AI Vizier.
- Train the custom model with Vertex AI Training.
- Add a serving function for online/batch prediction to the custom model.
- Test the custom model with the serving function.
- Evaluate the custom model using Vertex AI Batch Prediction
- Wait for the AutoML training job to complete.
- Evaluate the AutoML model using Vertex AI Batch Prediction with the same evaluation slices as the custom model.
- Set the evaluation results of the AutoML model as the baseline.
- If the evaluation of the custom model is below baseline, continue to experiment with the custom model.
- If the evaluation of the custom model is above baseline, save the model as the first best model.
```
File diff suppressed because it is too large Load Diff
@@ -87,10 +87,11 @@
"\n",
"The steps performed include:\n",
"\n",
"- `MirroredStrategy`: Train on single VM with multiple GPUs.\n",
"- `MirroredStrategy`: Train on a single VM with multiple GPUs.\n",
"- `MultiWorkerMirroredStrategy`: Train on multiple VMs with automatic setup of replicas.\n",
"- `MultiWorkerMirroredStrategy`: Train on multiple VMs with fine grain control of replicas.\n",
"- `ReductionServer`: Train on multiple VMS and sync updates across VMS with Vertex AI Reduction Server"
"- `ReductionServer`: Train on multiple VMS and sync updates across VMS with `Vertex AI Reduction Server`.\n",
"- `TPUTraining`: Train with multiple Cloud TPUs."
]
},
{
@@ -154,7 +155,9 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG"
]
},
{
@@ -1544,6 +1547,233 @@
"job.delete()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "tpu_intro"
},
"source": [
"## Cloud TPU Training\n",
"\n",
"To further speed up trainig, your organization can utilize Google's Cloud Tensor Processing Units (TPU) pods.\n",
"\n",
"Cloud TPU is the custom-designed machine learning ASIC that powers Google products like Translate, Photos, Search, Assistant, and Gmail. Cloud TPU is designed to run cutting-edge machine learning models with AI services on Google Cloud. And its custom high-speed network offers over 100 petaflops of performance in a single pod.\n",
"\n",
"Learn more about [Cloud TPU](https://cloud.google.com/tpu)\n",
"\n",
"*Note*: TPU VM Training is currently an opt-in feature. Your GCP project must first be added to the feature allowlist. Please email your project information(project id/number) to vertex-ai-tpu-vm-training-support@google.com for the allowlist. You will receive an email as soon as your project is ready."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "docker_write:tpu"
},
"source": [
"### Write Docker file for TPU training\n",
"\n",
"Currently, there is no pre-built Vertex AI Docker image for training with TPUs. No problems, you can make your own, as follows:\n",
"\n",
"1. Create a vanilla Python 3 image (e.g., `python3:8`).\n",
"2. Get and install the TPU library (`libtpu.so`).\n",
"3. Copy in your training package"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "docker_write:tpu"
},
"outputs": [],
"source": [
"%%writefile custom/Dockerfile\n",
"FROM python:3.8\n",
"\n",
"WORKDIR /root\n",
"\n",
"# Copies the trainer code to the docker image.\n",
"COPY trainer /trainer\n",
"\n",
"RUN pip3 install tensorflow-datasets\n",
"\n",
"# Install TPU Tensorflow and dependencies.\n",
"# libtpu.so must be under the '/lib' directory.\n",
"RUN wget https://storage.googleapis.com/cloud-tpu-tpuvm-artifacts/libtpu/20210525/libtpu.so -O /lib/libtpu.so\n",
"RUN chmod 777 /lib/libtpu.so\n",
"\n",
"RUN wget https://storage.googleapis.com/cloud-tpu-tpuvm-artifacts/tensorflow/20210525/tf_nightly-2.6.0-cp38-cp38-linux_x86_64.whl\n",
"RUN pip3 install tf_nightly-2.6.0-cp38-cp38-linux_x86_64.whl\n",
"RUN rm tf_nightly-2.6.0-cp38-cp38-linux_x86_64.whl\n",
"# Sets up the entry point to invoke the trainer.\n",
"ENTRYPOINT [\"python\", \"-m\", \"trainer.task\"]"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "docker_push:tpu"
},
"source": [
"### Build and push the Docker image to the Artifact Registry"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "docker_push:tpu"
},
"outputs": [],
"source": [
"TRAIN_IMAGE = f\"gcr.io/\" + PROJECT_ID + \"/tpu-train:latest\"\n",
"\n",
"os.chdir(\"custom\")\n",
"! docker build --quiet --tag={TRAIN_IMAGE} .\n",
"! docker push {TRAIN_IMAGE}\n",
"os.chdir(\"..\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "worker_pool_tpu"
},
"source": [
"### TPU worker specification pool\n",
"\n",
"Next, you create the worker specification pool. For TPUs, you do:\n",
"\n",
"- Create only one worker pool (Primary).\n",
"- Set the machine type to `cloud-tpu`.\n",
"- Set the accelerator type to a `TPU`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "worker_pool_tpu"
},
"outputs": [],
"source": [
"# Use TPU Accelerators. Temporarily using numeric codes, until types are added to the SDK\n",
"# 6 = TPU_V2\n",
"# 7 = TPU_V3\n",
"TRAIN_TPU, TRAIN_NTPU = (7, 8)\n",
"TRAIN_COMPUTE = \"cloud-tpu\"\n",
"\n",
"\n",
"if not TRAIN_NTPU or TRAIN_NTPU < 2:\n",
" TRAIN_STRATEGY = \"single\"\n",
"else:\n",
" TRAIN_STRATEGY = \"tpu\"\n",
"print(TRAIN_STRATEGY)\n",
"\n",
"EPOCHS = 20\n",
"STEPS = 10000\n",
"\n",
"TRAINER_ARGS = [\n",
" \"--epochs=\" + str(EPOCHS),\n",
" \"--steps=\" + str(STEPS),\n",
" \"--distribute=\" + TRAIN_STRATEGY,\n",
"]\n",
"\n",
"\n",
"WORKER_POOL_SPECS = [\n",
" {\n",
" \"container_spec\": {\n",
" \"args\": TRAINER_ARGS,\n",
" \"image_uri\": TRAIN_IMAGE,\n",
" },\n",
" \"replica_count\": 1,\n",
" \"machine_spec\": {\n",
" \"machine_type\": TRAIN_COMPUTE,\n",
" \"accelerator_type\": TRAIN_TPU,\n",
" \"accelerator_count\": TRAIN_NTPU,\n",
" },\n",
" }\n",
"]\n",
"\n",
"print(WORKER_POOL_SPECS[0])"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "custom_job:worker_pool"
},
"source": [
"### Create CustomJob with worker pool specifications\n",
"\n",
"Next, you create a `CustomJob` for the multi-worker distributed training job:\n",
"\n",
"-`display_name`: The display name for the custom job.\n",
"\n",
"-`worker_pool_specs`: The detailed specifications for each worker pool."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "custom_job:worker_pool"
},
"outputs": [],
"source": [
"DISPLAY_NAME = \"boston_\" + TIMESTAMP\n",
"\n",
"job = aip.CustomJob(display_name=DISPLAY_NAME, worker_pool_specs=WORKER_POOL_SPECS)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "run_custom_job:multiworker"
},
"source": [
"### Run the CustomJob\n",
"\n",
"Next, you run the custom job."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "run_custom_job:multiworker"
},
"outputs": [],
"source": [
"try:\n",
" job.run(sync=True)\n",
"except Exception as e:\n",
" # may fail in multi-worker to find startup script\n",
" print(e)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "delete_job"
},
"source": [
"### Delete a custom training job\n",
"\n",
"After a training job is completed, you can delete the training job with the method `delete()`. Prior to completion, a training job can be canceled with the method `cancel()`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "delete_job"
},
"outputs": [],
"source": [
"job.delete()"
]
},
{
"cell_type": "markdown",
"metadata": {
File diff suppressed because it is too large Load Diff
@@ -623,7 +623,7 @@
"In summary:\n",
"\n",
"- Get the directory where to save the model artifacts from the command line (`--model_dir`), and if not specified, then from the environment variable `AIP_MODEL_DIR`.\n",
"- Open a file \"test.txt\" in the directory where to sace the model artifacts.\n",
"- Open a file \"test.txt\" in the directory where to save the model artifacts.\n",
"- Write \"hello world\" to the file."
]
},
@@ -848,7 +848,7 @@
"\n",
"- Get the directory where to save the model artifacts from the command line (`--model_dir`), and if not specified, then from the environment variable `AIP_MODEL_DIR`.\n",
"- Get the number of epochs to run from the command line (`--model_dir`).\n",
"- Open a file \"test.txt\" in the directory where to sace the model artifacts.\n",
"- Open a file \"test.txt\" in the directory where to save the model artifacts.\n",
"- Repeat appending \"hello world\" to the file, one per epoch."
]
},
@@ -1045,7 +1045,7 @@
"\n",
"- Get the directory where to save the model artifacts from the command line (`--model_dir`), and if not specified, then from the environment variable `AIP_MODEL_DIR`.\n",
"- Get the number of epochs to run from the command line (`--model_dir`).\n",
"- Open a file \"test.txt\" in the directory where to sace the model artifacts.\n",
"- Open a file \"test.txt\" in the directory where to save the model artifacts.\n",
"- Repeat appending \"hello world\" to the file, one per epoch."
]
},
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -39,10 +39,11 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_vizier.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_vertex_vizier.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
" </td> \n",
"</table>\n",
"<br/><br/><br/>"
]
@@ -139,6 +140,25 @@
"Install *one time* the packages for executing the MLOps notebooks."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "1fd00fa70a2a"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"# The Google Cloud Notebook product has specific requirements\n",
"IS_GOOGLE_CLOUD_NOTEBOOK = os.path.exists(\"/opt/deeplearning/metadata/env_version\")\n",
"\n",
"# Google Cloud Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_GOOGLE_CLOUD_NOTEBOOK:\n",
" USER_FLAG = \"--user\""
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -147,20 +167,8 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" "
]
},
{
@@ -268,7 +276,9 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type:\"string\"}\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -318,7 +328,7 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_URI = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
]
},
{
@@ -329,8 +339,8 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_URI = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
]
},
{
@@ -350,7 +360,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -370,7 +380,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -415,7 +425,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
"aip.init(project=PROJECT_ID, staging_bucket=BUCKET_URI)"
]
},
{
@@ -808,7 +818,7 @@
"! rm -f custom.tar custom.tar.gz\n",
"! tar cvf custom.tar custom\n",
"! gzip custom.tar\n",
"! gsutil cp custom.tar.gz $BUCKET_NAME/trainer_boston.tar.gz"
"! gsutil cp custom.tar.gz $BUCKET_URI/trainer_boston.tar.gz"
]
},
{
@@ -916,7 +926,7 @@
"outputs": [],
"source": [
"JOB_NAME = \"custom_job_\" + TIMESTAMP\n",
"MODEL_DIR = \"{}/{}\".format(BUCKET_NAME, JOB_NAME)\n",
"MODEL_DIR = \"{}/{}\".format(BUCKET_URI, JOB_NAME)\n",
"\n",
"if not TRAIN_NGPU or TRAIN_NGPU < 2:\n",
" TRAIN_STRATEGY = \"single\"\n",
@@ -948,7 +958,7 @@
" \"disk_spec\": disk_spec,\n",
" \"python_package_spec\": {\n",
" \"executor_image_uri\": TRAIN_IMAGE,\n",
" \"package_uris\": [BUCKET_NAME + \"/trainer_boston.tar.gz\"],\n",
" \"package_uris\": [BUCKET_URI + \"/trainer_boston.tar.gz\"],\n",
" \"python_module\": \"trainer.task\",\n",
" \"args\": CMDARGS,\n",
" },\n",
@@ -1577,14 +1587,6 @@
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
]
},
@@ -1596,61 +1598,8 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if os.getenv(\"IS_TESTING\"):\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],
@@ -0,0 +1,874 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "VBOfRw7ifk8w"
},
"outputs": [],
"source": [
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "title:generic,gcp"
},
"source": [
"# E2E ML on GCP: MLOps stage 2 : AutoML Image Classfication Training with Customer Managed Encryption Keys (CMEK)\n",
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_with_cmek_training.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage2/get_started_with_cmek_training.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" </a>\n",
" </td>\n",
"</table>\n",
"<br/><br/><br/>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "overview:mlops"
},
"source": [
"## Overview\n",
"\n",
"\n",
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 2 : experimentation: get started with AutoML training with a customer managed encyrption key CMEK."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dataset:flowers,icn"
},
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the [Flowers dataset](https://www.tensorflow.org/datasets/catalog/tf_flowers) from [TensorFlow](https://www.tensorflow.org/datasets/catalog/overview). The version of the dataset you will use in this tutorial is stored in a public #(GCS) bucket. The trained model predicts the type of flower an image is from a class of five flowers: daisy, dandelion, rose, sunflower, or tulip.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "objective:mlops,stage3,get_started_automl_pipeline_components"
},
"source": [
"### Objective\n",
"\n",
"In this tutorial, you learn how to use a customer managed encryption key (CMEK) for `Vertex AI AutoML` training.\n",
"\n",
"This tutorial uses the following Google Cloud ML services:\n",
"\n",
"- `Vertex AI AutoML`\n",
"- Customer managed encryption key.\n",
"\n",
"The steps performed include:\n",
"\n",
"- Creating a customer managed encryption key.\n",
"- Creating an image dataset with CMEK encryption.\n",
"- Train an AutoML model with CMEK encryption."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "install_mlops"
},
"source": [
"## Installations\n",
"\n",
"Install the Vertex AI SDK and the KMS package for CMEK encryption."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "sBfZtR4X1Dr_"
},
"outputs": [],
"source": [
"USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG\n",
"! pip3 install --upgrade google-cloud-kms $USER_FLAG"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "restart"
},
"source": [
"### Restart the kernel\n",
"\n",
"Once you've installed the additional packages, you need to restart the notebook kernel so it can find the packages."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "restart"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" # Automatically restart kernel after installs\n",
" import IPython\n",
"\n",
" app = IPython.Application.instance()\n",
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "project_id"
},
"source": [
"#### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "set_project_id"
},
"outputs": [],
"source": [
"PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "autoset_project_id"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None or PROJECT_ID == \"[your-project-id]\":\n",
" # Get your GCP project id from gcloud\n",
" shell_output = ! gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID:\", PROJECT_ID)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "set_gcloud_project_id"
},
"outputs": [],
"source": [
"! gcloud config set project $PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "region"
},
"source": [
"#### Region\n",
"\n",
"You can also change the `REGION` variable, which is used for operations\n",
"throughout the rest of this notebook. Below are regions supported for Vertex AI. We recommend that you choose the region closest to you.\n",
"\n",
"- Americas: `us-central1`\n",
"- Europe: `europe-west4`\n",
"- Asia Pacific: `asia-east1`\n",
"\n",
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
"\n",
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "region"
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "timestamp"
},
"source": [
"#### Timestamp\n",
"\n",
"If you are in a live tutorial session, you might be using a shared test account or project. To avoid name collisions between users on resources created, you create a timestamp for each instance session, and append the timestamp onto the name of resources you create in this tutorial."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "timestamp"
},
"outputs": [],
"source": [
"from datetime import datetime\n",
"\n",
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bucket:mbsdk"
},
"source": [
"### Create a Cloud Storage bucket\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"When you initialize the Vertex SDK for Python, you specify a Cloud Storage staging bucket. The staging bucket is where all the data associated with your dataset and model resources are retained across sessions.\n",
"\n",
"Set the name of your Cloud Storage bucket below. Bucket names must be globally unique across all Google Cloud projects, including those outside of your organization."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bucket"
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "autoset_bucket"
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "create_bucket"
},
"source": [
"**Only if your bucket doesn't already exist**: Run the following cell to create your Cloud Storage bucket."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "create_bucket"
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "validate_bucket"
},
"source": [
"Finally, validate access to your Cloud Storage bucket by examining its contents:"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "validate_bucket"
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "setup_vars"
},
"source": [
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_aip:mbsdk"
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip\n",
"from google.cloud import kms"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "init_aip:mbsdk,all"
},
"source": [
"### Initialize Vertex AI SDK for Python\n",
"\n",
"Initialize the Vertex AI SDK for Python for your project and corresponding bucket."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "init_aip:mbsdk,all"
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, location=REGION, staging_bucket=BUCKET_NAME)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "mRk9eoTm6Pyi"
},
"source": [
"## Setting up Customer Managed Encryption Keys\n",
"\n",
"By default, Google Cloud automatically encrypts data when it is stored in Cloud Storage using encryption keys managed by Google. If you have specific compliance or regulatory requirements related to the keys that protect your data, you can use customer-managed encryption keys (CMEK) for your training jobs.\n",
"\n",
"### Enable KMS API\n",
"\n",
"First, you enble the [Cloud Key Management Service (KMS)](https://console.cloud.google.com/flows/enableapi?apiid=cloudkms.googleapis.com)\n",
"\n",
"Learn more about [Customer managed encryption keys (CMEK)](https://cloud.google.com/vertex-ai/docs/general/cmek)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "RD_Pvrg584X3"
},
"source": [
"### Create a key ring\n",
"\n",
"After you have enabled the KMS API, you create a key ring and a key. Use the helper function `create_key_ring()` to create a key ring, with the following parameters:\n",
"\n",
"- `project_id`: Your project ID.\n",
"- `location`: Your region.\n",
"- `key_ring_id`: The unique identifier for your key ring.\n",
"\n",
"The helper function calls the KMS client method `create_key_ring()` to create your key ring.\n",
"\n",
"Learn more about [KMS: Create a key ring](https://cloud.google.com/kms/docs/samples/kms-create-key-ring)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "dxRZzbvQnZC7"
},
"outputs": [],
"source": [
"KEY_RING_ID = \"your_cmek_key_ring_id\"\n",
"\n",
"\n",
"def create_key_ring(project_id, location, key_ring_id):\n",
" \"\"\"\n",
" Creates a new key ring in Cloud KMS\n",
"\n",
" Args:\n",
" project_id (string): Google Cloud project ID (e.g. 'my-project').\n",
" location (string): Cloud KMS location (e.g. 'us-east1').\n",
" id (string): ID of the key ring to create (e.g. 'my-key-ring').\n",
"\n",
" Returns:\n",
" KeyRing: Cloud KMS key ring.\n",
"\n",
" \"\"\"\n",
"\n",
" # Create the client.\n",
" client = kms.KeyManagementServiceClient()\n",
"\n",
" # Build the parent location name.\n",
" location_name = f\"projects/{project_id}/locations/{location}\"\n",
"\n",
" # Build the key ring.\n",
" key_ring = {}\n",
"\n",
" # Call the API.\n",
" created_key_ring = client.create_key_ring(\n",
" request={\n",
" \"parent\": location_name,\n",
" \"key_ring_id\": key_ring_id,\n",
" \"key_ring\": key_ring,\n",
" }\n",
" )\n",
" print(\"Created key ring: {}\".format(created_key_ring.name))\n",
" return created_key_ring\n",
"\n",
"\n",
"key_ring = create_key_ring(\n",
" project_id=PROJECT_ID, location=REGION, key_ring_id=KEY_RING_ID\n",
")\n",
"print(key_ring)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gCL1-IfFtWXl"
},
"source": [
"### Create a key\n",
"\n",
"Next, you create your key. Use the helper function `create_key()` with the following parameters:\n",
"\n",
"- `project_id`: Your project ID.\n",
"- `location`: Your region.\n",
"- `key_ring_id`: The unique identifier for your key ring.\n",
"- `key_id`: The unique identifier for your key.\n",
"\n",
"The helper function calls the KMS client method `create_cryto_key()` to create your key.\n",
"\n",
"Learn more about [](https://cloud.google.com/kms/docs/samples/kms-create-key-symmetric-encrypt-decrypt)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "LXcagdmSnYYW"
},
"outputs": [],
"source": [
"KEY_ID = \"your_cmek_key_id\"\n",
"\n",
"\n",
"def create_key(project_id, location, key_ring_id, key_id):\n",
" \"\"\"\n",
" Creates a new symmetric encryption/decryption key in Cloud KMS.\n",
"\n",
" Args:\n",
" project_id (string): Google Cloud project ID (e.g. 'my-project').\n",
" location (string): Cloud KMS location (e.g. 'us-east1').\n",
" key_ring_id (string): ID of the Cloud KMS key ring (e.g. 'my-key-ring').\n",
" key_id (string): ID of the key to create (e.g. 'my-symmetric-key').\n",
"\n",
" Returns:\n",
" CryptoKey: Cloud KMS key.\n",
"\n",
" \"\"\"\n",
"\n",
" # Create the client.\n",
" client = kms.KeyManagementServiceClient()\n",
"\n",
" # Build the parent key ring name.\n",
" key_ring_name = client.key_ring_path(project_id, location, key_ring_id)\n",
"\n",
" # Build the key.\n",
" purpose = kms.CryptoKey.CryptoKeyPurpose.ENCRYPT_DECRYPT\n",
" algorithm = (\n",
" kms.CryptoKeyVersion.CryptoKeyVersionAlgorithm.GOOGLE_SYMMETRIC_ENCRYPTION\n",
" )\n",
" key = {\n",
" \"purpose\": purpose,\n",
" \"version_template\": {\n",
" \"algorithm\": algorithm,\n",
" },\n",
" }\n",
"\n",
" # Call the API.\n",
" created_key = client.create_crypto_key(\n",
" request={\"parent\": key_ring_name, \"crypto_key_id\": key_id, \"crypto_key\": key}\n",
" )\n",
" print(\"Created symmetric key: {}\".format(created_key.name))\n",
" return created_key\n",
"\n",
"\n",
"key_id = create_key(\n",
" project_id=PROJECT_ID, location=REGION, key_ring_id=KEY_RING_ID, key_id=KEY_ID\n",
")\n",
"\n",
"print(key_id)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "3gKDBOqC8Gl5"
},
"source": [
"### Set service account permissions\n",
"\n",
"Next, you set permissions for your Vertex AI service account to encrypt and decrypt resources using your key.\n",
"\n",
"Learn more about [Grant Vertex AI permissions](https://cloud.google.com/vertex-ai/docs/general/cmek#grant_permissions)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6QrRg08Vqfru"
},
"outputs": [],
"source": [
"# Reference: https://cloud.google.com/vertex-ai/docs/general/cmek#granting_permissions\n",
"# Get the service account\n",
"SERVICE_ACCOUNT = ! gcloud projects get-iam-policy {PROJECT_ID} \\\n",
" --flatten=\"bindings[].members\" \\\n",
" --format=\"table(bindings.members)\" \\\n",
" --filter=\"bindings.role:roles/aiplatform.serviceAgent\" \\\n",
" | grep -oP \"service-.+?@gcp-sa-aiplatform.iam.gserviceaccount.com\"\n",
"SERVICE_ACCOUNT = SERVICE_ACCOUNT[0]\n",
"\n",
"print(f\"Service account is: {SERVICE_ACCOUNT}\")\n",
"\n",
"# Give permissions\n",
"! gcloud kms keys add-iam-policy-binding {KEY_ID} \\\n",
" --keyring={KEY_RING_ID} \\\n",
" --location={REGION} \\\n",
" --project={PROJECT_ID} \\\n",
" --member=serviceAccount:{SERVICE_ACCOUNT} \\\n",
" --role=roles/cloudkms.cryptoKeyEncrypterDecrypter"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "1e8cd37e5f99"
},
"source": [
"Create the full resource identifier for the created key"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ebAHZg2vlhXL"
},
"outputs": [],
"source": [
"ENCRYPTION_SPEC_KEY_NAME = key_id.name"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "Aa_8wrqSkamz"
},
"source": [
"## Initialize Vertex SDK for Python\n",
"\n",
"Initialize the *client* for Vertex AI\n",
"\n",
"All resources created during this Notebook run will encrypted with the encryption key created above.\n",
"\n",
"You can override the encryption key at each function call."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "init_aip:mbsdk,all"
},
"source": [
"### Initialize Vertex AI SDK for Python\n",
"\n",
"Initialize the Vertex AI SDK for Python for your project, bucket, and corresponding encryption key.\n",
"\n",
"All resources created during this session are encrypted with the encryption key you created.\n",
"\n",
"*Note:* You can override the encryption key at each function call."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ohdgOs69kGNU"
},
"outputs": [],
"source": [
"aip.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
" encryption_spec_key_name=ENCRYPTION_SPEC_KEY_NAME,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_file:u_dataset,csv"
},
"source": [
"#### Location of Cloud Storage training data.\n",
"\n",
"Now set the variable `IMPORT_FILE` to the location of the CSV index file in Cloud Storage."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_file:flowers,csv,icn"
},
"outputs": [],
"source": [
"IMPORT_FILE = (\n",
" \"gs://cloud-samples-data/vision/automl_classification/flowers/all_data_v2.csv\"\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "35QVNhACqcTJ"
},
"source": [
"# Create `Vertex AI ImageDataset` resource\n",
"\n",
"Next, you create an `ImageDataset` resource, which will be encrypted using your encryption key."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4OfCqaYRqcTJ"
},
"outputs": [],
"source": [
"dataset = aip.ImageDataset.create(\n",
" display_name=\"flowers_\" + TIMESTAMP,\n",
" gcs_source=[IMPORT_FILE],\n",
" import_schema_uri=aip.schema.dataset.ioformat.image.single_label_classification,\n",
")\n",
"\n",
"print(dataset.resource_name)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "6-bBqipfqcTS"
},
"source": [
"# Launch a Training Job to Create a Model\n",
"\n",
"Train an AutoML Image Classification model."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "aA41rT_mb-rV"
},
"outputs": [],
"source": [
"job = aiplatform.AutoMLImageTrainingJob(\n",
" display_name=\"flowers_\" + TIMESTAMP,\n",
" prediction_type=\"classification\",\n",
" multi_label=False,\n",
" model_type=\"CLOUD\",\n",
" base_model=None,\n",
")\n",
"\n",
"# This will take around half an hour to run\n",
"model = job.run(\n",
" dataset=ds,\n",
" model_display_name=\"flowers_\" + TIMESTAMP,\n",
" training_fraction_split=0.6,\n",
" validation_fraction_split=0.2,\n",
" test_fraction_split=0.2,\n",
" budget_milli_node_hours=8000,\n",
" disable_early_stopping=False,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5vhDsMJNqcTW"
},
"source": [
"# Deploy Your Model\n",
"\n",
"Deploy your model, then wait until the model FINISHES deployment before proceeding to prediction."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "Y9GH72wWqcTX"
},
"outputs": [],
"source": [
"endpoint = model.deploy()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "nIw1ifPuqcTb"
},
"source": [
"# Predict on Endpoint\n",
"- Take one sample from the data imported to the dataset\n",
"- This sample will be encoded to base64 and passed to the endpoint for prediction"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H23ISHdHVIZM"
},
"outputs": [],
"source": [
"test_item = !gsutil cat $IMPORT_FILE | head -n1\n",
"test_item, test_label = str(test_item[0]).split(\",\")\n",
"\n",
"print(test_item, test_label)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "TF_N0kqZU768"
},
"outputs": [],
"source": [
"import base64\n",
"\n",
"import tensorflow as tf\n",
"\n",
"with tf.io.gfile.GFile(test_item, \"rb\") as f:\n",
" content = f.read()\n",
"\n",
"# The format of each instance should conform to the deployed model's prediction input schema.\n",
"instances_list = [{\"content\": base64.b64encode(content).decode(\"utf-8\")}]\n",
"\n",
"prediction = endpoint.predict(instances=instances_list)\n",
"\n",
"print(prediction)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "nWA3qocXfk82"
},
"source": [
"# Undeploy Model from Endpoint"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "V1brMaO_fk82"
},
"outputs": [],
"source": [
"endpoint.undeploy_all()"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e00750837ca8"
},
"outputs": [],
"source": [
"# missing\n",
"endpoint.delete()\n",
"model.delete()\n",
"dataset.delete()\n",
"\n",
"! gcloud kms keys versions destroy key-version \\\n",
" --key key {KEY_ID} \\\n",
" --keyring={KEY_RING_ID} \\\n",
" --location={REGION} "
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "aa95b7fff9b5"
},
"outputs": [],
"source": [
"! gcloud kms keys list --location {REGION} --keyring {KEY_RING_ID}"
]
}
],
"metadata": {
"colab": {
"collapsed_sections": [],
"name": "get_started_with_cmek_training.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -103,10 +103,10 @@
"- Add a serving function for online/batch prediction to the custom model.\n",
"- Test the custom model with the serving function.\n",
"- Evaluate the custom model using Vertex AI Batch Prediction\n",
"- Wait for AutoML training job to complete.\n",
"- Wait for the AutoML training job to complete.\n",
"- Evaluate the AutoML model using Vertex AI Batch Prediction with the same evaluation slices as the custom model.\n",
"- Set the evaluation results of the AutoML model as the baseline.\n",
"- If the evaluation of the custom model is below baseline, continue to experiment with custom model.\n",
"- If the evaluation of the custom model is below baseline, continue to experiment with the custom model.\n",
"- If the evaluation of the custom model is above baseline, save the model as the first best model."
]
},
@@ -186,7 +186,9 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG"
]
},
{
@@ -436,7 +438,7 @@
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
+103
View File
@@ -35,17 +35,120 @@ The third stage in MLOps is formalization to develop an automated pipeline proce
[Get Started with Kubeflow pipelines](get_started_with_kubeflow_pipelines.ipynb)
```
The steps performed include:
- Building KFP lightweight Python function components.
- Assembling and compiling KFP components into a pipeline.
- Executing a KFP pipeline using Vertex AI Pipelines.
- Loading component and pipeline definitions from a source code repository.
- Building sequential, parallel, multiple output components.
- Building control flow into pipelines.
```
[Get Started with BQ and TFDV components](get_started_with_bq_tfdv_pipeline_components.ipynb)
```
The steps performed include:
- Build and execute a pipeline component for creating a Vertex AI Tabular Dataset from a BigQuery table.
- Build and execute a pipeline component for generating TFDV statistics and schema from a Vertex AI Tabular Dataset.
- Execute a Vertex AI pipeline.
```
[Get Started with Dataflow components](get_started_with_dataflow_pipeline_components.ipynb)
```
The steps performed include:
- Build an Apache Beam data pipeline.
- Encapsulate the Apache Beam data pipeline with a Dataflow component in a Vertex AI pipeline.
- Execute a Vertex AI pipeline.
```
[Get Started with Vertex AI AutoML components](get_started_with_automl_pipeline_components.ipynb)
```
The steps performed include:
- Construct a pipeline for:
- Training a Vertex AI AutoML trained model.
- Test the serving binary with a batch prediction job.
- Deploying a Vertex AI AutoML trained model.
- Execute a Vertex AI pipeline.
```
[Get Started with Vertex AI Custom Training components](get_started_with_custom_training_pipeline_components.ipynb)
```
The steps performed include:
- Construct a pipeline for:
- Training a Vertex AI custom trained model.
- Test the serving binary with a batch prediction job.
- Deploying a Vertex AI custom trained model.
- Execute a Vertex AI pipeline.
```
[Get Started with Vertex AI Hyperparameter Tuning components](get_started_with_hpt_pipeline_components.ipynb)
```
The steps performed include:
- Construct a pipeline for:
- Hyperparameter tune/train a custom model.
- Retrieve the tuned hyperparameter values and metrics to optimize.
- If the metrics exceed a specified threshold.
- Get the location of the model artifacts for the best tuned model.
- Upload the model artifacts to a `Vertex AI Model` resource.
- Execute a Vertex AI pipeline.
```
[Get Started with BQML components](get_started_with_bqml_pipeline_components.ipynb)
```
The steps performed include:
- Construct a pipeline for:
- Training BigQuery ML model.
- Evaluating the BigQuery ML model.
- Exporting the BigQuery ML model.
- Importing the BigQuery ML model to a Vertex AI model.
- Deploy the Vertex AI model.
- Execute a Vertex AI pipeline.
- Make a prediction with the deployed Vertex AI model.
```
[Get Started with rapid prototyping with BQML and AutoML components](get_started_with_rapid_prototyping_bqml_automl.ipynb)
```
The steps performed include:
- Creating a BigQuery and Vertex AI training dataset.
- Training a BigQuery ML and AutoML model.
- Extracting evaluation metrics from the BigQueryML and AutoML models.
- Selecting the best trained model.
- Deploying the best trained model.
- Testing the deployed model infrastructure.
```
### E2E Stage Example
[Stage 3: Formalization](mlops_formalization.ipynb)
```
The steps performed include:
- Obtain resources from the experimentation stage.
- Baseline model.
- Dataset schema/statistics for baseline model.
- Formalize a data preprocessing pipeline.
- Extract columns/rows from BigQuery table to local BigQuery table.
- Use Tensorflow Data Validation library to determine statistics, schema, and features.
- Use Dataflow to preprocess the data.
- Create a Vertex AI Dataset.
- Formalize a build model architecture pipeline.
- Create the Vertex AI Model base model.
- Formalize a training pipeline.
```
@@ -86,10 +86,14 @@
"- `Vertex AI AutoML`\n",
"- `Google Cloud Pipeline Components`\n",
"- `Vertex AI Dataset, Model and Endpoint` resources\n",
"- `Vertex AI Prediction`\n",
"\n",
"The steps performed include:\n",
"\n",
"- Construct a pipeline for training and deploying a Vertex AI AutoML model.\n",
"- Construct a pipeline for:\n",
" - Training a Vertex AI AutoML trained model.\n",
" - Test the serving binary with a batch prediction job.\n",
" - Deploying a Vertex AI AutoML trained model.\n",
"- Execute a Vertex AI pipeline."
]
},
@@ -125,7 +129,11 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG\n",
" ! pip3 install --upgrade python-tabulate $USER_FLAG\n",
" ! pip3 install -U opencv-python-headless==4.5.2.52 $USER_FLAG"
]
},
{
@@ -375,7 +383,7 @@
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
@@ -534,11 +542,13 @@
},
"outputs": [],
"source": [
"from kfp.v2.dsl import Artifact, Input, Model\n",
"from kfp.v2.dsl import Artifact, Input, Model, Output\n",
"\n",
"\n",
"@component(packages_to_install=[\"google-cloud-aiplatform\"])\n",
"def evaluateAutoMLModelOp(model: Input[Artifact], region: str) -> str:\n",
"def evaluateAutoMLModelOp(\n",
" model: Input[Artifact], region: str, model_evaluation: Output[Artifact]\n",
"):\n",
" import logging\n",
"\n",
" import google.cloud.aiplatform.gapic as gapic\n",
@@ -551,8 +561,7 @@
"\n",
" model_evaluations = model_service_client.list_model_evaluations(parent=model_id)\n",
" model_evaluation = list(model_evaluations)[0]\n",
" logging.info(model_evaluation)\n",
" return str(model_evaluation)"
" logging.info(model_evaluation)"
]
},
{
@@ -569,15 +578,25 @@
" - The display name for the dataset is passed into the pipeline.\n",
" - The import file for the dataset is passed into the pipeline.\n",
" - The component returns the dataset resource as `outputs[\"dataset\"]`\n",
"\n",
"\n",
"2. Use the prebuilt component `AutoMLImageTrainingJobRunOp` to train a Vertex AI AutoML Model resource, where:\n",
" - The display name for the dataset is passed into the pipeline.\n",
" - The dataset is the output from the `ImageDatasetCreateOp`.\n",
" - The component returns the model resource as `outputs[\"model\"]`.\n",
"3. Use the prebuilt component `EndpointCreateOp` to create a Vertex AI Endpoint to deploy the trained model to, where:\n",
"\n",
"\n",
"3. Use the prebuild component `ModelBatchPredictOp` to do a test batch prediction, where:\n",
" - The model is the output from the `AutoMLTrainingJobRunOp`.\n",
"\n",
"\n",
"4. Use the prebuilt component `EndpointCreateOp` to create a Vertex AI Endpoint to deploy the trained model to, where:\n",
" - Since the component has no dependencies on other components, by default it would be executed in parallel with the model training.\n",
" - The `after(training_op)` is added to serialize its execution, so its only executed if the training operation completes successfully.\n",
" - The component returns the endpoint resource as `outputs[\"endpoint\"]`.\n",
"4. Use the prebuilt component `ModelDeployOp` to deploy the trained AutoML model to, where:\n",
"\n",
"\n",
"5. Use the prebuilt component `ModelDeployOp` to deploy the trained AutoML model to, where:\n",
" - The display name for the dataset is passed into the pipeline.\n",
" - The model is the output from the `AutoMLTrainingJobRunOp`.\n",
" - The endpoint is the output from the `EndpointCreateOp`\n",
@@ -596,13 +615,19 @@
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"\n",
"PIPELINE_ROOT = \"{}/pipeline_root/automl_icn_training\".format(BUCKET_NAME)\n",
"DEPLOY_COMPUTE = \"n1-standard-4\"\n",
"\n",
"\n",
"@dsl.pipeline(\n",
" name=\"automl-icn-training\", description=\"AutoML image classification training\"\n",
")\n",
"def pipeline(\n",
" import_file: str, display_name: str, project: str = PROJECT_ID, region: str = REGION\n",
" import_file: str,\n",
" batch_files: list,\n",
" display_name: str,\n",
" bucket: str = PIPELINE_ROOT,\n",
" project: str = PROJECT_ID,\n",
" region: str = REGION,\n",
"):\n",
"\n",
" dataset_op = gcc_aip.ImageDatasetCreateOp(\n",
@@ -617,7 +642,6 @@
" display_name=display_name,\n",
" prediction_type=\"classification\",\n",
" model_type=\"CLOUD\",\n",
" base_model=None,\n",
" dataset=dataset_op.outputs[\"dataset\"],\n",
" model_display_name=display_name,\n",
" training_fraction_split=0.6,\n",
@@ -628,11 +652,25 @@
"\n",
" eval_op = evaluateAutoMLModelOp(model=training_op.outputs[\"model\"], region=region)\n",
"\n",
" batch_op = gcc_aip.ModelBatchPredictOp(\n",
" project=project,\n",
" job_display_name=\"batch_predict_job\",\n",
" model=training_op.outputs[\"model\"],\n",
" gcs_source_uris=batch_files,\n",
" gcs_destination_output_uri_prefix=bucket,\n",
" instances_format=\"jsonl\",\n",
" predictions_format=\"jsonl\",\n",
" model_parameters={},\n",
" machine_type=DEPLOY_COMPUTE,\n",
" starting_replica_count=1,\n",
" max_replica_count=1,\n",
" ).after(eval_op)\n",
"\n",
" endpoint_op = gcc_aip.EndpointCreateOp(\n",
" project=project,\n",
" location=region,\n",
" display_name=display_name,\n",
" ).after(eval_op)\n",
" ).after(batch_op)\n",
"\n",
" deploy_op = gcc_aip.ModelDeployOp(\n",
" model=training_op.outputs[\"model\"],\n",
@@ -642,6 +680,107 @@
" )"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "get_test_items:batch_prediction"
},
"source": [
"### Get test item(s)\n",
"\n",
"Now do a batch prediction to your Vertex model. You will use arbitrary examples out of the dataset as a test items. Don't be concerned that the examples were likely used in training the model -- we just want to demonstrate how to make a prediction."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "get_test_items:automl,icn,csv"
},
"outputs": [],
"source": [
"test_items = !gsutil cat $IMPORT_FILE | head -n2\n",
"if len(str(test_items[0]).split(\",\")) == 3:\n",
" _, test_item_1, test_label_1 = str(test_items[0]).split(\",\")\n",
" _, test_item_2, test_label_2 = str(test_items[1]).split(\",\")\n",
"else:\n",
" test_item_1, test_label_1 = str(test_items[0]).split(\",\")\n",
" test_item_2, test_label_2 = str(test_items[1]).split(\",\")\n",
"\n",
"print(test_item_1, test_label_1)\n",
"print(test_item_2, test_label_2)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "copy_test_items:batch_prediction"
},
"source": [
"### Copy test item(s)\n",
"\n",
"For the batch prediction, copy the test items over to your Cloud Storage bucket."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "copy_test_items:batch_prediction"
},
"outputs": [],
"source": [
"file_1 = test_item_1.split(\"/\")[-1]\n",
"file_2 = test_item_2.split(\"/\")[-1]\n",
"\n",
"! gsutil cp $test_item_1 $BUCKET_NAME/$file_1\n",
"! gsutil cp $test_item_2 $BUCKET_NAME/$file_2\n",
"\n",
"test_item_1 = BUCKET_NAME + \"/\" + file_1\n",
"test_item_2 = BUCKET_NAME + \"/\" + file_2"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "make_batch_file:automl,image"
},
"source": [
"### Make the batch input file\n",
"\n",
"Now make a batch input file, which you will store in your local Cloud Storage bucket. The batch input file can only be in JSONL. For JSONL file, you make one dictionary entry per line for each data item (instance). The dictionary contains the key/value pairs:\n",
"\n",
"- `content`: The Cloud Storage path to the image.\n",
"- `mime_type`: The content type. In our example, it is a `jpeg` file.\n",
"\n",
"For example:\n",
"\n",
" {'content': '[your-bucket]/file1.jpg', 'mime_type': 'jpeg'}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "make_batch_file:automl,image"
},
"outputs": [],
"source": [
"import json\n",
"\n",
"import tensorflow as tf\n",
"\n",
"gcs_input_uri = BUCKET_NAME + \"/test.jsonl\"\n",
"with tf.io.gfile.GFile(gcs_input_uri, \"w\") as f:\n",
" data = {\"content\": test_item_1, \"mime_type\": \"image/jpeg\"}\n",
" f.write(json.dumps(data) + \"\\n\")\n",
" data = {\"content\": test_item_2, \"mime_type\": \"image/jpeg\"}\n",
" f.write(json.dumps(data) + \"\\n\")\n",
"\n",
"print(gcs_input_uri)\n",
"! gsutil cat $gcs_input_uri"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -653,6 +792,7 @@
"Next, you compile the pipeline and then exeute it. The pipeline takes the following parameters, which are passed as the dictionary `parameter_values`:\n",
"\n",
"- `import_file`: The Cloud Storage path to the dataset index file.\n",
"- `batch_files`: A list of Cloud Storage paths to the input batch files.\n",
"- `display_name`: The display name for the generated Vertex AI resources.\n",
"- `project`: The project ID.\n",
"- `region`: The region."
@@ -676,6 +816,7 @@
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" \"import_file\": IMPORT_FILE,\n",
" \"batch_files\": [gcs_input_uri],\n",
" \"display_name\": \"flowers\" + TIMESTAMP,\n",
" \"project\": PROJECT_ID,\n",
" \"region\": REGION,\n",
@@ -739,30 +880,56 @@
" + str(TASK_ID)\n",
" + \"/gcp_resources\"\n",
" )\n",
" EVAL_METRICS = (\n",
" PIPELINE_ROOT\n",
" + \"/\"\n",
" + PROJECT_NUMBER\n",
" + \"/\"\n",
" + JOB_ID\n",
" + \"/\"\n",
" + output_task_name\n",
" + \"_\"\n",
" + str(TASK_ID)\n",
" + \"/evaluation_metrics\"\n",
" )\n",
" if tf.io.gfile.exists(EXECUTE_OUTPUT):\n",
" ! gsutil cat $EXECUTE_OUTPUT\n",
" break\n",
" return EXECUTE_OUTPUT\n",
" elif tf.io.gfile.exists(GCP_RESOURCES):\n",
" ! gsutil cat $GCP_RESOURCES\n",
" break\n",
" return GCP_RESOURCES\n",
" elif tf.io.gfile.exists(EVAL_METRICS):\n",
" ! gsutil cat $EVAL_METRICS\n",
" return EVAL_METRICS\n",
"\n",
" return EXECUTE_OUTPUT\n",
" return None\n",
"\n",
"\n",
"print(\"imagedataset-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"imagedataset-create\")\n",
"print(\"\\n\")\n",
"print(\"automlimagetrainingjob-run\")\n",
"artifacts = print_pipeline_output(pipeline, \"automlimagetrainingjob-run\")\n",
"print(\"\\n\")\n",
"print(\"image-dataset-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"image-dataset-create\")\n",
"print(\"\\n\\n\")\n",
"print(\"automl-image-training-job\")\n",
"artifacts = print_pipeline_output(pipeline, \"automl-image-training-job\")\n",
"print(\"\\n\\n\")\n",
"print(\"endpoint-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"endpoint-create\")\n",
"print(\"\\n\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-deploy\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-deploy\")\n",
"print(\"\\n\")\n",
"print(\"\\n\\n\")\n",
"print(\"evaluateautomlmodelop\")\n",
"artifacts = print_pipeline_output(pipeline, \"evaluateautomlmodelop\")"
"artifacts = print_pipeline_output(pipeline, \"evaluateautomlmodelop\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-batch-predict\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-batch-predict\")\n",
"output = !gsutil cat $artifacts\n",
"output = json.loads(output[0])\n",
"print(\"\\n\\n\")\n",
"print(\n",
" output[\"artifacts\"][\"batchpredictionjob\"][\"artifacts\"][0][\"metadata\"][\n",
" \"gcsOutputDirectory\"\n",
" ]\n",
")"
]
},
{
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -131,7 +131,11 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG\n",
" ! pip3 install --upgrade python-tabulate $USER_FLAG\n",
" ! pip3 install -U opencv-python-headless==4.5.2.52 $USER_FLAG"
]
},
{
@@ -289,7 +293,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}"
]
},
{
@@ -300,8 +305,8 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_URI = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
]
},
{
@@ -321,7 +326,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -341,7 +346,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -352,7 +357,9 @@
"source": [
"#### Service Account\n",
"\n",
"**If you don't know your service account**, try to get your service account using `gcloud` command by executing the second cell below."
"**If you don't know your service account**, try to get your service account using `gcloud` command by executing the second cell below.\n",
"\n",
"*Note:* The code for automatically finding your service account works on a user-managed Workbench AI noteboook. If you are using a fully-managed notebook, you will need to manually enter your service account."
]
},
{
@@ -381,7 +388,7 @@
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
@@ -404,9 +411,9 @@
},
"outputs": [],
"source": [
"! gsutil iam ch serviceAccount:{SERVICE_ACCOUNT}:roles/storage.objectCreator $BUCKET_NAME\n",
"! gsutil iam ch serviceAccount:{SERVICE_ACCOUNT}:roles/storage.objectCreator $BUCKET_URI\n",
"\n",
"! gsutil iam ch serviceAccount:{SERVICE_ACCOUNT}:roles/storage.objectViewer $BUCKET_NAME"
"! gsutil iam ch serviceAccount:{SERVICE_ACCOUNT}:roles/storage.objectViewer $BUCKET_URI"
]
},
{
@@ -668,7 +675,7 @@
},
"outputs": [],
"source": [
"PIPELINE_ROOT = f\"{BUCKET_NAME}/bq_query\"\n",
"PIPELINE_ROOT = f\"{BUCKET_URI}/bq_query\"\n",
"\n",
"\n",
"@dsl.pipeline(name=\"bq-hello-world\", pipeline_root=PIPELINE_ROOT)\n",
@@ -678,7 +685,7 @@
" dataset: str,\n",
" model: str,\n",
" artifact_uri: str,\n",
" min_trials: int,\n",
" num_trials: int,\n",
" deploy_image: str,\n",
" machine_type: str,\n",
" min_replica_count: int,\n",
@@ -690,68 +697,75 @@
" location: str = \"US\",\n",
" region: str = \"us-central1\",\n",
"):\n",
" import google_cloud_pipeline_components.experimental.bigquery as gcc_bq\n",
" from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
" from google_cloud_pipeline_components.types import artifact_types\n",
" from google_cloud_pipeline_components.v1.bigquery import (\n",
" BigqueryCreateModelJobOp, BigqueryEvaluateModelJobOp,\n",
" BigqueryExportModelJobOp, BigqueryPredictModelJobOp,\n",
" BigqueryQueryJobOp)\n",
" from google_cloud_pipeline_components.v1.endpoint import (EndpointCreateOp,\n",
" ModelDeployOp)\n",
" from google_cloud_pipeline_components.v1.model import ModelUploadOp\n",
" from kfp.v2.components import importer_node\n",
"\n",
" bq_dataset = gcc_bq.BigqueryQueryJobOp(\n",
" bq_dataset = BigqueryQueryJobOp(\n",
" project=project, location=\"US\", query=f\"CREATE SCHEMA {dataset}\"\n",
" )\n",
"\n",
" bq_model = gcc_bq.BigqueryCreateModelJobOp(\n",
" bq_model = BigqueryCreateModelJobOp(\n",
" project=project,\n",
" location=location,\n",
" query=f\"CREATE OR REPLACE MODEL {dataset}.{model} OPTIONS (model_type='dnn_classifier', labels=['{label}'], min_trials={min_trials}) AS SELECT * FROM `{bq_table}` WHERE body_mass_g IS NOT NULL AND sex IS NOT NULL\",\n",
" query=f\"CREATE OR REPLACE MODEL {dataset}.{model} OPTIONS (model_type='dnn_classifier', labels=['{label}'], num_trials={num_trials}) AS SELECT * FROM `{bq_table}` WHERE body_mass_g IS NOT NULL AND sex IS NOT NULL\",\n",
" ).after(bq_dataset)\n",
"\n",
" # bq_eval = gcc_bq.BigqueryEvaluateModelJobOp(\n",
" # project=PROJECT_ID,\n",
" # location=\"US\",\n",
" # model_name=\"bqml_tutorial.penguins_model\",\n",
" # ).after(bq_model)\n",
"\n",
" bq_eval = gcc_bq.BigqueryQueryJobOp(\n",
" project=project,\n",
" location=location,\n",
" query=f\"SELECT * FROM ML.EVALUATE(MODEL {dataset}.{model}) ORDER BY roc_auc desc LIMIT 1\",\n",
" bq_eval = BigqueryEvaluateModelJobOp(\n",
" project=PROJECT_ID, location=\"US\", model=bq_model.outputs[\"model\"]\n",
" ).after(bq_model)\n",
"\n",
" bq_predict = gcc_bq.BigqueryPredictModelJobOp(\n",
" bq_predict = BigqueryPredictModelJobOp(\n",
" project=project,\n",
" location=location,\n",
" model_name=f\"{dataset}.{model}\",\n",
" model=bq_model.outputs[\"model\"],\n",
" table_name=f\"`{bq_table}`\",\n",
" # query_statement=f\"SELECT * EXCEPT ({label}) FROM {bq_table} WHERE body_mass_g IS NOT NULL AND sex IS NOT NULL\"\n",
" job_configuration_query={\n",
" \"destinationTable\": {\n",
" \"projectId\": f\"`{project}`\",\n",
" \"datasetId\": f\"{dataset}\",\n",
" \"projectId\": PROJECT_ID,\n",
" \"datasetId\": \"bqml_tutorial\",\n",
" \"tableId\": \"results_1\",\n",
" }\n",
" },\n",
" ).after(bq_model)\n",
"\n",
" bq_export = gcc_bq.BigqueryExportModelJobOp(\n",
" bq_export = BigqueryExportModelJobOp(\n",
" project=project,\n",
" location=location,\n",
" model_name=f\"{project}.{dataset}.{model}\",\n",
" model=bq_model.outputs[\"model\"],\n",
" model_destination_path=artifact_uri,\n",
" ).after(bq_model)\n",
"\n",
" model_upload = gcc_aip.ModelUploadOp(\n",
" display_name=display_name,\n",
" import_unmanaged_model_task = importer_node.importer(\n",
" artifact_uri=artifact_uri,\n",
" serving_container_image_uri=deploy_image,\n",
" project=project,\n",
" location=region,\n",
" artifact_class=artifact_types.UnmanagedContainerModel,\n",
" metadata={\n",
" \"containerSpec\": {\n",
" \"imageUri\": DEPLOY_IMAGE,\n",
" },\n",
" },\n",
" ).after(bq_export)\n",
"\n",
" endpoint = gcc_aip.EndpointCreateOp(\n",
" model_upload = ModelUploadOp(\n",
" project=project,\n",
" display_name=display_name,\n",
" unmanaged_container_model=import_unmanaged_model_task.outputs[\"artifact\"],\n",
" ).after(import_unmanaged_model_task)\n",
"\n",
" endpoint = EndpointCreateOp(\n",
" project=project,\n",
" location=region,\n",
" display_name=display_name,\n",
" ).after(model_upload)\n",
"\n",
" deploy_model = gcc_aip.ModelDeployOp(\n",
" deploy_model = ModelDeployOp(\n",
" model=model_upload.outputs[\"model\"],\n",
" endpoint=endpoint.outputs[\"endpoint\"],\n",
" dedicated_resources_min_replica_count=min_replica_count,\n",
@@ -778,7 +792,7 @@
"- `dataset`: The BigQuery dataset component name.\n",
"- `model`: The BigQuery model component name.\n",
"- `artifact_uri`: The Cloud Storage location to export the BigQuery model artifacts.\n",
"- `min_trials`: If greater than one, will perform hyperparameter tuning for the specified number of trials using the Vertex AI Vizier service.\n",
"- `num_trials`: If greater than one, will perform hyperparameter tuning for the specified number of trials using the Vertex AI Vizier service.\n",
"- `deploy_image`: The container image for serving predictions.\n",
"- `machine_type`: The VM for serving predictions.\n",
"- `min_replica_count`/`max_replica_count`: The number of virtual machines for auto-scaling predictions.\n",
@@ -811,7 +825,7 @@
" \"dataset\": \"bqml_tutorial\",\n",
" \"model\": \"penguins_model\",\n",
" \"artifact_uri\": MODEL_DIR,\n",
" \"min_trials\": 2,\n",
" \"num_trials\": 2,\n",
" \"deploy_image\": DEPLOY_IMAGE,\n",
" \"display_name\": \"penguins\",\n",
" \"machine_type\": \"n1-standard-4\",\n",
@@ -880,14 +894,29 @@
" + str(TASK_ID)\n",
" + \"/gcp_resources\"\n",
" )\n",
" EVAL_METRICS = (\n",
" PIPELINE_ROOT\n",
" + \"/\"\n",
" + PROJECT_NUMBER\n",
" + \"/\"\n",
" + JOB_ID\n",
" + \"/\"\n",
" + output_task_name\n",
" + \"_\"\n",
" + str(TASK_ID)\n",
" + \"/evaluation_metrics\"\n",
" )\n",
" if tf.io.gfile.exists(EXECUTE_OUTPUT):\n",
" ! gsutil cat $EXECUTE_OUTPUT\n",
" break\n",
" return EXECUTE_OUTPUT\n",
" elif tf.io.gfile.exists(GCP_RESOURCES):\n",
" ! gsutil cat $GCP_RESOURCES\n",
" break\n",
" return GCP_RESOURCES\n",
" elif tf.io.gfile.exists(EVAL_METRICS):\n",
" ! gsutil cat $EVAL_METRICS\n",
" return EVAL_METRICS\n",
"\n",
" return EXECUTE_OUTPUT\n",
" return None\n",
"\n",
"\n",
"print(\"bigquery-query-job\")\n",
@@ -896,8 +925,8 @@
"print(\"bigquery-create-model-job\")\n",
"artifacts = print_pipeline_output(pipeline, \"bigquery-create-model-job\")\n",
"print(\"\\n\\n\")\n",
"print(\"bigquery-query-job-2\")\n",
"artifacts = print_pipeline_output(pipeline, \"bigquery-query-job-2\")\n",
"print(\"bigquery-evaluate-model-job\")\n",
"artifacts = print_pipeline_output(pipeline, \"bigquery-evaluate-model-job\")\n",
"print(\"\\n\\n\")\n",
"print(\"bigquery-predict-model-job\")\n",
"artifacts = print_pipeline_output(pipeline, \"bigquery-predict-model-job\")\n",
@@ -946,32 +975,6 @@
"pipeline.delete()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "load_saved_model"
},
"source": [
"## Load the saved model\n",
"\n",
"Your model is stored in a TensorFlow SavedModel format in a Cloud Storage bucket. Now load it from the Cloud Storage bucket, and then you can do some things, like evaluate the model, and do a prediction.\n",
"\n",
"To load, you use the TF.Keras `model.load_model()` method passing it the Cloud Storage path where the model is saved -- specified by `MODEL_DIR`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "load_saved_model:model"
},
"outputs": [],
"source": [
"model = tf.keras.models.load_model(MODEL_DIR)\n",
"\n",
"model.summary()"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -1002,11 +1005,32 @@
"source": [
"#### Make prediction instances\n",
"\n",
"Next, you prepare a prediction request using a synthetic example. The format for making a prediction request to an export BigQuery ML model is the same as the format for an AutoML model trained on the same data:\n",
"Next, you prepare a prediction request using a synthetic example. The format for making a prediction request to an export BigQuery ML model is dependent on the exported model format. In the case where `model_type=DNN_CLASSIFIER`, the exported model format is a TensorFlow estimator format. For this format, you use the `raw_predict()`, with the following request format:\n",
"\n",
" { 'instances': [ {instance_1}, {instance_2}, ... ])\n",
" http_body -> {\n",
" 'signature_name' : serving_signature,\n",
" 'instances': [ {instance_1}, {instance_2}, ... ]\n",
" }\n",
"\n",
" instance -> { 'feature_1': value_1, 'feature_2': value_2, ... }"
" instance -> { 'feature_1': value_1, 'feature_2': value_2, ... }\n",
"\n",
" serving_signature -> \"predict\"\n",
"\n",
"Below is a partial list of mapping BigQuery ML model types to their corresponding exported model format:\n",
"\n",
"'LINEAR_REG'<br/>\n",
"'LOGISTIC_REG' -> TensorFlow SavedFormat\n",
"\n",
"'AUTOML_CLASSIFIER'<br/>\n",
"'AUTOML_REGRESSOR' -> TensorFlow SavedFormat\n",
"\n",
"'BOOSTED_TREE_CLASSIFIER'<br/>\n",
"'BOOSTED_TREE_REGRESSOR' -> XGBoost format\n",
"\n",
"'DNN_CLASSIFIER'<br/>\n",
"'DNN_REGRESSOR'<br/>\n",
"'DNN_LINEAR_COMBINED_CLASSIFIER'<br/>\n",
"'DNN_LINEAR_COMBINED_REGRESSOR' -> TensorFlow Estimator"
]
},
{
@@ -1017,7 +1041,13 @@
},
"outputs": [],
"source": [
"INSTANCES = {\n",
"import json\n",
"\n",
"from google.api import httpbody_pb2\n",
"from google.cloud import aiplatform_v1\n",
"\n",
"DATA = {\n",
" \"signature_name\": \"predict\",\n",
" \"instances\": [\n",
" {\n",
" \"island\": \"DREAM\",\n",
@@ -1027,8 +1057,15 @@
" \"body_mass_g\": 3475.0,\n",
" \"sex\": \"FEMALE\",\n",
" }\n",
" ]\n",
"}"
" ],\n",
"}\n",
"\n",
"http_body = httpbody_pb2.HttpBody(\n",
" data=json.dumps(DATA).encode(\"utf-8\"),\n",
" content_type=\"application/json\",\n",
")\n",
"\n",
"req = aiplatform_v1.RawPredictRequest(http_body=http_body, endpoint=endpoint_id)"
]
},
{
@@ -1050,7 +1087,12 @@
},
"outputs": [],
"source": [
"response = endpoint.predict(INSTANCES)\n",
"API_ENDPOINT = \"{}-aiplatform.googleapis.com\".format(REGION)\n",
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
"\n",
"pred_client = aip.gapic.PredictionServiceClient(client_options=client_options)\n",
"\n",
"response = pred_client.raw_predict(req)\n",
"print(response)"
]
},
@@ -1077,7 +1119,7 @@
" job = bqclient.delete_model(\"bqml_tutorial.penguins_model\")\n",
"except:\n",
" pass\n",
"job = bqclient.delete_dataset(\"bqml_tutorial\")"
"job = bqclient.delete_dataset(\"bqml_tutorial\", delete_contents=True)"
]
},
{
@@ -1091,17 +1133,7 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"Otherwise, you can delete the individual resources you created in this tutorial:"
]
},
{
@@ -1115,57 +1147,9 @@
"delete_all = True\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
" # (DEVELOPER TODO) Find generated resources from pipeline and delete\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" if \"BUCKET_URI\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
]
}
@@ -86,10 +86,14 @@
"- `Vertex AI Training`\n",
"- `Google Cloud Pipeline Components`\n",
"- `Vertex AI Dataset, Model and Endpoint` resources\n",
"- `Vertex AI Prediction`\n",
"\n",
"The steps performed include:\n",
"\n",
"- Construct a pipeline for training and deploying a Vertex AI custom trained model.\n",
"- Construct a pipeline for:\n",
" - Training a Vertex AI custom trained model.\n",
" - Test the serving binary with a batch prediction job.\n",
" - Deploying a Vertex AI custom trained model.\n",
"- Execute a Vertex AI pipeline."
]
},
@@ -125,7 +129,11 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG\n",
" ! pip3 install --upgrade python-tabulate $USER_FLAG\n",
" ! pip3 install -U opencv-python-headless==4.5.2.52 $USER_FLAG"
]
},
{
@@ -375,7 +383,7 @@
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
@@ -768,6 +776,7 @@
"import json\n",
"import logging\n",
"import tqdm\n",
"import hypertune as hpt\n",
"\n",
"def parse_args():\n",
" parser = argparse.ArgumentParser(description=\"TF.Keras Image Classification\")\n",
@@ -794,7 +803,9 @@
" parser.add_argument(\n",
" \"--lr\", dest=\"lr\", default=0.01, type=float, help=\"Learning rate.\"\n",
" )\n",
" parser.add_argument(\"--batch-size\", default=16, type=int, help=\"mini-batch size\")\n",
" parser.add_argument(\n",
" \"--batch-size\", dest=\"batch_size\", default=16, type=int, help=\"mini-batch size\"\n",
" )\n",
" parser.add_argument(\n",
" \"--epochs\", default=10, type=int, help=\"number of training epochs\"\n",
" )\n",
@@ -813,6 +824,14 @@
" help=\"distributed training strategy\",\n",
" )\n",
"\n",
" parser.add_argument(\n",
" \"--tuning\",\n",
" dest=\"tuning\",\n",
" type=bool,\n",
" default=False,\n",
" help=\"hyperparameter tuning\"\n",
" )\n",
"\n",
" args = parser.parse_args()\n",
" return args\n",
"\n",
@@ -938,8 +957,19 @@
"def train_model(model, train_dataset, val_dataset):\n",
" logging.info(\"Start model training\")\n",
" history = model.fit(\n",
" x=train_dataset, epochs=args.epochs, validation_data=val_dataset, steps_per_epoch=args.steps\n",
" x=train_dataset, epochs=args.epochs, steps_per_epoch=args.steps, batch_size=args.batch_size, validation_data=val_dataset\n",
" )\n",
"\n",
" if args.tuning:\n",
" hp_metric = history.history['val_accuracy'][-1]\n",
"\n",
" hpt = hypertune.HyperTune()\n",
" hpt.report_hyperparameter_tuning_metric(\n",
" hyperparameter_metric_tag='accuracy',\n",
" metric_value=hp_metric,\n",
" global_step=args.epochs\n",
" )\n",
"\n",
" return history\n",
"\n",
"num_classes, train_dataset, val_dataset = get_data()\n",
@@ -1021,13 +1051,17 @@
" - The component returns the model resource as `outputs[\"model\"]`.\n",
"\n",
"\n",
"4. Use the prebuilt component `EndpointCreateOp` to create a Vertex AI Endpoint to deploy the trained model to, where:\n",
"4. Use the prebuild component `ModelBatchPredictOp` to do a test batch prediction, where:\n",
" - The model is the output from the `CustomPythonPackageTrainingJobRunOp`.\n",
"\n",
"\n",
"5. Use the prebuilt component `EndpointCreateOp` to create a Vertex AI Endpoint to deploy the trained model to, where:\n",
" - Since the component has no dependencies on other components, by default it would be executed in parallel with the model training.\n",
" - The `after(training_op)` is added to serialize its execution, so its only executed if the training operation completes successfully.\n",
" - The component returns the endpoint resource as `outputs[\"endpoint\"]`.\n",
"\n",
"\n",
"5. Use the prebuilt component `ModelDeployOp` to deploy the trained Vertex AI model to, where:\n",
"6. Use the prebuilt component `ModelDeployOp` to deploy the trained Vertex AI model to, where:\n",
" - The display name for the dataset is passed into the pipeline.\n",
" - The model is the output from the `CustomPythonPackageTrainingJobRunOp`.\n",
" - The endpoint is the output from the `EndpointCreateOp`\n",
@@ -1043,9 +1077,8 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"\n",
"PIPELINE_ROOT = \"{}/pipeline_root/custom_icn_training\".format(BUCKET_NAME)\n",
"DEPLOY_COMPUTE = \"n1-standard-4\"\n",
"\n",
"\n",
"@dsl.pipeline(\n",
@@ -1055,11 +1088,18 @@
"def pipeline(\n",
" import_file: str,\n",
" display_name: str,\n",
" batch_files: list,\n",
" python_package: str,\n",
" python_module: str,\n",
" bucket: str = PIPELINE_ROOT,\n",
" project: str = PROJECT_ID,\n",
" region: str = REGION,\n",
"):\n",
" from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
" from google_cloud_pipeline_components.v1.batch_predict_job import \\\n",
" ModelBatchPredictOp\n",
" from google_cloud_pipeline_components.v1.endpoint import (EndpointCreateOp,\n",
" ModelDeployOp)\n",
"\n",
" dataset_op = gcc_aip.ImageDatasetCreateOp(\n",
" project=project,\n",
@@ -1088,21 +1128,136 @@
" model_display_name=display_name,\n",
" )\n",
"\n",
" endpoint_op = gcc_aip.EndpointCreateOp(\n",
" batch_op = ModelBatchPredictOp(\n",
" project=project,\n",
" job_display_name=\"batch_predict_job\",\n",
" model=training_op.outputs[\"model\"],\n",
" gcs_source_uris=batch_files,\n",
" gcs_destination_output_uri_prefix=bucket,\n",
" instances_format=\"jsonl\",\n",
" predictions_format=\"jsonl\",\n",
" model_parameters={},\n",
" machine_type=DEPLOY_COMPUTE,\n",
" starting_replica_count=1,\n",
" max_replica_count=1,\n",
" )\n",
"\n",
" endpoint_op = EndpointCreateOp(\n",
" project=project,\n",
" location=region,\n",
" display_name=display_name,\n",
" ).after(training_op)\n",
" ).after(batch_op)\n",
"\n",
" deploy_op = gcc_aip.ModelDeployOp(\n",
" deploy_op = ModelDeployOp(\n",
" model=training_op.outputs[\"model\"],\n",
" endpoint=endpoint_op.outputs[\"endpoint\"],\n",
" dedicated_resources_min_replica_count=1,\n",
" dedicated_resources_max_replica_count=1,\n",
" dedicated_resources_machine_type=\"n1-standard-4\",\n",
" dedicated_resources_machine_type=DEPLOY_COMPUTE,\n",
" )"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "get_test_items:batch_prediction"
},
"source": [
"### Get test item(s)\n",
"\n",
"Now do a batch prediction to your Vertex model. You will use arbitrary examples out of the dataset as a test items. Don't be concerned that the examples were likely used in training the model -- we just want to demonstrate how to make a prediction."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "get_test_items:automl,icn,csv"
},
"outputs": [],
"source": [
"test_items = !gsutil cat $IMPORT_FILE | head -n2\n",
"if len(str(test_items[0]).split(\",\")) == 3:\n",
" _, test_item_1, test_label_1 = str(test_items[0]).split(\",\")\n",
" _, test_item_2, test_label_2 = str(test_items[1]).split(\",\")\n",
"else:\n",
" test_item_1, test_label_1 = str(test_items[0]).split(\",\")\n",
" test_item_2, test_label_2 = str(test_items[1]).split(\",\")\n",
"\n",
"print(test_item_1, test_label_1)\n",
"print(test_item_2, test_label_2)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "copy_test_items:batch_prediction"
},
"source": [
"### Copy test item(s)\n",
"\n",
"For the batch prediction, copy the test items over to your Cloud Storage bucket."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "copy_test_items:batch_prediction"
},
"outputs": [],
"source": [
"file_1 = test_item_1.split(\"/\")[-1]\n",
"file_2 = test_item_2.split(\"/\")[-1]\n",
"\n",
"! gsutil cp $test_item_1 $BUCKET_NAME/$file_1\n",
"! gsutil cp $test_item_2 $BUCKET_NAME/$file_2\n",
"\n",
"test_item_1 = BUCKET_NAME + \"/\" + file_1\n",
"test_item_2 = BUCKET_NAME + \"/\" + file_2"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "make_batch_file:automl,image"
},
"source": [
"### Make the batch input file\n",
"\n",
"Now make a batch input file, which you will store in your local Cloud Storage bucket. The batch input file can only be in JSONL. For JSONL file, you make one dictionary entry per line for each data item (instance). The dictionary contains the key/value pairs:\n",
"\n",
"- `content`: The Cloud Storage path to the image.\n",
"- `mime_type`: The content type. In our example, it is a `jpeg` file.\n",
"\n",
"For example:\n",
"\n",
" {'content': '[your-bucket]/file1.jpg', 'mime_type': 'jpeg'}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "make_batch_file:automl,image"
},
"outputs": [],
"source": [
"import json\n",
"\n",
"import tensorflow as tf\n",
"\n",
"gcs_input_uri = BUCKET_NAME + \"/test.jsonl\"\n",
"with tf.io.gfile.GFile(gcs_input_uri, \"w\") as f:\n",
" data = {\"content\": test_item_1, \"mime_type\": \"image/jpeg\"}\n",
" f.write(json.dumps(data) + \"\\n\")\n",
" data = {\"content\": test_item_2, \"mime_type\": \"image/jpeg\"}\n",
" f.write(json.dumps(data) + \"\\n\")\n",
"\n",
"print(gcs_input_uri)\n",
"! gsutil cat $gcs_input_uri"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -1114,6 +1269,7 @@
"Next, you compile the pipeline and then exeute it. The pipeline takes the following parameters, which are passed as the dictionary `parameter_values`:\n",
"\n",
"- `import_file`: The Cloud Storage path to the dataset index file.\n",
"- `batch_files`: A list of Cloud Storage paths to the input batch files.\n",
"- `display_name`: The display name for the generated Vertex AI resources.\n",
"- `python_package`: The Python package for the custom training job.\n",
"- `python_module`: The Python module in the package to execute.\n",
@@ -1139,6 +1295,7 @@
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" \"import_file\": IMPORT_FILE,\n",
" \"batch_files\": [gcs_input_uri],\n",
" \"display_name\": \"flowers\" + TIMESTAMP,\n",
" \"python_package\": f\"{BUCKET_NAME}/trainer_flowers.tar.gz\",\n",
" \"python_module\": \"trainer.task\",\n",
@@ -1214,17 +1371,425 @@
" return EXECUTE_OUTPUT\n",
"\n",
"\n",
"print(\"imagedataset-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"imagedataset-create\")\n",
"print(\"\\n\")\n",
"print(\"image-dataset-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"image-dataset-create\")\n",
"print(\"\\n\\n\")\n",
"print(\"custompythonpackagetrainingjob-run\")\n",
"artifacts = print_pipeline_output(pipeline, \"custompythonpackagetrainingjob-run\")\n",
"print(\"\\n\")\n",
"print(\"\\n\\n\")\n",
"print(\"endpoint-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"endpoint-create\")\n",
"print(\"\\n\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-deploy\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-deploy\")"
"artifacts = print_pipeline_output(pipeline, \"model-deploy\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-batch-predict\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-batch-predict\")\n",
"output = !gsutil cat $artifacts\n",
"output = json.loads(output[0])\n",
"print(\"\\n\\n\")\n",
"print(\n",
" output[\"artifacts\"][\"batchpredictionjob\"][\"artifacts\"][0][\"metadata\"][\n",
" \"gcsOutputDirectory\"\n",
" ]\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "delete_pipeline"
},
"source": [
"### Delete a pipeline job\n",
"\n",
"After a pipeline job is completed, you can delete the pipeline job with the method `delete()`. Prior to completion, a pipeline job can be canceled with the method `cancel()`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "delete_pipeline"
},
"outputs": [],
"source": [
"pipeline.delete()"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "create_custom_training_job_op_from_component:intro"
},
"source": [
"## Using `create_custom_training_job_op_from_component`\n",
"\n",
"An alternative approach is for you to create your own component to do custom training, instead of creating a Python package and executing it with a `CustomPythonPackageTrainingOp`. In this case, what would have been inside the Python package is instead directly embedded in your component.\n",
"\n",
"You might do this for example if you are early on in the development of the training package and you want speed and convenience over scaling. One issue with this is that when executed it will only be seen and tracked as a component artifact, versus being seen and tracked as a CustomTrainingJob.\n",
"\n",
"The utility `google_cloud_pipeline_components.experimental.custom_job.utils.create_custom_training_job_op_from_component` provides you the benefits of both. This utility takes as input your custom training component and outputs a conversion to a `CustomTrainingJobOp` component."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "create_component:custom_train_model"
},
"source": [
"### Create a custom training job component\n",
"\n",
"First, you create a custom training component `custom_train_model`. In this component, you will use a very simple script to train a CIFAR-10 model. The script has very few bells and whistles otherthan:\n",
"\n",
"- Setting the learning rate, number of epochs, batch size and number of steps per epoch as parameters to your component.\n",
"- Setting the Cloud Storage location to save the trained model artifacts to.\n",
"\n",
"Note, you set the default value of `model_dir` to a null string. The reason you do this, is that the training service may alternately specifiy the location with the environment variable `AIP_MODEL_DIR`. The code logic is: if the paraneter `model_dir` is set (non-empty), use that value; otherwise use the location specified by the environment variable `AIP_MODEL_DIR`.\n",
"\n",
"Once the model is trained, you need to know where the model artifacts are located. Since their location can be either that of the `model_dir` parameter or the environment variable `AIP_MODEL_DIR`. You do this with the component `model_artifacts()`. If the `model_dir` parameter is non-empty, then return its value; otherwise construct the value of AIP_MODEL_DIR setting from the `base_output_directory` parameter."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "create_component:custom_train_model"
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.v1.custom_job import utils\n",
"from kfp.v2.dsl import Artifact\n",
"\n",
"\n",
"@component(\n",
" base_image=\"tensorflow/tensorflow:latest\",\n",
" packages_to_install=[\"tensorflow_datasets\"],\n",
")\n",
"def custom_train_model(\n",
" model_dir: str = \"\",\n",
" lr: float = 0.01,\n",
" epochs: int = 10,\n",
" steps: int = 200,\n",
" batch_size: int = 64,\n",
"):\n",
" import os\n",
"\n",
" import tensorflow as tf\n",
" import tensorflow_datasets as tfds\n",
"\n",
" if model_dir == \"\":\n",
" model_dir = os.getenv(\"AIP_MODEL_DIR\")\n",
"\n",
" # Preparing dataset\n",
" BUFFER_SIZE = 10000\n",
"\n",
" def get_data():\n",
"\n",
" # Scaling CIFAR10 data from (0, 255] to (0., 1.]\n",
" def scale(image, label):\n",
" image = tf.cast(image, tf.float32)\n",
" image /= 255.0\n",
" return image, label\n",
"\n",
" datasets, info = tfds.load(name=\"cifar10\", with_info=True, as_supervised=True)\n",
" return datasets[\"train\"].map(scale).cache().shuffle(BUFFER_SIZE).repeat()\n",
"\n",
" # Build the Keras model\n",
" def get_model():\n",
" model = tf.keras.Sequential(\n",
" [\n",
" tf.keras.layers.Conv2D(\n",
" 32, 3, activation=\"relu\", input_shape=(32, 32, 3)\n",
" ),\n",
" tf.keras.layers.MaxPooling2D(),\n",
" tf.keras.layers.Conv2D(32, 3, activation=\"relu\"),\n",
" tf.keras.layers.MaxPooling2D(),\n",
" tf.keras.layers.Flatten(),\n",
" tf.keras.layers.Dense(10, activation=\"softmax\"),\n",
" ]\n",
" )\n",
" model.compile(\n",
" loss=tf.keras.losses.sparse_categorical_crossentropy,\n",
" optimizer=tf.keras.optimizers.SGD(learning_rate=lr),\n",
" metrics=[\"accuracy\"],\n",
" )\n",
" return model\n",
"\n",
" def train_model(model, train_dataset):\n",
" model.fit(x=train_dataset, epochs=epochs, steps_per_epoch=steps)\n",
" return model\n",
"\n",
" train_dataset = get_data().batch(batch_size)\n",
"\n",
" model = get_model()\n",
"\n",
" model = train_model(model, train_dataset)\n",
"\n",
" model.save(model_dir)\n",
"\n",
"\n",
"@component()\n",
"def model_artifacts(model_dir: str, base_output_directory: str) -> str:\n",
" # location of model artifacts overridden by model_dir parameter\n",
" if model_dir != \"\":\n",
" return model_dir\n",
" # location of model artifacts specified by base_output_directory\n",
" else:\n",
" return base_output_directory + \"/model\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "create_custom_training_job_op_from_component"
},
"source": [
"### Convert your custom training component to a predefined CustomTrainingJobOp component\n",
"\n",
"Next, use the utility to convert your custom training component to a CustomTrainingJobOp component, as the required parameter. There are some additional optional keyword parameters to overide default settings in the worker pool specification, service account, and optional setting tensorboard instance and encryption key.\n",
"\n",
"Learn more about [create_custom_training_job_op_from_component reference](https://google-cloud-pipeline-components.readthedocs.io/en/google-cloud-pipeline-components-0.2.0/google_cloud_pipeline_components.experimental.custom_job.html)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "create_custom_training_job_op_from_component"
},
"outputs": [],
"source": [
"custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" custom_train_model, replica_count=1\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "create_custom_pipeline:custom_train_op"
},
"source": [
"## Construct custom training pipeline\n",
"\n",
"In the example below, you construct a pipeline for training a custom model using:\n",
"\n",
"1. Pipeline arguments, specify the locations of:\n",
" - `display_name`: The human readable name for the model and endpoint.\n",
" - `model_dir`: Optionally location (override) for saving the model artifacts\n",
" - `epochs`: The number of epochs.\n",
" - `steps`: The number of steps per epoch.\n",
" - `lr`: The learning rate.\n",
" - `project`: The project for executing the pipeline components.\n",
" - `location`: The location for executing the pipeline components.\n",
" - `deploy_image`: The serving container.\n",
"\n",
"\n",
"2. Use the converted `custom_job_training_op` to train the custom model.\n",
" - If model_dir is non-empty string, it will override the setting of base_output_directory.\n",
"\n",
"3. Use the custom component `model_artifacts` to determine the location of the model artifacts.\n",
" - If model_dir is non-empty string, return its location.\n",
" - Otherwise, return the derived location from base_output_directory.\n",
"\n",
"4. Use the prebuilt component `ModelUploadOp` to create a `Vertex AI Model` resource from the model artifacts.\n",
" - The location of the model artifacts is the output from the component `model_artifacts`.\n",
" - The `after(custom_job_op)` is added to serialize its execution, so its only executed if the training operation completes successfully.\n",
"\n",
"5. Use the prebuilt component `EndpointCreateOp` to create a `Vertex AI Endpoint` to deploy the trained model to, where:\n",
" - Since the component has no dependencies on other components, by default it would be executed in parallel with the model training.\n",
" - The `after(model_op)` is added to serialize its execution, so its only executed if the training operation completes successfully.\n",
" - The component returns the endpoint resource as `outputs[\"endpoint\"]`.\n",
"\n",
"6. Use the prebuilt component `ModelDeployOp` to deploy the trained `Vertex AI Model` to, where:\n",
" - The display name for the dataset is passed into the pipeline.\n",
" - The model is the output from the `ModelUploadOp`.\n",
" - The endpoint is the output from the `EndpointCreateOp`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "create_custom_pipeline:custom_train_op"
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"\n",
"PIPELINE_ROOT = \"{}/pipeline_root/custom_cifar10_training\".format(BUCKET_NAME)\n",
"\n",
"\n",
"@dsl.pipeline(name=\"custom-model-training-sample-pipeline\")\n",
"def pipeline(\n",
" display_name: str,\n",
" model_dir: str = \"\",\n",
" lr: float = 0.01,\n",
" epochs: int = 10,\n",
" steps: int = 200,\n",
" project: str = PROJECT_ID,\n",
" location: str = REGION,\n",
" deploy_image: str = \"us-docker.pkg.dev/cloud-aiplatform/prediction/tf2-cpu.2-3:latest\",\n",
"):\n",
" custom_job_op = custom_job_training_op(\n",
" model_dir=model_dir,\n",
" lr=lr,\n",
" epochs=epochs,\n",
" steps=steps,\n",
" project=project,\n",
" location=location,\n",
" base_output_directory=PIPELINE_ROOT,\n",
" )\n",
"\n",
" artifacts_op = model_artifacts(model_dir, PIPELINE_ROOT)\n",
"\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
" project=project,\n",
" display_name=display_name,\n",
" artifact_uri=artifacts_op.output,\n",
" serving_container_image_uri=deploy_image,\n",
" ).after(custom_job_op)\n",
"\n",
" endpoint_op = gcc_aip.EndpointCreateOp(\n",
" project=project,\n",
" location=location,\n",
" display_name=display_name,\n",
" ).after(model_upload_op)\n",
"\n",
" deploy_op = gcc_aip.ModelDeployOp(\n",
" model=model_upload_op.outputs[\"model\"],\n",
" endpoint=endpoint_op.outputs[\"endpoint\"],\n",
" dedicated_resources_min_replica_count=1,\n",
" dedicated_resources_max_replica_count=1,\n",
" dedicated_resources_machine_type=DEPLOY_COMPUTE,\n",
" )"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "run_custom_train_pipeline:custom_train_job"
},
"source": [
"### Compile and execute the pipeline\n",
"\n",
"Next, you compile the pipeline and then exeute it. The pipeline takes the following parameters, which are passed as the dictionary `parameter_values`:\n",
"\n",
"- `display_name`: The display name for the generated Vertex AI resources.\n",
"- `epochs`: The number of epochs.\n",
"- `project`: The project ID.\n",
"- `region`: The region.\n",
"\n",
"*Note:* In this execution, you do not override the location of the model artifacts -- i.e., model_dir parameter is a null string."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "run_custom_train_pipeline:custom_train_job"
},
"outputs": [],
"source": [
"compiler.Compiler().compile(\n",
" pipeline_func=pipeline, package_path=\"custom_cifar10_training.json\"\n",
")\n",
"\n",
"pipeline = aip.PipelineJob(\n",
" display_name=\"cifar10-custom_training\",\n",
" template_path=\"custom_cifar10_training.json\",\n",
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" \"display_name\": \"simple-example\",\n",
" \"epochs\": 20,\n",
" \"project\": PROJECT_ID,\n",
" \"location\": REGION,\n",
" },\n",
")\n",
"\n",
"pipeline.run()\n",
"\n",
"! rm -f custom_cifar10_training.json"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "view_pipeline_results:custom_train_job"
},
"source": [
"### View custom model training pipeline results\n",
"\n",
"Finally, you will view the artifact outputs of each task in the pipeline."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "view_pipeline_results:custom_train_job"
},
"outputs": [],
"source": [
"PROJECT_NUMBER = pipeline.gca_resource.name.split(\"/\")[1]\n",
"print(PROJECT_NUMBER)\n",
"\n",
"\n",
"def print_pipeline_output(job, output_task_name):\n",
" JOB_ID = job.name\n",
" print(JOB_ID)\n",
" for _ in range(len(job.gca_resource.job_detail.task_details)):\n",
" TASK_ID = job.gca_resource.job_detail.task_details[_].task_id\n",
" EXECUTE_OUTPUT = (\n",
" PIPELINE_ROOT\n",
" + \"/\"\n",
" + PROJECT_NUMBER\n",
" + \"/\"\n",
" + JOB_ID\n",
" + \"/\"\n",
" + output_task_name\n",
" + \"_\"\n",
" + str(TASK_ID)\n",
" + \"/executor_output.json\"\n",
" )\n",
" GCP_RESOURCES = (\n",
" PIPELINE_ROOT\n",
" + \"/\"\n",
" + PROJECT_NUMBER\n",
" + \"/\"\n",
" + JOB_ID\n",
" + \"/\"\n",
" + output_task_name\n",
" + \"_\"\n",
" + str(TASK_ID)\n",
" + \"/gcp_resources\"\n",
" )\n",
" if tf.io.gfile.exists(EXECUTE_OUTPUT):\n",
" ! gsutil cat $EXECUTE_OUTPUT\n",
" break\n",
" elif tf.io.gfile.exists(GCP_RESOURCES):\n",
" ! gsutil cat $GCP_RESOURCES\n",
" break\n",
"\n",
" return EXECUTE_OUTPUT\n",
"\n",
"\n",
"print(\"custom-train-model\")\n",
"artifacts = print_pipeline_output(pipeline, \"custom-train-model\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-artifacts\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-artifacts\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-upload\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-upload\")\n",
"print(\"\\n\\n\")\n",
"print(\"endpoint-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"endpoint-create\")\n",
"print(\"\\n\\n\")\n",
"print(\"model-deploy\")\n",
"artifacts = print_pipeline_output(pipeline, \"model-deploy\")\n",
"print(\"\\n\\n\")"
]
},
{
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -125,7 +125,11 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG\n",
" ! pip3 install --upgrade python-tabulate $USER_FLAG\n",
" ! pip3 install -U opencv-python-headless==4.5.2.52 $USER_FLAG"
]
},
{
@@ -375,7 +379,7 @@
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
@@ -449,9 +453,8 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.dataflow import \\\n",
" DataflowPythonJobOp\n",
"from google_cloud_pipeline_components.experimental.wait_gcp_resources import \\\n",
"from google_cloud_pipeline_components.v1.dataflow import DataflowPythonJobOp\n",
"from google_cloud_pipeline_components.v1.wait_gcp_resources import \\\n",
" WaitGcpResourcesOp"
]
},
@@ -645,7 +648,8 @@
"outputs": [],
"source": [
"%%writefile requirements.txt\n",
"apache-beam"
"apache-beam\n",
"future"
]
},
{
@@ -908,7 +912,8 @@
"source": [
"%%writefile requirements.txt\n",
"apache-beam\n",
"tensorflow-transform==1.2.0"
"tensorflow-transform==1.2.0\n",
"future"
]
},
{
@@ -935,6 +940,7 @@
"\n",
"REQUIRED_PACKAGES = [\n",
" 'tensorflow-transform==1.2.0',\n",
" 'future'\n",
"]\n",
"PACKAGE_NAME = 'my_package'\n",
"PACKAGE_VERSION = '0.0.1'\n",
File diff suppressed because it is too large Load Diff
@@ -90,9 +90,9 @@
"\n",
"The steps performed include:\n",
"\n",
"- Obtain resources from experimention stage.\n",
"- Obtain resources from the experimentation stage.\n",
" - Baseline model.\n",
" - Dataset schema/statstics for baseline model.\n",
" - Dataset schema/statistics for baseline model.\n",
"- Formalize a data preprocessing pipeline.\n",
" - Extract columns/rows from BigQuery table to local BigQuery table.\n",
" - Use Tensorflow Data Validation library to determine statistics, schema, and features.\n",
@@ -195,7 +195,11 @@
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG\n",
" ! pip3 install --upgrade python-tabulate $USER_FLAG\n",
" ! pip3 install -U opencv-python-headless==4.5.2.52 $USER_FLAG"
]
},
{
@@ -445,7 +449,7 @@
"):\n",
" # Get your GCP project id from gcloud\n",
" shell_output = !gcloud auth list 2>/dev/null\n",
" SERVICE_ACCOUNT = shell_output[2].strip()\n",
" SERVICE_ACCOUNT = shell_output[2].replace(\"*\", \"\").strip()\n",
" print(\"Service Account:\", SERVICE_ACCOUNT)"
]
},
@@ -541,9 +545,8 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.dataflow import \\\n",
" DataflowPythonJobOp\n",
"from google_cloud_pipeline_components.experimental.wait_gcp_resources import \\\n",
"from google_cloud_pipeline_components.v1.dataflow import DataflowPythonJobOp\n",
"from google_cloud_pipeline_components.v1.wait_gcp_resources import \\\n",
" WaitGcpResourcesOp"
]
},
@@ -1506,7 +1509,8 @@
"%%writefile requirements.txt\n",
"apache-beam\n",
"tensorflow-transform==1.2.0\n",
"tensorflow-data-validation==1.2"
"tensorflow-data-validation==1.2\n",
"future"
]
},
{
@@ -1533,7 +1537,8 @@
"\n",
"REQUIRED_PACKAGES = [\n",
" 'tensorflow-transform==1.2.0',\n",
" 'tensorflow-data-validation==1.2'\n",
" 'tensorflow-data-validation==1.2',\n",
" 'future'\n",
"]\n",
"PACKAGE_NAME = 'my_package'\n",
"PACKAGE_VERSION = '0.0.1'\n",
@@ -1598,7 +1603,7 @@
},
"outputs": [],
"source": [
"@component(packages_to_install=[\"tensorflow\", \"tensorflow-transform\"])\n",
"@component(packages_to_install=[\"tensorflow\", \"tensorflow-transform==1.2.0\", \"future\"])\n",
"def transformed_data_analysis(\n",
" metadata_location: str,\n",
" transformed_data_prefix: str,\n",
@@ -1681,7 +1686,7 @@
" staging_dir: str,\n",
" data_bucket: str,\n",
" metadata_location: str,\n",
" dataset_labels: str,\n",
" dataset_labels: dict,\n",
" year: int,\n",
" limit: int,\n",
" project: str = PROJECT_ID,\n",
@@ -1712,9 +1717,6 @@
" label=label_column,\n",
" )\n",
"\n",
" DataflowPythonJobOp.component_spec.implementation.container.image = (\n",
" \"gcr.io/ml-pipeline/google-cloud-pipeline-components:v0.2.0_dataflow_logs_fix\"\n",
" )\n",
" dataflow_python_op = DataflowPythonJobOp(\n",
" project=project,\n",
" location=region,\n",
@@ -1807,7 +1809,7 @@
" \"staging_dir\": PIPELINE_ROOT,\n",
" \"data_bucket\": BUCKET_NAME,\n",
" \"metadata_location\": BUCKET_NAME + \"/metadata.jsonl\",\n",
" \"dataset_labels\": str({\"user_metadata\": BUCKET_NAME[5:]}).replace(\"'\", '\"'),\n",
" \"dataset_labels\": {\"user_metadata\": BUCKET_NAME[5:]},\n",
" \"year\": 2020,\n",
" \"limit\": 300000,\n",
" \"project\": PROJECT_ID,\n",
@@ -1870,14 +1872,29 @@
" + str(TASK_ID)\n",
" + \"/gcp_resources\"\n",
" )\n",
" EVAL_METRICS = (\n",
" PIPELINE_ROOT\n",
" + \"/\"\n",
" + PROJECT_NUMBER\n",
" + \"/\"\n",
" + JOB_ID\n",
" + \"/\"\n",
" + output_task_name\n",
" + \"_\"\n",
" + str(TASK_ID)\n",
" + \"/evaluation_metrics\"\n",
" )\n",
" if tf.io.gfile.exists(EXECUTE_OUTPUT):\n",
" ! gsutil cat $EXECUTE_OUTPUT\n",
" break\n",
" return EXECUTE_OUTPUT\n",
" elif tf.io.gfile.exists(GCP_RESOURCES):\n",
" ! gsutil cat $GCP_RESOURCES\n",
" break\n",
" return GCP_RESOURCES\n",
" elif tf.io.gfile.exists(EVAL_METRICS):\n",
" ! gsutil cat $EVAL_METRICS\n",
" return EVAL_METRICS\n",
"\n",
" return EXECUTE_OUTPUT\n",
" return None\n",
"\n",
"\n",
"print(\"make-chicago-bq-dataset\")\n",
@@ -1898,8 +1915,8 @@
"print(\"transformed-data-analysis\")\n",
"artifacts = print_pipeline_output(pipeline, \"transformed-data-analysis\")\n",
"print(\"\\n\")\n",
"print(\"tabulardataset-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"tabulardataset-create\")\n",
"print(\"tabular-dataset-create\")\n",
"artifacts = print_pipeline_output(pipeline, \"tabular-dataset-create\")\n",
"print(\"\\n\")\n",
"\n",
"output = !gsutil cat $artifacts\n",
@@ -1958,7 +1975,7 @@
},
"outputs": [],
"source": [
"@component(packages_to_install=[\"tensorflow==2.5\", \"tensorflow-transform\"])\n",
"@component(packages_to_install=[\"tensorflow==2.5\", \"tensorflow-transform\", \"future\"])\n",
"def build_model(\n",
" dataset_id: str, display_name: str, deploy_image: str, bucket: str, project: str\n",
") -> str:\n",
@@ -2118,7 +2135,9 @@
" region: str = REGION,\n",
" labels: dict = {\"base_model\": \"1\"},\n",
"):\n",
" from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
" from google_cloud_pipeline_components.types import artifact_types\n",
" from google_cloud_pipeline_components.v1.model import ModelUploadOp\n",
" from kfp.v2.components import importer_node\n",
"\n",
" model_build_op = build_model(\n",
" dataset_id=dataset_id,\n",
@@ -2128,14 +2147,21 @@
" project=project,\n",
" )\n",
"\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
" display_name=display_name,\n",
" import_unmanaged_model_task = importer_node.importer(\n",
" artifact_uri=model_build_op.output,\n",
" serving_container_image_uri=deploy_image,\n",
" labels=labels,\n",
" artifact_class=artifact_types.UnmanagedContainerModel,\n",
" metadata={\n",
" \"containerSpec\": {\n",
" \"imageUri\": DEPLOY_IMAGE,\n",
" },\n",
" },\n",
" ).after(model_build_op)\n",
"\n",
" model_upload = ModelUploadOp(\n",
" project=project,\n",
" location=region,\n",
" )"
" display_name=display_name,\n",
" unmanaged_container_model=import_unmanaged_model_task.outputs[\"artifact\"],\n",
" ).after(import_unmanaged_model_task)"
]
},
{
@@ -3046,8 +3072,10 @@
" region: str = REGION,\n",
"):\n",
" from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
" from google_cloud_pipeline_components.v1.endpoint import (EndpointCreateOp,\n",
" ModelDeployOp)\n",
"\n",
" with dsl.Condition(warmup == \"True\", name=\"train-model\"):\n",
" with dsl.Condition(warmup == \"True\", name=\"warmup-model\"):\n",
"\n",
" warmup_op = gcc_aip.CustomPythonPackageTrainingJobRunOp(\n",
" project=project,\n",
@@ -3064,7 +3092,7 @@
" accelerator_count=accelerator_count,\n",
" )\n",
"\n",
" with dsl.Condition(warmup == \"False\", name=\"warmup-model\"):\n",
" with dsl.Condition(warmup == \"False\", name=\"train-model\"):\n",
"\n",
" training_op = gcc_aip.CustomPythonPackageTrainingJobRunOp(\n",
" project=project,\n",
@@ -3087,13 +3115,13 @@
" labels=label,\n",
" )\n",
"\n",
" endpoint_op = gcc_aip.EndpointCreateOp(\n",
" endpoint_op = EndpointCreateOp(\n",
" project=project,\n",
" location=region,\n",
" display_name=display_name,\n",
" ).after(training_op)\n",
"\n",
" deploy_op = gcc_aip.ModelDeployOp(\n",
" deploy_op = ModelDeployOp(\n",
" model=training_op.outputs[\"model\"],\n",
" endpoint=endpoint_op.outputs[\"endpoint\"],\n",
" dedicated_resources_min_replica_count=1,\n",
@@ -0,0 +1,91 @@
{
"pipelineSpec": {
"components": {
"comp-hello-world": {
"executorLabel": "exec-hello-world",
"inputDefinitions": {
"parameters": {
"text": {
"type": "STRING"
}
}
},
"outputDefinitions": {
"parameters": {
"Output": {
"type": "STRING"
}
}
}
}
},
"deploymentSpec": {
"executors": {
"exec-hello-world": {
"container": {
"args": [
"--executor_input",
"{{$}}",
"--function_to_execute",
"hello_world"
],
"command": [
"sh",
"-c",
"\nif ! [ -x \"$(command -v pip)\" ]; then\n python3 -m ensurepip || python3 -m ensurepip --user || apt-get install python3-pip\nfi\n\nPIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location 'kfp==1.8.11' && \"$0\" \"$@\"\n",
"sh",
"-ec",
"program_path=$(mktemp -d)\nprintf \"%s\" \"$0\" > \"$program_path/ephemeral_component.py\"\npython3 -m kfp.v2.components.executor_main --component_module_path \"$program_path/ephemeral_component.py\" \"$@\"\n",
"\nimport kfp\nfrom kfp.v2 import dsl\nfrom kfp.v2.dsl import *\nfrom typing import *\n\ndef hello_world(text: str) -> str:\n print(text)\n return text\n\n"
],
"image": "python:3.9"
}
}
}
},
"pipelineInfo": {
"name": "hello-world"
},
"root": {
"dag": {
"tasks": {
"hello-world": {
"cachingOptions": {
"enableCache": true
},
"componentRef": {
"name": "comp-hello-world"
},
"inputs": {
"parameters": {
"text": {
"componentInputParameter": "text"
}
}
},
"taskInfo": {
"name": "hello-world"
}
}
}
},
"inputDefinitions": {
"parameters": {
"text": {
"type": "STRING"
}
}
}
},
"schemaVersion": "2.0.0",
"sdkVersion": "kfp-1.8.11"
},
"runtimeConfig": {
"gcsOutputDirectory": "gs://andy-1234-221921aip-20220302183146/pipeline_root/hello_world",
"parameters": {
"text": {
"stringValue": "hi there"
}
}
}
}
@@ -0,0 +1,40 @@
name: Hello world
inputs:
- {name: text, type: String}
outputs:
- {name: Output, type: String}
implementation:
container:
image: python:3.9
command:
- sh
- -c
- |2
if ! [ -x "$(command -v pip)" ]; then
python3 -m ensurepip || python3 -m ensurepip --user || apt-get install python3-pip
fi
PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location 'kfp==1.8.11' && "$0" "$@"
- sh
- -ec
- |
program_path=$(mktemp -d)
printf "%s" "$0" > "$program_path/ephemeral_component.py"
python3 -m kfp.v2.components.executor_main --component_module_path "$program_path/ephemeral_component.py" "$@"
- |2+
import kfp
from kfp.v2 import dsl
from kfp.v2.dsl import *
from typing import *
def hello_world(text: str) -> str:
print(text)
return text
args:
- --executor_input
- {executorInput: null}
- --function_to_execute
- hello_world
+53 -3
View File
@@ -42,17 +42,67 @@ This stage may be done entirely by MLOps. We recommend:
### Get Started
[Get started with Google Artifact Registry](get_started_google_artifact_registry.ipynb)
[Get started with Google Artifact Registry](get_started_with_google_artifact_registry.ipynb)
```
The steps performed include:
- Creating a private Docker repository.
- Tagging a container image, specific to the private Docker repository.
- Pushing a container image to the private Docker repository.
- Pulling a container image from the private Docker repository.
- Deleting a private Docker repository.
```
Get started with Vertex Model Registry
Get started with Vertex ML Metadata
[Get started with Vertex ML Metadata](get_started_with_vertex_ml_metadata.ipynb)
```
The steps performed include:
- Create a `Metadatastore` resource.
- Create (record)/List an `Artifact`, with artifacts and metadata.
- Create (record)/List an `Execution`.
- Create (record)/List a `Context`.
- Add `Artifact` to `Execution` as events.
- Add `Execution` and `Artifact` into the `Context`
- Delete `Artifact`, `Execution` and `Context`.
- Create and run a `Vertex AI Pipeline` ML workflow to train and deploy a scikit-learn model.
- Create custom pipeline components that generate artifacts and metadata.
- Compare Vertex AI Pipelines runs.
- Trace the lineage for pipeline-generated artifacts.
- Query your pipeline run metadata.
```
Get started with custom model evaluation
Get started with A/B Testing
Get started with Vertex Explainable AI
[Get started with Vertex Explainable AI](get_started_with_vertex_xai.ipynb)
```
The steps performed include:
- Train an AutoML tabular model.
- Do a batch prediction with explanations.
- Do an online prediction with explanations.
- Train an custom TensorFlow tabular model.
- Manually set configuration metadata.
- Do a batch prediction with explanations.
- Do an online prediction with explanations.
- Automatically set configuration metadata.
- Train an custom TensorFlow image model.
- Manually set configuration metadata.
- Do a batch prediction with explanations.
- Do an online prediction with explanations.
- Train an custom XGBoost tabular model.
- Manually set configuration metadata.
- Do an online prediction with explanations.
- Train an custom scikit-learn tabular model.
- Manually set configuration metadata.
- Do an online prediction with explanations.
```
### E2E Stage Example
File diff suppressed because it is too large Load Diff
@@ -0,0 +1,484 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "copyright"
},
"outputs": [],
"source": [
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "title:generic,gcp"
},
"source": [
"# E2E ML on GCP: MLOps stage 4 : formalization: get started with Google Artifact Registry\n",
"\n",
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage4/get_started_with_google_artifact_registry.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage4/get_started_with_google_artifact_registry.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" </a>\n",
" </td>\n",
"</table>\n",
"<br/><br/><br/>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "overview:mlops"
},
"source": [
"## Overview\n",
"\n",
"\n",
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 4 : formalization: get started with Google Artifact Registry."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "objective:mlops,stage4,get_started_google_artifact_registry"
},
"source": [
"### Objective\n",
"\n",
"In this tutorial, you learn how to use `Google Artifact Registry`.\n",
"\n",
"This tutorial uses the following Google Cloud ML services:\n",
"\n",
"- `Google Artifact Registry`\n",
"\n",
"The steps performed include:\n",
"\n",
"- Creating a private Docker repository.\n",
"- Tagging a container image, specific to the private Docker repository.\n",
"- Pushing a container image to the private Docker repository.\n",
"- Pulling a container image from the private Docker repository.\n",
"- Deleting a private Docker repository."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "install_mlops"
},
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "install_mlops"
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG\n",
" ! pip3 install --upgrade torchvision $USER_FLAG\n",
" ! pip3 install --upgrade rpy2 $USER_FLAG"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "restart"
},
"source": [
"### Restart the kernel\n",
"\n",
"Once you've installed the additional packages, you need to restart the notebook kernel so it can find the packages."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "restart"
},
"outputs": [],
"source": [
"import os\n",
"\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" # Automatically restart kernel after installs\n",
" import IPython\n",
"\n",
" app = IPython.Application.instance()\n",
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "project_id"
},
"source": [
"#### Set your project ID\n",
"\n",
"**If you don't know your project ID**, you may be able to get your project ID using `gcloud`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "set_project_id"
},
"outputs": [],
"source": [
"PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "autoset_project_id"
},
"outputs": [],
"source": [
"if PROJECT_ID == \"\" or PROJECT_ID is None or PROJECT_ID == \"[your-project-id]\":\n",
" # Get your GCP project id from gcloud\n",
" shell_output = ! gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID:\", PROJECT_ID)"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "set_gcloud_project_id"
},
"outputs": [],
"source": [
"! gcloud config set project $PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "region"
},
"source": [
"#### Region\n",
"\n",
"You can also change the `REGION` variable, which is used for operations\n",
"throughout the rest of this notebook. Below are regions supported for Vertex AI. We recommend that you choose the region closest to you.\n",
"\n",
"- Americas: `us-central1`\n",
"- Europe: `europe-west4`\n",
"- Asia Pacific: `asia-east1`\n",
"\n",
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
"\n",
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "region"
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "timestamp"
},
"source": [
"#### Timestamp\n",
"\n",
"If you are in a live tutorial session, you might be using a shared test account or project. To avoid name collisions between users on resources created, you create a timestamp for each instance session, and append the timestamp onto the name of resources you create in this tutorial."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "timestamp"
},
"outputs": [],
"source": [
"from datetime import datetime\n",
"\n",
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "setup_vars"
},
"source": [
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "intro_gar"
},
"source": [
"## Introduction to Google Artifact Registry\n",
"\n",
"The `Google Artifact Registry` is a service for storing and managing artifacts in private repositories, including container images, Helm charts, and language packages. It is the recommended container image registry for Google Cloud.\n",
"\n",
"Learn more about [Quick start for Docker](https://cloud.google.com/artifact-registry/docs/docker/quickstart)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_enable_api"
},
"source": [
"### Enable Artifact Registry API\n",
"\n",
"First, you must enable the Artifact Registry API service for your project.\n",
"\n",
"Learn more about [Enabling service](https://cloud.google.com/artifact-registry/docs/enable-service)."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_enable_api"
},
"outputs": [],
"source": [
"! gcloud services enable artifactregistry.googleapis.com"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_create_repo"
},
"source": [
"## Create a private Docker repository\n",
"\n",
"Your first step is to create your own Docker repository in Google Artifact Registry.\n",
"\n",
"1. Run the `gcloud artifacts repositories create` command to create a new Docker repository with your region with the description \"docker repository\".\n",
"\n",
"2. Run the `gcloud artifacts repositories list` command to verify that your repository was created."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_create_repo"
},
"outputs": [],
"source": [
"PRIVATE_REPO = \"my-docker-repo\"\n",
"\n",
"! gcloud artifacts repositories create {PRIVATE_REPO} --repository-format=docker --location={REGION} --description=\"Docker repository\"\n",
"\n",
"! gcloud artifacts repositories list"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_auth"
},
"source": [
"### Configure authentication to your private repo\n",
"\n",
"Before you push or pull container images, configure Docker to use the `gcloud` command-line tool to authenticate requests to `Artifact Registry` for your region."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_auth"
},
"outputs": [],
"source": [
"! gcloud auth configure-docker {REGION}-docker.pkg.dev --quiet"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_get_example"
},
"source": [
"### Obtain an example container image\n",
"\n",
"For demonstration purposes, you obtain (pull) a local copy of our demonstration container image: `hello-app:1.0`"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_get_example"
},
"outputs": [],
"source": [
"! docker pull us-docker.pkg.dev/google-samples/containers/gke/hello-app:1.0"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_tag_image"
},
"source": [
"## Tagging your container image\n",
"\n",
"Now that you have your own container image, the first step is to tag your image.\n",
"\n",
"- Tagging the Docker image with a repository name configures the docker push command to push the image to a specific location, e.g., us-central1-docker.pkg.dev.\n",
"\n",
"- `:my-tag` is a tag you're adding to the Docker image. If a tag is not specified, it defaults to `:latest`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_tag_image"
},
"outputs": [],
"source": [
"CONTAINER_NAME = \"my-image:my-tag\"\n",
"\n",
"! docker tag us-docker.pkg.dev/google-samples/containers/gke/hello-app:1.0 us-central1-docker.pkg.dev/{PROJECT_ID}/{PRIVATE_REPO}/{CONTAINER_NAME}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_push_image"
},
"source": [
"## Push your image to your private Docker repository\n",
"\n",
"Next, push your container to your private Docker repository."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_push_image"
},
"outputs": [],
"source": [
"! docker push {REGION}-docker.pkg.dev/{PROJECT_ID}/{PRIVATE_REPO}/{CONTAINER_NAME}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_pull_image"
},
"source": [
"## Pull your image from your private Docker repostory\n",
"\n",
"Now pull your container from your private Docker repository."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_pull_image"
},
"outputs": [],
"source": [
"! docker pull {REGION}-docker.pkg.dev/{PROJECT_ID}/{PRIVATE_REPO}/{CONTAINER_NAME}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "gar_delete_repo"
},
"source": [
"### Deleting your private Docker repostory\n",
"\n",
"Finally, once your private repository becomes obsolete, use the command `gcloud artifacts repositories delete` to delete it `Google Artifact Registry`."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "gar_delete_repo"
},
"outputs": [],
"source": [
"! gcloud artifacts repositories delete {PRIVATE_REPO} --location={REGION} --quiet"
]
}
],
"metadata": {
"colab": {
"name": "get_started_with_google_artifact_registry.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff

Some files were not shown because too many files have changed in this diff Show More