Compare commits

...
Author SHA1 Message Date
Andrew Ferlitsch 97532cf2a5 fix: fine-tuning 2022-09-07 17:25:18 +00:00
Andrew Ferlitsch 463e6a5d1f fix: fine-tuning 2022-09-07 17:23:01 +00:00
Andrew FerlitschandGitHub aa09d46265 feat: batch prediction for AutoML text models (#929)
* feat: Automl text model batch predict

* feat: Automl text model batch predict

* feat: Automl text model batch predict
2022-09-07 13:14:16 -04:00
Andrew FerlitschandGitHub 5667967131 feat: add BQ input example (#926)
* feat: add notebook for custom tabular batch predict

* feat: add notebook for custom tabular batch predict

* feat: add example for BQ input

* feat: add example for BQ input

* feat: add example for BQ input

* feat: add example for BQ input
2022-09-07 08:38:36 -07:00
4e4f532658 feat: batch prediction for automl tabular models (#928)
* feat: notebook for AutoML tabular batch prediction

* feat: notebook for AutoML tabular batch prediction

Co-authored-by: gericdong <itseric@google.com>
2022-09-06 15:53:54 -04:00
Andrew FerlitschandGitHub 14b2ce4f2e feat: notebook for batch predict for automl image models (#927)
* feat: batch predict for automl image model

* feat: batch predict for automl image model
2022-09-06 11:45:04 -04:00
Chun-Hsiang WangandGitHub c14b98c92d samples: Minor fix for the wording. (#924) 2022-09-05 10:42:25 -07:00
8275ea6c49 fix: correct the download_url (#923)
* fix: correct the download_url

* fix: fixed formatting issue

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-02 17:04:42 -04:00
40fbffcc95 Sdk automl image object detection batch (#869)
* changed to andrew comments

* changes according to andrew comments

* changes according to andrew comments

* review changes

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-02 13:34:25 -07:00
Andrew FerlitschandGitHub 08bb513488 feat: Batch prediction for custom tabular model (#920)
* feat: add notebook for custom tabular batch predict

* feat: add notebook for custom tabular batch predict
2022-09-01 20:33:34 -04:00
Chun-Hsiang WangandGitHub b298f83cd3 Vertex Prediction PyTorch Experimental: Add a sample for pre-built PyTorch deployments. (#898)
* samples: Add a new sample for pre-built Pytorch deployments. It's
borrowed from the examples in community-content/pytorch_text_classification_using_vertex_sdk_and_gcloud.

* samples: Removed all training related stuff in the notebooks.

* samples: Fixed comments.

* samples: Updated readme.

* samples: Updated emails for Pytorch launch.
2022-09-01 11:48:59 -07:00
Andrew FerlitschandGitHub 659cbb54c4 feat: add model monitoring with custom container (#919)
* feat: add notebook using custom deployment container

* feat: add notebook using custom deployment container
2022-09-01 10:22:05 -07:00
6ddcaa540a fix: tf serving workaround (#917)
* fix: pin TF serving image

* fix: pin TF serving image

Co-authored-by: gericdong <itseric@google.com>
2022-09-01 12:58:27 -04:00
1656c57b18 feat: extend image batch notebook (#916)
* feat: add notebook for custom image model batch prediction

* feat: add notebook for custom image model batch prediction

* fix: review comments

* fix: review comments

* feat: extend image batch notebook

* feat: extend image batch notebook

Co-authored-by: gericdong <itseric@google.com>
2022-09-01 09:56:36 -07:00
6cac60f74a Sdk feature store ver1 (#790)
* Added condition to create Featurestore if it doesn't exist

* Ran Linter Test

* Made changes mentioned in review

* Ran Linter Test

* Attached uuid to featurestore_id to avoid error while creating featurestore with existing name

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-09-01 08:57:16 -07:00
Andrew FerlitschandGitHub 55e37f795c feat: notebook for batch prediction with custom image model (#915)
* feat: add notebook for custom image model batch prediction

* feat: add notebook for custom image model batch prediction

* fix: review comments

* fix: review comments
2022-08-31 10:38:31 -07:00
c030d7ef74 use dataset instead of datasets (#892)
less chance for an error and confusion in name clashing with the `datasets` pypi package also used in the notebook.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-31 07:44:46 -07:00
Andrew FerlitschandGitHub 96be449c69 feat: add notebook for MM autoML (#912)
* feat: model monitoring for AutoML

* feat: model monitoring for AutoML

* fix: correction on AutoML

* fix: correction on AutoML
2022-08-30 12:45:45 -07:00
e40ddab4d5 Upgrade to DataprocPySparkBatch v1 component and add Vertex AI placeholder features (#910)
* Fix typo in notebook heading.

* Fix linting issues.

* Use gcpc v1 components and use Vertex AI for model upload and serving.

* Notebook cleanup

* Minor heading cleanup

* Fix linting issues

* Fix linting issues

* Fix linting issues

* Fix linting issues

Co-authored-by: Win Woo <wwoo@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-30 10:46:21 -07:00
Michael HuandGitHub d02bc2d56b pin arima notebook dependencies (#905)
Pins the versions of packages installed in the notebook in anticipation for a breaking change to the GCPC package.
2022-08-29 19:35:54 -04:00
76b641b23d fix: private endpoint example (#909)
* fix: remove gcloud usage

* fix: remove gcloud usage

* fix: review comments

* fix: review comments

Co-authored-by: nayaknishant <nishantnayak@google.com>
2022-08-29 12:16:18 -07:00
Andrew FerlitschandGitHub bbf4345e76 fix: remove Pantheon links (#908)
* fix: issue 194103604

* fix: issue 194103604
2022-08-28 11:24:32 -04:00
058358a795 Vertex SDK AutoML Image Object Detection (#808)
* new notebook Vertex SDK AutoML Image Object Detection

* new notebook Vertex SDK AutoML Image Object Detection

* new notebook of Vertex SDK AutoML Image Object Detection

* new notebook of Vertex SDK AutoML Image Object Detection

* linter test

* linter test

* andrew commented changes

* andrew commented changes

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 15:56:46 -07:00
Andrew FerlitschandGitHub 1c2f75f680 update: GetVertexModelOp (#907)
* update: use GetVertexModelOp

* update: use GetVertexModelOp
2022-08-26 12:12:09 -07:00
Andrew FerlitschandGitHub 999866fad1 feat: model monitoring custom (#906)
* feat: notebook for custom models

* feat: notebook for custom models

* fix: refining

* fix: refining

* fix: review updates

* fix: review updates
2022-08-26 08:58:54 -07:00
89f4571a2c Create explore_data_in_bigquery_with_workbench.ipynb (#885)
* Create explore_data_in_bigquery_with_workbench.ipynb

Adding in notebook for exploratory data analysis as part of "Data to AI" effort. See this Colab for what this notebook looks like after it is run: https://colab.research.google.com/drive/1JeNeMtj2A_5P5vo9wxSkrwHQM5JQSoAu. Submitting it with outputs shown since a lot of this about interactive visualization, which can inspire folks to use/read the notebook beyond just the code.

* Update CODEOWNERS

Adding owner for forthcoming exploratory data analysis notebook

* Update CODEOWNERS

* Updating exploratory data analysis notebook with latest updates from linter/review

* Updated notebook formatting to try to pass format test

* Trying again to pass notebook formatting test

* Trying again to pass notebook formatting test

* Trying again to pass notebook formatting test

* Linted version of notebook & better project picker

* Uploading linted version from ivanmkc@

* Update CODEOWNERS with EDA notebook

* Updated notebook w/ Tech Writer edits, re-ran all

* 1-2 minor text updates, try to pass linter again

* Trying w/ updated linted file from ivanmkc@

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 08:46:17 -07:00
eaff81fd97 New Build model experimentation lineage with prebuild code (#785)
* new changes of build model notebook

* new changes of build model notebook

* linter test issues

* linter test issues

* review changes

* review changes

* review changes

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 08:42:15 -07:00
976ed94cf2 metrics_viz_run_compare_kfp (#847)
* added new cell for is_colab condition

* added new cell for is_colab condition

* changes andrew comments

* changes andrew comments

* review changes

* review changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-26 08:26:58 -07:00
haomengchaoandGitHub 8ab8ef9ca9 update featurestore api version (#861)
* update api version

* fix tests

* remove unused import

* Run lint to format the change
2022-08-25 10:05:45 -07:00
eaff80a920 Fraud detection notebook2 (#821)
* Made minor changes

* Ran linter test

* Made changes mentioned in the review

* Ran Linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-25 09:49:24 -07:00
Andrew FerlitschandGitHub 8646285c26 fix: fine-tuning (#902)
* feat: new mm notebook

* feat: new mm notebook

* fix: fine-tuning

* fix: fine-tuning

* fix: review comments

* fix: review comments

* fix: review comments

* fix: review comments
2022-08-25 08:34:34 -07:00
7cad8680e1 Sdk automl tabular binary classification batch explain (#829)
* Changed prediction_output format from csv to jsonl to support generate_explanations

* ran linter test

* Made the changes as mentioned in the review

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-25 08:05:21 -07:00
4f66324883 Google cloud pipeline components automl tabular (#843)
* Removed try except blocks from cleanup section

* Ran Linter test

* Made changes mentioned in review and removed globals

* Removed an unused variable

* Ran Linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-24 21:55:50 -07:00
468fd144d2 New auto ml tabular classification bean (#787)
* new notebook of classification beans

* new notebook of classification beans

* changes on andrew comments

* changes on andrew comments

* json file issues

* json file issue

* fixes issues from reviews: adds parameter descriptions, fixes clean up, textual updates and replaces gapic functionality

* ran linter test

* adds the missing machine-type parameter

* ran linter test

* retreives the metrics using dict method

* removes unused variables

* ran linter test

* replaces old code for resource-name with new one

* ran linter test

* updates fetching the resourceName from the training artifacts

* ran linter test

* adds wait method for endpoint deployment

* ran linter test

* removes the wait method

* ran linter test

* adds wait gcp resources component

* ran linter test

* updates colab link, removes wait component, sets force to true in delete endpoint step

* ran linter test

* adds endpoint.wait() method

* ran linter test

* moves model deletion down the endpoint deletion and removes endpoint.wait() method

* ran linter test

Co-authored-by: Krishna Chaitanya Movva <krishr2d2@gmail.com>
Co-authored-by: Krishna Chaitanya Movva <krishna.movva@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-24 13:30:48 -07:00
Rosie ZouandGitHub 2503c3411c chore: fix typo in notebook (#900)
This fix was previously made by Yang Pan in https://github.com/googleapis/python-aiplatform/pull/1437 but closed due to the notebook being moved out of the main Vertex SDK repo.
2022-08-24 11:03:22 -07:00
Andrew FerlitschandGitHub 94b27550e8 feat: model monitor notebook (#899)
* feat: new mm notebook

* feat: new mm notebook
2022-08-24 08:56:18 -07:00
Soheila ZangenehandGitHub 3542e0b0a3 Add bqml vertexai model registry notebook (#842)
* Add bqml-vertexai-model-registry notebook

* Run linter

* Add notebook to CODEOWNERS file

* Update the links

* Ran linter again

* Rename bigquey-ml folder to model-registry

* Add bigquery-ml folder

* Moved the notebook

* Deleted folder

* Resolve comments

* Use UUID

* Remove using existing endpoint

* Remove try statement

* Get model sample based on model's name

* Use job.result to check query job status

* Run linter

* Fix dataset not found error by adding region in bq client creation

* Revert changes

* Fix bq bugs

* Run linter

* Resolve comments

* Display dataframe

* Updated the codeowner file
2022-08-24 10:58:46 -04:00
Andrew FerlitschandGitHub 5cf3b64618 fix: add BQ batch format info (#895)
* fix: add more info on BQ batch format

* fix: add more info on BQ batch format
2022-08-23 09:56:04 -07:00
885bfd56e5 Vertex AI Pipelines - Dataproc Serverless components - Notebook review (#866)
* review dataproc serverless notebook

* linter passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-23 09:44:34 -07:00
3a5eec64af Vertex AI Experiments - Compare pipeline runs - Notebook review (#854)
* experiments cuj1 review

* linter test passed

* typo

* linter test passed

* add correct library. add IAM roles

* linter test passed

* minor fix

* linter test passed

* add api

* linter test passed

* remove library

* linter test passed

* fix

* linter passed

* check

* linter passed

* add text

* linter passed

* minor changes

* andy reviews

* linter passed

* fix link. fix warnings

* linter passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-23 07:57:41 -07:00
8cdc7f1f79 Modified notebook multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb (#886)
* modified notebook according to template

* ran linter

Co-authored-by: gericdong <itseric@google.com>
2022-08-22 10:57:24 -04:00
Ivan CheungandGitHub 84fd10f408 fix: Fixed kernel spec by forcing it to use python3 (#889) 2022-08-19 18:43:07 -07:00
Andrew FerlitschandGitHub 7804c860c5 fix: replace tabs with spaces in JSON template (#888)
* fix: replace tabs with spaces in JSON template

* fix: replace tabs with spaces in JSON template
2022-08-19 11:11:08 -07:00
Andrew FerlitschandGitHub ed0c1c74a6 fix: typo in serving_container_uri parameter (#887) 2022-08-19 08:49:12 -07:00
Andrew FerlitschandGitHub 5127a59e92 Model monitoring (#883)
* fix: notebook template tuning

* fix: notebook template tuning

* fix: possible confusion on when to wait for the email notification

* fix: possible confusion on when to wait for the email notification
2022-08-19 08:38:29 -07:00
d8df732d6b Replace GAPIC with SDK - Model Monitoring Notebook (#879)
* Replace GAPIC with SDK

* Run linter

* Remove unused variables

* Run linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-18 11:41:11 -07:00
9c10899db8 AutoML Video Classificaton (#871)
* changes according to andrew review comments

* changes according to andrew review comments

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-18 07:25:14 -07:00
Ivan NardiniandGitHub 80770188ec Vertex AI Experiments - Model training - Notebook review (#853)
* experiments cuj1 review

* linter test passed

* add IAM role

* linter test passed

* add rm local dir

* linter test passed

* add api

* linter test passed

* remove libraries

* linter test passed

* solve build error

* fix issue

* clean

* linter passed

* fix dependency

* linter passed

* add dependency

* linter passed

* add dependency

* linter passed

* delete bucket flag fix

* linter passed
2022-08-17 10:43:34 -04:00
fa91e45018 Adds the updated managed_notebooks/predictive_maintenance notebook to the official folder (#521)
* adds the updated predictive-maintenance (managed)notebook from community to official folder

* ran linter test

* resubmitting during phase2

* ran linter test

* addresses the review comments: updates based on the new template, sets delete_bucket to False

* ran linter test

* replaces timestamp with uuid

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-16 09:39:07 -07:00
fa27309134 Fixes the issues from the regression tests (#822)
* fixes tensorflow version, replaces timestamp with uuid, adds service-account and minor textual changes

* removes second defnition of random library

* ran linter test

* uncomments the user flag and updates the installation command

* ran linter test

* removes the extra backslash

* ran linter test

* updates the installation step to fix long running compatibility checks

* ran linter test

* updates the METADATA path during installation steps

* ran linter test

* adds google-api-core version in the installation

* ran linter test

* removes METADATA step during installation

* ran linter test

* updates google api-core & auth versions

* ran linter test

* fixes tensorflow version, replaces timestamp with uuid, adds service-account and minor textual changes

* removes second defnition of random library

* ran linter test

* uncomments the user flag and updates the installation command

* ran linter test

* removes the extra backslash

* ran linter test

* updates the installation step to fix long running compatibility checks

* ran linter test

* updates the METADATA path during installation steps

* ran linter test

* adds google-api-core version in the installation

* ran linter test

* removes METADATA step during installation

* ran linter test

* updates google api-core & auth versions

* ran linter test

* fixes the issues from review: cell descriptions, parameter definitions, tense changes, 3rd person --> 2nd person, list model after pipeline run

* ran linter test

* removes the METADATA hack and updates the installations

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-16 09:11:30 -07:00
udaypunnaandGitHub 7b85f76384 custom_model_training_and_batch_prediction (#873)
* changed based on andrew review comments

* changed based on andrew review comments

* import library issues

* import library issues

* import issues

* import issues
2022-08-16 08:40:33 -07:00
40a0477b08 modified notebook automl-text-classification.ipynb (#757)
* modified notebook

* modified notebook

* added new notebook

* added new notebook

* new auto_ml_text_classifiation

* new auto_ml_text_classifiation

* new automl text classification

* linter test

* linter test

* changes on andrew comments

* changes on andrew comments

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-15 17:53:52 -07:00
839c7dddb8 Vertex AI Experiments - Compare Models - Notebook review (#852)
* experiments cuj1 review

* linter test passed

* typo

* linter test passed

* add andy reviews

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-15 09:49:50 -07:00
Andrew FerlitschandGitHub 578cfb7da7 fi: Issue 850 (#863)
* fix: add missing end_run() for experiment

* fix: add missing end_run() for experiment
2022-08-15 08:57:07 -07:00
Ivan CheungandGitHub b129c0bf43 Update CODEOWNERS (#864)
Use proper Github username.
2022-08-12 17:21:39 -04:00
07b4c37135 Automl links fix (#742)
* fixing links to open notebook - main and images

* linter test changes

* fixes the papermill execution error(hard-coded bucket link was the cause)

* ran linter test

* adds minor textual changes

* ran linter test

* fixes issues from review: future tense, copyright year, section placement, latest sdk methods, new updates from the template

* ran linter test

Co-authored-by: Manuel Amunategui <manuel.amunategui@springml.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-12 12:34:53 -07:00
f48fb1c650 Modified file churn_prediction_for_game_developers (#809)
* made changes

* made changes

* ran linter test

* made changes

* ran linter

* made changes

* ran linter

* changes suggested by andrew done

* ran linter

* replaced timestamp with uuid

* ran linter

* changed bucket creation command according to template

* ran linter

* changed text in overview

* changed region cell from markdown to code

* made changes

* replaced dataset from constant to a variable

* replaced constant dataset_id with a variable

* ran linter

* changed suggested by andrew done

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-12 08:40:38 -07:00
3bbd59311c Made UUID Changes to SDK_BigQuery_Custom_Container_Training.ipynb (#849)
* MAde UUID changes

* Ran Linter test

* made some minor changes

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-12 08:08:32 -07:00
Krishna Chaitanya MovvaandGitHub 15bb4cea73 Fixes the issues(missing variable) from regression tests, adds minor updates from the template. (#823)
* adds the missing delete_bucket variable, adds steps to configure SERVICE_ACCOUNT

* removes unnecessary random import

* ran linter test

* removes the src folder dependency to run on Colab, adds the pipeline.wait step, updates the cleanup steps

* ran linter test

* fixed issues from review: section posistions, tense changes, section descriptions, template updates

* ran linter test
2022-08-12 08:07:11 -07:00
Andrew FerlitschandGitHub 1511cc9fd1 fix: branding updates from autoreview (#862)
* autoreview: branding fixes

* fix: improve installation detection

* cleanup: rm tmp file

* fix: lint issues

* fix: 2nd try at lint fixes
2022-08-11 18:32:47 -07:00
2885a7a70f Migrated matching engine notebook to official and added VPC network support to CI (#836)
* Added matching engine notebook official

* Ran linter

* Added matching engine to .cloud-build/test_notebook_vm.txt

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 18:30:22 -07:00
ea36f5c43e Vertex SDK Custom Image Classification with pre-built training container (#833)
* new notebook of custom image classification

* new notebook of custome image classification

* andrew commented changes

* andrew commented changes

* andrew commented changes

* andrew commented changes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 14:58:49 -07:00
a905a6305f fixed cleanup cell, cosmetic and doc improvements, and removed load test (to avoid flakiness), (#859)
* fix cleanup cell and print out more info on xai prediction test

* lint fix

* remove load test

* lint fixes

* lint fix

* fix andrews comments

* lint fix

* missing newline

* lint fixes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 14:04:28 -07:00
Ivan CheungandGitHub aeaeddcc75 Update PULL_REQUEST_TEMPLATE.md (#860)
Updated PR template to emphasize need for a summary and checklist. Otherwise, people tend to skip this standard practice.
2022-08-11 16:18:54 -04:00
161965cfb0 Fixes the exception in batch-explain notebook in the official folder (#810)
* fixes exception(reg-test), replaces timestamp with uuid, minor changes

* ran linter test

* resolved review comments: license year, Vertex AI SDK, dataset after objective and future tense

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 10:25:51 -07:00
b9d4457474 Modified notebook forecasting-retail-demand (#827)
* deleted file in community and added file in official folder

* renamed file

* ran linter test

* renamed file

* ran linter

* made changes

* ran linter test

* made changes

* ran linter test

* made changes

* ran linter test

* made changes

* ran linter

* made change

* ran linter test

* changes suggested by andrew done

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 09:31:27 -07:00
a5b6bcfab1 those two files are moved to official folder.Deleting them in community content (#855)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 09:14:02 -07:00
5d55f5b0d2 Modified notebook pricing-optimization.ipynb (#834)
* modified notebook according to notebook_template.

* ran linter

* Added create dataset step

* ran linter

* replaced hardcoded dataset name with a variable

* ran linter

* changes suggested by nadrew done

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 09:00:13 -07:00
36ace6f4a6 deleted inventory_prediction_folder,folder moved to official (#856)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 08:24:39 -07:00
32d9b416c1 UUID changes done comparing_pipeline_runs.ipynb (#759)
* done UUID changes

* ran lintertest

* made changes in cleanup section

* ran lintertest

* done UUID changes

* ran lintertest

* made changes in cleanup section

* ran lintertest

* made changes in cleanup section

* Ran linter test

* made UUID changes

* RAN linter test

* Made Some minor Chanages notebook

* Ran Linter Test

* small changes made

* Ran Linter Test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-11 08:07:17 -07:00
1c6309f401 Modified notebook SDK_AutoML_Video_Classification.ipynb (#839)
* modified notebook according to template, tensorflow library is used only for file opening so instead of tf we used bucket.blob.download_as_string()

* ran linter

* all changes requested by andrew are done

* cleared all outputs

* making changes to run linter test

* making changes to run linter test

* ran linter

* removed region text in create bucket step

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-10 19:05:41 -07:00
728dec8526 Updates the custom-tabular-bq-managed-dataset notebook according to the new template (#780)
* updates the configuring steps, replaces timestamp with uuid, expands the imports

* ran linter test

* separates the vertex-ai and bigquery initialization steps

* adds comment to cell_24

* adds blank line to cell_24:7:1

* adds blank line to cell_24:7:1

* ran linter test

* fixes aiplatform+bigquery installation compatibility issue

* ran linter test

* fixes installation dependencies

* ran linter test

* fixes the issues from the review: future tense, section positions, updates from the latest template

* ran linter test

* fixes the issues from the review: Code formatting, delete redundant cells, resource name changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-10 08:41:50 -07:00
sudarshan-SpringMLandGitHub 7692f902dd Added minor changes to training-multi-class-classification-model-for-ads-targeting-usecase notebook (#735)
* added new file

* ran linter test

* made small changes

* ran linter

* added file

* ran linter

* changes requested by andrew done

* ran linter
2022-08-10 08:03:42 -07:00
9281403198 fix cleanup cell to undeploy models before deleting endpoint and remove BQ table and dataset (#846)
* fix artifact cleanup

* lint fixes

* remove extraneous echo

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 20:09:25 -07:00
2be602fbef Update comparing_local_trained_models.ipynb (#704)
Install from Pypi

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 15:39:54 -07:00
b140077eb1 Change REGION_NAME to REGION to match flag set earlier in notebook (#734)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 14:54:22 -07:00
d3139f7df8 Added colab , installed some packages, added some code based on standard template and made changes in cleanup section for the file inventory_prediction.ipynb (#533)
* Added notebook

* Ran linter test

* added pyarrow to install

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: sudarshan-SpringML <82567512+sudarshan-SpringML@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 14:49:40 -07:00
72baced988 model monitoring notebook fixes (#841)
* fix model monitoring notebook

* lint fixes

* fixed Soheila's review comments

* fix Andrew's comments

* lint fixes

* clean up install packages per review request

* lint fixes

* fix more comments from Andrew

* lint fixes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-09 14:16:54 -07:00
Soheila ZangenehandGitHub 5232654705 Update folder name to training (#845) 2022-08-09 12:29:34 -07:00
Andrew FerlitschandGitHub 125fe32eb2 feat: notebook for DASK training (#837)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region

* fix: set MODEL_DIR for HPT

* fix: set MODEL_DIR for HPT

* feat: add batch example

* feat: add batch example

* feat: add batch example

* feat: add batch example

* feat: add notebook for DASK training

* feat: add notebook for DASK training
2022-08-08 16:17:28 -07:00
Andrew FerlitschandGitHub 614f4154dc fix: owner names 2022-08-08 15:50:33 -07:00
Andrew FerlitschandGitHub 970415398b fix: owner username 2022-08-08 15:46:57 -07:00
Hyunuk LimandGitHub a052a3d361 A new notebook for Spark Sample (#720)
* Created spark notebook with test code

* Implemented experimental code for poly_view

* implemented the table

* WIP-notebook

* moved experimental to tutorial

* delete experimental code and rename the notebook

* clear all outputs

* fix: delete outputs again

* fix: changed template to the newer one

* fix: modify link on workbench

* add creating a cluster

* Completed Before you begin part

* Change execution sequence

* completed write back process

* change order that switching kernel goes top

* modify pie chart to bar chart

* Completed write up part

* WIP: adding description and comments.

* WIP: delete outputs

* fix: nbqa done

* Completed the first draft

* Delete %%time from cells

* Apply changes as per the code review from Brad except SparkSql

* delete outputs

* Change SparkSQL to Spark API

* change label to xlabel

* fix: description in Dataset

* fix: change BUCKET_NAME to DATASET_NAME, link for the region, and add descriptions and examples for frequency table

* fix: move normalize_name to top of the cell

* fix: refactor udf functions and descriptions

* fix: add link for udf

* fix: description in Dataset

* fix: grammer

* fix: add declared in the sentence

* fix: small changes on grammar

* fix: delete string

* fix: change UserDefinedFunction to udf

* fix: as per TW's code review

* fix: reorder REGION and TIMESTAMP under Creating a GCS bucket

* fix: lint

* chore: add bmiro@ as a codeowner of this doc

* fix: change the variable to fix a bug

* fix: as per TW's second review

* fix: add installation part to pass the ci test

* fix: url for links to main

* fix: delete disabling API since it doesn't affect to the pricing

* fix: add conditions for CI test

* fix: changed jar for testing

* fix: add gcs connector

* fix: change writing method to direct

* fix: delete gcs connector

* fix: specify java folder

* fix: change java_home location

* fix: change unzip instruction

* fix: delete mono_ranking_avg_bytes from testing env

* fix: delete frequency_table from testing env

* fix: delete GCS bucket part

* fix: as per Brad's review

* fix: lint

* fix: add version

* fix: change comment

* fix: add package due to switching the kernel

* fix: delete dataproc cluster command

* fix: change link

* fix: change link

* fix: revert cluster deletion command

* fix: change parenthesis to encoded character

* fix: change the name of the notebook

* fix: change timestamp to UUID

* fix: change the link and add description

* fix: change metadata
2022-08-08 16:23:16 -04:00
Krishna Chaitanya MovvaandGitHub f8203b9f46 UUID replaces Timestamp in the notebook template (#745)
* replaces timestamp with uuid #create *task #tag1 replace the TIMESTAMP with uuid in other official notebooks

* ran linter test

* updates the uuid code

* fixes the comment style highlighted through linter-test

* ran linter test

* adds length argument to uuid function defaulted to 8

* ran linter test
2022-08-08 11:20:33 -04:00
Andrew FerlitschandGitHub fac8c4c9b1 fix: improve batch description (#830)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region

* fix: set MODEL_DIR for HPT

* fix: set MODEL_DIR for HPT

* feat: add batch example

* feat: add batch example

* feat: add batch example

* feat: add batch example
2022-08-05 13:50:14 -07:00
Andrew FerlitschandGitHub d6c13c201e Ml ops v9v4 (#817)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region

* fix: set MODEL_DIR for HPT

* fix: set MODEL_DIR for HPT

* feat: add batch example

* feat: add batch example
2022-08-05 09:40:11 -07:00
Soheila ZangenehandGitHub 8db9ce0415 Move download link up (#813) 2022-08-04 15:05:18 -04:00
Ivan CheungandGitHub 8c7fb38136 Added missing dependency (#814) 2022-08-04 14:53:17 -04:00
Andrew FerlitschandGitHub acec861ad5 tune: notebook template (#812)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script

* tune: project ID and Region

* tune: project ID and Region
2022-08-04 10:51:08 -07:00
Andrew FerlitschandGitHub b5cc2b425e feat: auto review script tuning (#811)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review script
2022-08-04 09:30:13 -07:00
Soheila ZangenehandGitHub 710e6ea0d8 Run commands in quiet mode (#789)
* Run commands in quiet mode in both yaml files
* Test CI against single and multiple notebooks
2022-08-04 11:00:49 -04:00
4dce246b57 Add single notebook test file and remove broken notebook from the list (#801)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-08-04 10:39:09 -04:00
Andrew FerlitschandGitHub 696efb00ee fix: auto review (#807)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 21:19:10 -07:00
Andrew FerlitschandGitHub fea73bb9c0 obsolete 2022-08-03 20:28:16 -07:00
Andrew FerlitschandGitHub f50ea24dd1 fix: auto review (#806)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 20:27:45 -07:00
Andrew FerlitschandGitHub 473e673d0a fix: auto review (#805)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 17:22:25 -07:00
Andrew FerlitschandGitHub 127297ee4e tune: grammar 2022-08-03 15:38:44 -07:00
Chun-Hsiang WangandGitHub fb528b60c6 samples: Minor fix for CPR existing image use cases. (#778) 2022-08-03 15:23:35 -07:00
Andrew FerlitschandGitHub 1c1a2b2097 fix: auto review (#804)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review

* feat: auto review

* fix: auto review
2022-08-03 14:56:26 -07:00
Andrew FerlitschandGitHub 8cb2a26817 fix: auto review (#803)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* feat: auto review

* feat: auto review
2022-08-03 14:38:14 -07:00
Andrew FerlitschandGitHub 3bf098b361 feat: auto review (#802)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 14:19:49 -07:00
433cffbf76 Tabnet (#732)
* Start a new branch for TabNet tutorial.

* format lint

* Clean version Created using Colaboratory

* Remove unused import

* Remove unused import

* Created using Colaboratory

* add import

* Add visualization for TabNet

* add gcs

* run format

* reformat

* reformat

* Rmove the - file

* run linter

* run linter

* Update the objective and data section

* Update the link.

* Update data description.

* Update data description.

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:42:06 -07:00
0ec2f4fbe8 bugfix: pass Dataflow related parameters correct for AutoML Tabular pipeline notebook (#725)
Also corrected the required Roles for the service account.

Co-authored-by: Helin Wang <helin@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:39:32 -07:00
a9af97f1b9 Added notebook demonstrating Tensorboard Custom Training with custom container. (#611)
* Added notebook demonstrating Tensorboard Custom Training with custom container.

* Added notebook demonstrating Tensorboard Custom Training with custom container.

* update codeowners file

* call Vertex API instead of gapic API

* resolve comments for custom container

* resolve comments and format

* resolve comments

* using --quiet for delete doctor repository

* address more comments

Co-authored-by: gericdong <itseric@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:37:14 -07:00
d6431fab4c Added notebook demonstrating Tensorboard Custom Training with prebuilt container. (#603)
* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* small fix

* address comments

* format

* update project id to be [your-project-id], and populate tensorboard resource name automatically

* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* Added notebook demonstrating Tensorboard Custom Training with prebuilt container

* small fix

* address comments

* format

* fix typo for service account

* use vertex api instead of gapic api

* address comments

* minor fix

* minor fix for link

* minor fix

* resolve more comments

* a minor fix for comment

* format the notebook

* resolve comments

* address more comments

Co-authored-by: gericdong <itseric@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:35:41 -07:00
dcfde86928 Added colab , installation packages and few other changes to chicago_taxi_fare_prediction.ipynb file (#515)
* Added notebook

* Made changes in installing packages code cell

* Ran linter test

* fixes the installation issues and updates some textual content

* fixes the # formatting for comments

* ran linter test

* adds pyarrow to the packages

* ran linter test

* replaces timestamp with uuid

* ran linter test

* updates the uuid code

* fixes the comment style highlighted through linter-test

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: krishr2d2 <krishna.movva@springml.com>
2022-08-03 13:33:08 -07:00
5d747ffa0d Refresh of PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container (#509)
* notebook refresh from vertex ai sdk project

* linter test

* notebook refresh from vertex ai sdk project with trainer folder

* linter test

* add pyarrow

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:32:44 -07:00
53f25201cc Made minor changes to SDK_Custom_Training_Python_Package_Managed_Text_Dataset_Tensorflow_Serving_Container notebook (#507)
* modified notebook

* small changes done

* modified notebook and moved notebook to official folder

* ran linter test

* resolved comments

* ran linter test

* sentence case heading added for some more text

* ran linter test

* made changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:32:01 -07:00
9b17db3025 Refresh of PyTorch Image Classification Multi-Node Distributed Data Parallel Training on CPU using Vertex Training with Custom Container Notebook (#489)
* multi_node_ddp_gloo_vertex_training_with_custom_container refresh and related trainer folder

* linter test

* various fixes and colab update

* linter test

* modified notebook

* modified notebook

* ran linter test

* Update multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb

Co-authored-by: sudarshan-SpringML <sudarshan.c@springml.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 13:24:45 -07:00
423f7ac584 Adding PrivateEndpoint CUJ notebook to notebooks/community (#721)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console

* removing TODOs from Tabnet notebook

* adding notebook and editing CODEOWNERS file

* fixing links

* adding to community because of test issue

* removing CODEOWNERS

* reverting CODEOWNERS

* linting?

* adding fixes

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-08-03 12:54:46 -07:00
aec82c7e5b inardini -- bqml new operators release update to v1 (#717)
* update to v1

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 12:51:46 -07:00
b227509fbb chore(deps): update dependency black to v22.6.0 (#696)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-03 12:43:54 -07:00
Andrew FerlitschandGitHub e715e68273 fix: auto review (#800)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-03 12:39:06 -07:00
406de6fe9a Adds the updated sdk-feature-store-pandas notebook to official from community folder (#488)
* adds the updated sdk-feature-store-pandas notebook to official and removes it from the community

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: nayaknishant <nishantnayak@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-08-03 12:30:10 -07:00
Andrew FerlitschandGitHub eacc49d911 fix: auto review (#798)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auto review

* fix: auto review
2022-08-03 12:26:12 -07:00
Andrew FerlitschandGitHub b95959e7a1 cleanup 2022-08-03 10:58:57 -07:00
Andrew FerlitschandGitHub cc2cf876de fix: auto review (#797)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 10:58:27 -07:00
Andrew FerlitschandGitHub 1047237335 Ml ops v9v4 (#796)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 10:11:23 -07:00
Andrew FerlitschandGitHub 791d589d41 Ml ops v9v4 (#795)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 09:53:21 -07:00
Andrew FerlitschandGitHub f7bdf75d90 fix: auto-review (#794)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 09:37:14 -07:00
Andrew FerlitschandGitHub 785ca9f864 fix: auto review (#793)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review

* fix: auti review

* fix: auti review
2022-08-03 09:22:59 -07:00
Andrew FerlitschandGitHub aaa7d5c259 fix: auto review (#792)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auti review

* fix: auti review
2022-08-03 09:01:37 -07:00
Andrew FerlitschandGitHub e21cb948d6 feat: auto review (#784)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review

* fix: auto review

* fix: auto review
2022-08-02 18:46:08 -07:00
Andrew FerlitschandGitHub 5551c5f895 fix: auto review (#783)
* feat: tune template

* feat: tune template

* fix: auto review

* fix: auto review
2022-08-02 18:29:21 -07:00
Andrew FerlitschandGitHub e8853475bc feat: tune template (#782)
* feat: tune template

* feat: tune template
2022-08-02 17:33:32 -07:00
Andrew FerlitschandGitHub 33cb8139da Update get_started_vertex_training_lightgbm.ipynb 2022-08-02 16:33:03 -07:00
Andrew FerlitschandGitHub 0288fa3703 fix: link 2022-08-02 16:32:25 -07:00
Andrew FerlitschandGitHub d48edc2cb4 fix: links 2022-08-02 16:27:45 -07:00
Andrew FerlitschandGitHub 7b26f01671 fix: link 2022-08-02 16:25:45 -07:00
Andrew FerlitschandGitHub 59cd2cda3c fix: link 2022-08-02 16:23:46 -07:00
Andrew FerlitschandGitHub 3ac469f57c fix: link 2022-08-02 16:12:59 -07:00
Andrew FerlitschandGitHub 008833422c fix: link 2022-08-02 14:47:08 -07:00
Andrew FerlitschandGitHub 59c85c3085 fix: link 2022-08-02 14:44:57 -07:00
Andrew FerlitschandGitHub f2b5d0924e fix: link title 2022-08-02 14:35:38 -07:00
Andrew FerlitschandGitHub 772cd44cef fix: link 2022-08-02 14:28:58 -07:00
Andrew FerlitschandGitHub 379a4c6a1c fix: link 2022-08-02 14:27:16 -07:00
Andrew FerlitschandGitHub 5cea72848e fix: link 2022-08-02 14:25:47 -07:00
Andrew FerlitschandGitHub 9c12dd811b fix: links 2022-08-02 14:22:38 -07:00
Andrew FerlitschandGitHub 844cf5b047 fix: links 2022-08-02 14:19:52 -07:00
Andrew FerlitschandGitHub 1492051560 fix: link 2022-08-02 14:06:43 -07:00
Andrew FerlitschandGitHub 40bdd5fce3 fix: link 2022-08-02 14:03:36 -07:00
Andrew FerlitschandGitHub d1cc60e8d7 fix: link 2022-08-02 13:50:36 -07:00
Andrew FerlitschandGitHub 7ca4cf9912 fix: links 2022-08-02 13:34:59 -07:00
Andrew FerlitschandGitHub 294e40cb61 fix: link 2022-08-02 13:27:09 -07:00
Andrew FerlitschandGitHub f69e43d3d6 fix: link 2022-08-02 13:24:41 -07:00
Andrew FerlitschandGitHub 582c479dbe fix: link 2022-08-02 13:23:07 -07:00
Andrew FerlitschandGitHub f83660cf62 fix: link 2022-08-02 13:15:55 -07:00
Andrew FerlitschandGitHub e948fae793 fix: link 2022-08-02 13:13:57 -07:00
Andrew FerlitschandGitHub cd51333ff1 fix: link 2022-08-02 13:13:00 -07:00
Andrew FerlitschandGitHub cf5d266bd7 fix: link 2022-08-02 13:09:57 -07:00
Andrew FerlitschandGitHub 8ef840affb fix: link 2022-08-02 12:59:31 -07:00
Andrew FerlitschandGitHub 4dcc3d0183 fix: link 2022-08-02 12:31:11 -07:00
Andrew FerlitschandGitHub 0bcb6a8d8e fix: title 2022-08-02 12:24:32 -07:00
Andrew FerlitschandGitHub d26b385ec7 fix: title 2022-08-02 12:23:44 -07:00
Andrew FerlitschandGitHub d5a2766aa4 Update get_started_with_matching_engine.ipynb 2022-08-02 12:22:14 -07:00
Andrew FerlitschandGitHub 7abfbb5473 fix: title 2022-08-02 12:21:41 -07:00
Andrew FerlitschandGitHub 096423da33 fix: notice 2022-08-02 12:11:17 -07:00
Andrew FerlitschandGitHub 89a133549c fix: pinning (#779)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* fix: pinning

* fix: pinning
2022-08-01 19:56:29 -07:00
648f1c34e0 Add notebook to show how to deploy BQML models for online prediction via Vertex AI Model Registry (#736)
* adding new notebook on BQML online pred via Model Registry

* minor changes

* fixes to linting

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-08-01 08:42:51 -07:00
Andrew FerlitschandGitHub 3f21907c31 feat: autodiscover (#775)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover
2022-07-29 22:23:59 -07:00
Andrew FerlitschandGitHub fce66b3e57 fix: title (#774)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* fix: title

* fix: title
2022-07-29 22:19:45 -07:00
Andrew FerlitschandGitHub 3b140f9caa fix: title (#773)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 21:57:11 -07:00
Andrew FerlitschandGitHub 89325d7e52 feat: autodiscover (#772)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover
2022-07-29 19:58:21 -07:00
Andrew FerlitschandGitHub e4d44f02d6 feat: autodiscover (#771)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 19:54:08 -07:00
Andrew FerlitschandGitHub 78993c4729 fix: title (#770)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 16:28:15 -07:00
Andrew FerlitschandGitHub c29e7d86bd feat: autodiscover (#769)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title

* feat: autodiscover
2022-07-29 16:18:24 -07:00
Andrew FerlitschandGitHub a8793fb00a fix: title (#768)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover

* fix: title

* fix: title
2022-07-29 16:08:49 -07:00
Andrew FerlitschandGitHub bb60a7d0db Ml ops v9v3 (#767)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* feat: autodiscover

* feat: autodiscover
2022-07-29 15:08:27 -07:00
Andrew FerlitschandGitHub eef758c719 feat: autodiscover index (#766)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title
2022-07-29 15:06:34 -07:00
Andrew FerlitschandGitHub 486ef17ab8 fix: title (#765)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title

* fix: title
2022-07-29 14:57:39 -07:00
Andrew FerlitschandGitHub 90dfef3db6 fix: title (#764)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title
2022-07-29 14:35:34 -07:00
Andrew FerlitschandGitHub d59c87b387 fix: title (#763)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover

* fix: title

* fix: title
2022-07-29 13:27:46 -07:00
Andrew FerlitschandGitHub 9d69b77ac6 feat: autodiscover index (#762)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title

* feat: auto-discover
2022-07-29 13:04:48 -07:00
Andrew FerlitschandGitHub b0da5d69f8 update: tune title (#761)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release

* update: tune title

* update: tune title
2022-07-29 12:44:46 -07:00
Andrew FerlitschandGitHub 830e10e583 upgrade: updates for new release (#760)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template

* upgrade: updates for new release

* upgrade: updates for new release
2022-07-29 12:17:43 -07:00
kthytangandGitHub db904b424e chore: Update CPR notebooks. (#756)
* chore: Update CPR notebooks to pip install latest released Vertex SDK pypi package.

* Update CPR notebooks wording for experimental -> preview.

* Update Objectives wording

* Update github links to main branch.

* Update Sklearn interface.

* Fix formatting and typos.

* Update Predictor interface
2022-07-28 17:13:50 -07:00
Andrew FerlitschandGitHub c371f05bfa fix: split guidelines from template (#754)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template

* fix: split guidelines from template

* fix: split guidelines from template
2022-07-28 08:13:04 -07:00
Andrew FerlitschandGitHub 5f7de16e2d fix: split off authoring guidelines (#753)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF

* fix: split guidelines from template
2022-07-28 08:08:55 -07:00
Andrew FerlitschandGitHub 3908580ad6 feat: add notebook for non-TF HPT (#751)
* feat: import automl tabular model

* feat: import automl tabular model

* feat: HPT for non-TF

* feat: HPT for non-TF
2022-07-27 14:57:24 -07:00
Andrew FerlitschandGitHub 77d2cac20a Update README.md 2022-07-27 13:39:38 -07:00
Andrew FerlitschandGitHub a92d5ce473 Update README.md 2022-07-27 13:38:51 -07:00
Andrew FerlitschandGitHub 416ec74af3 add entry 2022-07-27 13:37:51 -07:00
Andrew FerlitschandGitHub 8443bbfe44 feat: notebook for importing automl tabular model (#750)
* feat: import automl tabular model

* feat: import automl tabular model
2022-07-27 13:35:04 -07:00
kthytangandGitHub 23a599068a Update CPR notebooks. (#741)
* Update CPR notebooks.

- Update interfaces
- Fix missing timestamp
- Rename some variables

* Update cpr preprocess notebook.

- Change preprocessor import path.

* Update SDK_Custom_Predict_SDK_Integration.ipynb

* Update SDK_Custom_Predict_and_Handler_SDK_Integration.ipynb

* Update SDK_Pytorch_Custom_Predict.ipynb

* Update SDK_Triton_PyTorch_Local_Prediction.ipynb

* Fix lint and revert path change for pickle dumping preprocessor.
2022-07-27 10:58:28 -07:00
gericdongandGitHub c63bb4c464 New notebook to demonstrate how to enable TensorBoard Profiler (#719)
* New notebook to demonstrate how to enable TensorBoard Profiler

* Reformatted with Lint

* Changed service account handling and added a step to monitor job state

* Addressed review comments

* Addressed technical writerreview comments

* Addressed Ivan review comments

* Switched from GAPIC to Vertex SDK

* Removed an unused package

* Addressed review comments
2022-07-26 14:39:37 -04:00
Ivan CheungandGitHub 2226e915c0 Update CODEOWNERS 2022-07-25 16:24:10 -04:00
Ivan CheungandGitHub cd9f8b1d89 Update CODEOWNERS 2022-07-25 15:01:46 -04:00
Ivan CheungandGitHub aae9ad0422 Update CODEOWNERS 2022-07-25 15:00:33 -04:00
Ivan CheungandGitHub 89d50579a6 Add @GoogleCloudPlatform/caiis-tw to CODEOWNERS
Add @GoogleCloudPlatform/caiis-tw to default.
2022-07-25 15:00:01 -04:00
Ivan CheungandGitHub 2d6afa8313 Added better download instructions (#738)
* Improve download instruc
tions

* Added web download to notebook results list
2022-07-22 18:21:05 -04:00
Ivan CheungandGitHub 00cfb20c36 Notebook CI: Fixed variable replacement to handle numbers (#739)
* Removed replacement of variable comparisons

* Fixed issue with numbers in replacement content
2022-07-22 11:50:39 -04:00
Ivan CheungandGitHub 14c87ae702 Removed replacement of variable comparisons (#737) 2022-07-21 19:21:02 -04:00
e2a6610c2d Add an example use case for custom prediction routines. (#709)
* Add an example use case for custom prediction routines.

* Addressing some PR comments: reworded the readme in a few places, added a 'probe' command to build.py that sends a sample predict request, and pinned versions in requirements. Also fixed a bug where the artifacts_uri passed in during deployment on Vertex AI was not recognized as a directory.

* Autoformat code with black and fix a couple of typing errors.

* Addressing PR comments: Add deployment machine type to the config and add docstring to probe_prediction method.

* Update example to work with new LocalModel interface.

* Update example to work with new LocalModel interface.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-07-21 12:42:31 -07:00
Ivan CheungandGitHub 145cdd0928 Added a service account injection (#695)
* Added a service account injection

* Revert this

* Added service account injection

* Fixed cloud build file

* Added gcloud version debug info

* Fixed sa injection

* Removed test file

* Revert CODEOWNERS
2022-07-21 15:04:10 -04:00
Michael HuandGitHub 04e1697bca fix workbench link in new tables notebooks (#714) 2022-07-21 09:29:06 -04:00
Ivan CheungandGitHub be785d0389 Allow outputs (#733) 2022-07-20 17:31:12 -04:00
MarcandGitHub 976e346a3d rm open in cloud notebook until tested there, also fix open links to use community for now (#731) 2022-07-20 21:48:07 +01:00
e37caca496 chore(deps): update dependency nbqa to v1.4.0 (#727)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-07-19 13:06:00 -05:00
MarcandGitHub 7a48fe8850 add community notebook (#729) 2022-07-19 07:52:03 +01:00
Ivan NardiniandGitHub 915a1edba8 inardini - vertex explainable ai example based api example using sdk gapic (#716)
* new notebook

* linter test passed.

* add codeowners

* review

* reviews

* linter test passed.

* last review. linter test passed
2022-07-16 19:12:46 -04:00
MarcandGitHub 424f947b04 avoid linter reformatting that breaks this notebook in colab (#715)
* fix formatting for colab

* disable black formatting selectively
2022-07-12 16:23:29 -07:00
Andrew FerlitschandGitHub c95f73c1a8 fix: bad link (#712)
* feat: notebook on model registry

* feat: notebook on model registry

* feat: workflow notebook

* feat: workflow notebook

* feat: workflow notebook

* fix: objective

* fix: objective

* fix: link

* fix: link
2022-07-07 12:51:14 -07:00
Andrew FerlitschandGitHub 9da033c887 Update README.md 2022-07-06 14:40:51 -07:00
Andrew FerlitschandGitHub f61f9bfdc2 feat: notebook for automl tabular workflow (#710)
* feat: notebook on model registry

* feat: notebook on model registry

* feat: workflow notebook

* feat: workflow notebook

* feat: workflow notebook
2022-07-06 14:26:45 -07:00
b2a17dfc83 inardini - New 20+ Pipeline Operators for BQML notebook (#706)
* google_cloud_pipeline_components_bqml_pipeline_demand_forecasting notebook

* linter test to check with andy

* google_cloud_pipeline_components_bqml_pipeline_demand_forecasting notebook

* linter test to check with andy

* merge

* linter test minor fails. check with andy

* add code owner

* minor changes

* remove components

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-07-06 08:38:28 -07:00
sasha-gitgandGitHub 7072219d8b Update build_model_experimentation_lineage_with_prebuild_code.ipynb (#703)
Switch to install from Pypi
2022-07-01 14:40:52 -07:00
Andrew FerlitschandGitHub 57db2f4014 Update README.md 2022-07-01 11:45:37 -07:00
Andrew FerlitschandGitHub 4604b0a0a9 Update README.md 2022-07-01 11:44:38 -07:00
Andrew FerlitschandGitHub c8c26a12ba fix: finish objective cell (#708)
* feat: notebook on model registry

* feat: notebook on model registry
2022-07-01 11:40:28 -07:00
Andrew FerlitschandGitHub 3a8fa3e312 feat: notebook for model registry (#707)
* update: refine experiment notebook

* update: refine experiment notebook

* update: new feature release

* update: new feature release

* update: new feature release

* update: new feature release

* feat: notebook on model registry

* feat: notebook on model registry
2022-07-01 11:25:20 -07:00
bbfba5aaaf add initial automl tables on vertex pipelines notebook (#694)
* add initial automl tables on vertex pipelines notebook

* apply template

* update bucket variable name

* reviewer requested changes

* update notebook with the updated API

* fix typo

* add stage_1_tuning_result_artifact_uri to skip architecture search pipeline

* update parameter for skip architecture search pipeline

* default evaluation to True; update data splits

* update dataset to gs://cloud-samples-data/vertex-ai/tabular-workflows/datasets/safe-driver/train.csv

Co-authored-by: Helin Wang <helin@google.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-07-01 09:54:39 -07:00
Andrew FerlitschandGitHub e30b2182b0 Update get_started_with_vertex_endpoints.ipynb 2022-06-30 20:35:07 -07:00
4c4dade55a samples: Add Prediction CPR preprocess sample. (#662)
* samples: Add Prediction CPR preprocess sample.

* chore: Refined wording and used notebook template for CPR preprocessing
sample.

* samples: Fixed comments for CPR Preprocess sample.

* samples: Fixed wording.

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-30 20:14:35 -07:00
5690d50430 samples: Add Prediction CPR Triton sample. (#661)
* samples: Add Prediction CPR Triton sample.

* chore: Refined wording and used notebook template for CPR Triton sample.

* samples: Fixed comments for CPR Triton samples.

* samples: Fixed wording.

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-30 20:13:00 -07:00
Chun-Hsiang WangandGitHub 10c33f934f samples: Add Prediction CPR SDK sample. (#660)
* samples: Add Prediction CPR SDK sample.

* chore: Refined wording and used notebook template for CPR SDK sample.

* samples: Fixed comments for CPR SDK sample.

* samples: Fixed wording.
2022-06-30 20:07:29 -07:00
Andrew FerlitschandGitHub 0c43cbd563 update: remove install from git branch 2022-06-30 16:24:20 -07:00
Andrew FerlitschandGitHub b640a8f545 update: new feature release (#702)
* update: refine experiment notebook

* update: refine experiment notebook

* update: new feature release

* update: new feature release

* update: new feature release

* update: new feature release
2022-06-30 11:57:50 -07:00
Ivan CheungandGitHub a575528b11 Tweaks to matching engine notebook (#701)
* Tweaks to notebook

* Ran linter

* More tweaks
2022-06-30 11:59:05 -04:00
Andrew FerlitschandGitHub 42a2c4d082 fix: doc link 2022-06-30 08:36:57 -07:00
Andrew FerlitschandGitHub 0bcf44e9fa Update get_started_bqml_training.ipynb 2022-06-30 08:33:06 -07:00
Andrew FerlitschandGitHub 9ac2774ece Update README.md 2022-06-29 21:25:19 -07:00
Andrew FerlitschandGitHub 975c9fe6bc update: refine experiments notebook (#699)
* update: refine experiment notebook

* update: refine experiment notebook
2022-06-29 21:14:11 -07:00
Andrew FerlitschandGitHub 417410f382 Fix: remove hardwired project number (#698)
* fix: remove hardwired project number

* fix: remove hardwired project number
2022-06-29 14:42:51 -07:00
Andrew FerlitschandGitHub 8fdfbe4e31 fix: link 2022-06-29 14:20:04 -07:00
Andrew FerlitschandGitHub 80f977546c fix: title 2022-06-29 09:54:29 -07:00
Ivan NardiniandGitHub c5fe281e32 inardini - experiments cuj2 notebook release (#637)
* experiments cuj2 notebook release

* add andy reviews

* linter test passed

* align notebooks

* linter test passed

* minor changes

* karl bug review fix

* linter test passed

* add -q to install

* linter test passed

* debug

* linter test passed

* PR build fix

* linter test passed. delete debug notebook

* import import tempfile

* linter test passed

* remove pandas install

* linter test passed

* add sklearn

* linter test passed

* test pandas dep

* linter test passed

* minor changes

* linter test passed

* ivan fix
2022-06-29 12:38:16 -04:00
49a2ddaf08 fix: removing TODOs from TabNet notebook (#652)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console

* removing TODOs from Tabnet notebook

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-28 07:26:01 -07:00
e9cba94bb4 inardini - experiments cuj3 notebook release (#638)
* experiments cuj3 notebook release

* add andy reviews

* linter test passed

* align notebooks

* linter test passed

* align notebooks

* linter test passed

* update CODEOWNERS

* sasha bug review fix

* linter test passed

* minor changes

* add -q to install

* linter test passed

* ivan dep fix

* linter test passed

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-06-27 19:15:13 -04:00
fc83cfcea5 samples: Add Prediction CPR PyTorch sample. (#659)
* samples: Add Prediction CPR PyTorch sample.

* chore: Refined wording and used notebook template for PyTorch sample.

* added missing bucket cleanup

Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-27 12:23:31 -07:00
e3aa9e8f35 samples: Add Prediction CPR handler sample. (#658)
* samples: Add Prediction CPR handler sample.

* chore: Refined wording and used notebook template.

* added missing bucket cleanup sequence

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-27 12:09:20 -07:00
Ivan CheungandGitHub 37c52abc11 Added a virtualenv to the notebook execution tests which should help with dependency issues (#693)
* Added a virtualenv

* Added a virtualenv for the single yaml

* Debug

* Fixed diff logic for all notebooks case

* Added missing -c
2022-06-26 13:31:52 -04:00
Ivan CheungandGitHub c8320c8764 Revert "Add notebook for co-hosting model (#666)" (#692)
This reverts commit aa5464151d.
2022-06-24 18:26:28 -04:00
b5d51e61b6 inardini - experiments cuj1 notebook release (#636)
* experiments cuj1 notebook release

* add andy reviews

* linter test passed

* align notebooks

* linter test passed

* minor changes

* linter test passed

* minor changes

* linter test passed

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-06-24 15:35:32 -04:00
Ziye XingandGitHub aa5464151d Add notebook for co-hosting model (#666)
* Add notebook for co-hosting model

* Add co-hosting model notebook codeowner
2022-06-24 10:36:26 -07:00
Andrew FerlitschandGitHub 386cecf4c2 upgrade: current notebook standard (#677)
* upgrade: notebook standard

* upgrade: notebook standard

* Update custom_model_training_and_batch_prediction.ipynb
2022-06-24 09:59:49 -07:00
dffdb15c17 Add default kernel_name for notebook execution (#497)
Currently, there is no kernel_name. Hence, the execution test cannot run for notebooks that don't have kernels defined in their .ipynb file.

Side-note: We should use lint to remove the kernel_name from .ipynb as well, as it could include info specific to the author's environment.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-23 19:18:49 -04:00
Andrew FerlitschandGitHub 2f3691eb71 fix: workbench link 2022-06-23 13:55:29 -07:00
Andrew FerlitschandGitHub f456d86555 fix: open in workbench link 2022-06-23 13:52:39 -07:00
Andrew FerlitschandGitHub f534b4e7a5 upgrade: fine tune notebook standard 2022-06-23 13:28:00 -07:00
Andrew FerlitschandGitHub de247cd78b upgrade: current notebook standards (#681)
* upgrade: notebook standard

* upgrade: notebook standard

* fix: formatting
2022-06-23 12:03:55 -07:00
Andrew FerlitschandGitHub 22ad74eb8d Update README.md 2022-06-23 10:06:28 -07:00
Andrew FerlitschandGitHub baf69999fc update: fine-tuning notebook (#689)
* update: touchups

* update: touchups
2022-06-23 10:02:02 -07:00
Mohammad Al-AnsariandGitHub d5057da9bb Added new notebook that creates Vertex AI AutoML text entity extraction dataset from PDFs using Vision API (#683)
* Added new Stage 1 notebook to create unlabelled
Vertex AI AutoML text entity extraction dataset
from collection of PDF files on Google Cloud Storage

* Linted notebook

* Removed TODOs

* Updates per PR comments

* Revered to multiple imports per line
2022-06-23 08:38:14 -07:00
24904a5999 feat: adding code owners and updating graph_paysim (#645)
* adding code owners and updating graph_paysim

* formatted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-06-22 21:31:55 -05:00
Ivan CheungandGitHub 881a2b45c5 Improved git diff logic (#687) 2022-06-22 21:49:09 -04:00
Andrew FerlitschandGitHub 41fc83ad03 upgrade: current notebook standards (#655)
* update: current standards

* update: current standards

* Update sdk_custom_image_classification_batch_explain.ipynb

* fix: bucket nit
2022-06-22 16:59:39 -07:00
Andrew FerlitschandGitHub 9928276dc3 upgrade: current notebook standard (#653)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update sdk_automl_tabular_binary_classification_batch_explain.ipynb

* fix: bucket nit
2022-06-22 16:58:42 -07:00
Andrew FerlitschandGitHub 6607f93f5e upgrade: updated curated notebook to current standards (#648)
* upgrade: current standards

* upgrade: current standards

* fix: missed nits

* fix: missed nits

* Update automl-text-classification.ipynb

* Update automl-text-classification.ipynb

* rm extra comma
2022-06-22 16:56:38 -07:00
Andrew FerlitschandGitHub dcc0cfe06e upgrade: current notebook standards (#686)
* upgrade: notebook standard

* upgrade: notebook standard
2022-06-22 16:50:13 -07:00
Andrew FerlitschandGitHub 00d5c5c4bf Update README.md 2022-06-22 15:34:01 -07:00
Andrew FerlitschandGitHub f8152dde19 Update README.md 2022-06-22 15:24:14 -07:00
Andrew FerlitschandGitHub 0586e04c21 upgrade: current notebook standards (#656)
* update: current standards

* update: current standards

* fix: bucket nit
2022-06-22 15:06:01 -07:00
Andrew FerlitschandGitHub 3de18a7fab upgrade: current notebook standards (#674)
* upgrade: current notebook standard

* upgrade: current notebook standard

* fix: bucket

* fix: bucket
2022-06-22 15:03:54 -07:00
Andrew FerlitschandGitHub dc0bf24cc5 Update README.md 2022-06-22 14:58:28 -07:00
Andrew FerlitschandGitHub 8ce4c3070c Update README.md 2022-06-22 14:53:54 -07:00
Andrew FerlitschandGitHub 13c3acb976 Update README.md 2022-06-22 14:50:45 -07:00
Andrew FerlitschandGitHub c1150ff584 Update README.md 2022-06-22 14:39:06 -07:00
Andrew FerlitschandGitHub 4f11d70f7e Update README.md 2022-06-22 14:34:02 -07:00
Andrew FerlitschandGitHub 2bf9a2b317 Update README.md 2022-06-22 14:24:53 -07:00
Andrew FerlitschandGitHub b1e0ad0c4f Update README.md 2022-06-22 14:15:22 -07:00
Andrew FerlitschandGitHub 5624f92f02 Update README.md 2022-06-22 14:12:18 -07:00
Andrew FerlitschandGitHub 1335032954 Update README.md 2022-06-22 14:05:24 -07:00
Andrew FerlitschandGitHub 0b13c66e07 Update README.md 2022-06-22 14:01:55 -07:00
Andrew FerlitschandGitHub ef25b54926 update: add index (#684) 2022-06-22 13:58:06 -07:00
Andrew FerlitschandGitHub 064dbfeefa fix: bucket nit 2022-06-22 12:34:50 -07:00
Andrew FerlitschandGitHub 044c69e7a5 upgrade: current notebook standards (#654)
* update: current standards

* update: current standards
2022-06-22 12:33:26 -07:00
Andrew FerlitschandGitHub 32a46e7471 upgrade: current standards (#649)
* upgrade: current standards

* upgrade: current standards

* fix: missed nits

* fix: missed nits
2022-06-22 12:30:16 -07:00
Andrew FerlitschandGitHub b52d59822d upgrade: current notebook standards (#657)
* update: current standards

* update: current standards

* update: current standards

* update: current standards

* Update sdk_custom_tabular_regression_batch_explain.ipynb

* fix: indent issue

* fix: indent issue

* fix: bucket

* fix: bucket

* fix: image

* fix: image

* fix: cleanup

* fix: cleanup

* fix: cleanup
2022-06-22 11:47:17 -07:00
Andrew FerlitschandGitHub 529995ecde upgrade: current notebook standard (#671)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update google_cloud_pipeline_components_automl_tabular.ipynb

* fix: bucket

* fix: bucket
2022-06-22 11:35:38 -07:00
Andrew FerlitschandGitHub 0726328c92 upgrade: current notebook standard (#667)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update model_monitoring.ipynb

* Update model_monitoring.ipynb
2022-06-22 11:21:32 -07:00
Andrew FerlitschandGitHub 090e83c286 fix: more broken links 2022-06-22 11:19:17 -07:00
Andrew FerlitschandGitHub c3802626b9 fix: links issue 672 2022-06-22 11:18:08 -07:00
Andrew FerlitschandGitHub 9570c2477f upgrade: current notebook standards (#682)
* upgrade: current notebook standards

* upgrade: current notebook standards
2022-06-22 11:09:27 -07:00
Andrew FerlitschandGitHub 2b1a898b2a upgrade: current notebook standards (#680)
* upgrade: current notebook standards

* upgrade: current notebook standards
2022-06-22 11:09:04 -07:00
Andrew FerlitschandGitHub f2a42aa66e upgrade: current notebook standard (#679)
* upgrade: notebook standard

* upgrade: notebook standard

* fix: bucket

* fix: bucket
2022-06-22 11:08:37 -07:00
Andrew FerlitschandGitHub 30a03f1fd1 upgrade: current notebook standards (#678)
* upgrade: notebook standard

* upgrade: notebook standard

* Update google_cloud_pipeline_components_model_train_upload_deploy.ipynb

* fix: bucket nits

* fix: bucket
2022-06-22 11:08:08 -07:00
Andrew FerlitschandGitHub ca25448f59 upgrade: current notebook standard (#673)
* upgrade: current notebook standard

* upgrade: current notebook standard

* fix: bucket nit

* fix: bucket nit
2022-06-22 11:07:37 -07:00
Andrew FerlitschandGitHub 8f922710b0 upgrade: current notebook standard (#670)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update google_cloud_pipeline_components_automl_images.ipynb

* fix: bucket

* fix: bucket
2022-06-22 11:06:31 -07:00
Andrew FerlitschandGitHub 9509c6ab9d upgrade: current notebook standard (#669)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update lightweight_functions_component_io_kfp.ipynb

* fix: nits

* fix: nits

* fix: nits

* fix: nits
2022-06-22 11:05:47 -07:00
Andrew FerlitschandGitHub ccba176979 upgrade: current notebook standard (#665)
* upgrade: notebook standard

* upgrade: notebook standard

* Update sdk-feature-store.ipynb

* Update sdk-feature-store.ipynb

* Update sdk-feature-store.ipynb

* fix: aip reference

* fix: nits

* fix: nits
2022-06-22 11:05:07 -07:00
Andrew FerlitschandGitHub 1b8f383897 upgrade: current notebook standard (#663)
* update: current standards

* update: current standards

* fix: bucket

* fix: bucket
2022-06-22 09:36:49 -07:00
Andrew FerlitschandGitHub e5cd9e86d2 upgrade: notebook to latest standard (#651)
* fix: missed nits

* fix: missed nits
2022-06-22 08:56:10 -07:00
Andrew FerlitschandGitHub a7e86a4f26 upgrade: current notebook standard (#668)
* upgrade: current notebook standard

* upgrade: current notebook standard

* Update sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
2022-06-21 20:23:18 -07:00
Ivan CheungandGitHub 8f0c73b32c Fixed cleanup scripts (#676) 2022-06-21 20:13:37 -07:00
Andrew FerlitschandGitHub c7d7b48a91 upgrade: notebook to current standards (#650)
* upgrade: current standards

* upgrade: current standards
2022-06-21 18:25:25 -07:00
Karl WeinmeisterandGitHub 583eb90f07 fix: CONTRIBUTING.md did not have nbfmt as final step 2022-06-20 13:56:49 -05:00
c3a9249c0c Workaround tensorboard/GCS issue for Cloud Shell (#386)
* Workaround tensorboard/GCS issue for Cloud Shell

Without `--load_fast=false` there will be `401 Unauthorized` for GCS log loads. 
See https://github.com/tensorflow/tensorboard/issues/4784#issuecomment-868945650

* PR #386: Fix missing import

`import json` was missing.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-19 10:07:09 -05:00
Karl WeinmeisterandGitHub 81b70e779c ci: Remove protobuf from requirements.txt 2022-06-19 09:38:45 -05:00
Karl WeinmeisterandGitHub 085713a818 ci: Add protobuf to requirements.txt 2022-06-18 17:20:45 -05:00
Karl WeinmeisterandGitHub 5af7c851dc Fix: update typo in GAPIC Feature Store notebook 2022-06-18 17:10:49 -05:00
691312d467 Add import feature analysis config sample code into gapic-feature-sto… (#548)
* Add import feature analysis config sample code into gapic-feature-store.ipynb

* Fixing linter for gapic-feature-store.ipynb

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 17:09:37 -05:00
650c256c13 Fixes link to colab (#627)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:26:36 -05:00
9b00c4380b chore(deps): update actions/setup-python action to v4 (#622)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:21:49 -05:00
Karl WeinmeisterandGitHub 4851457e93 ci: Add Python version to support setup-python v4 2022-06-18 16:19:09 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
1c54878fab build(deps): bump tensorflow (#595)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 16:08:07 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
c139b84454 build(deps): bump tensorflow (#593)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-06-18 16:02:53 -05:00
15c38b4ca6 chore(deps): update dependency pyupgrade to v2.34.0 (#457)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-06-18 15:59:54 -05:00
Ivan CheungandGitHub 271c949a71 Update README.md (#642) 2022-06-17 14:59:05 -07:00
Andrew FerlitschandGitHub 09b5401434 update: fine-tuning notebook (#641)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms

* review: updates from review

* review: updates from review

* updates: fine tuning
2022-06-17 13:41:10 -07:00
dad76547f0 inardini - mobile gaming feature store blog review (#635)
* review content and image

* linter test passed

* andy review fixes

* linter test passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-17 10:39:18 -07:00
Andrew FerlitschandGitHub c14a110c81 Update get_started_with_custom_training_pipeline_components.ipynb 2022-06-16 14:24:08 -07:00
Andrew FerlitschandGitHub d1e16546cc Update get_started_with_bqml_pipeline_components.ipynb 2022-06-16 14:23:29 -07:00
Andrew FerlitschandGitHub f91bc3d0c9 Update get_started_with_bq_tfdv_pipeline_components.ipynb 2022-06-16 14:22:56 -07:00
Andrew FerlitschandGitHub 5168808b6c fix: colab link 2022-06-16 14:22:23 -07:00
Andrew FerlitschandGitHub 501cca7b5e fix: colab link 2022-06-16 14:21:31 -07:00
Andrew FerlitschandGitHub f19d40d858 Update mlops_experimentation.ipynb 2022-06-16 13:49:17 -07:00
Andrew FerlitschandGitHub 5a721ce01d Update get_started_with_visionapi_and_automl.ipynb 2022-06-16 13:48:31 -07:00
Andrew FerlitschandGitHub 66421fb4d8 fix: colab link 2022-06-16 13:47:47 -07:00
Andrew FerlitschandGitHub 3658ee8c88 Update get_started_with_tabnet.ipynb 2022-06-16 13:46:10 -07:00
Andrew FerlitschandGitHub afaab4bb02 Update get_started_with_cmek_training.ipynb 2022-06-16 13:45:08 -07:00
Andrew FerlitschandGitHub c1e004bdff fix: colab link 2022-06-16 13:44:22 -07:00
Andrew FerlitschandGitHub 874e5a3ef5 Update get_started_vertex_training_xgboost.ipynb 2022-06-16 13:43:11 -07:00
Andrew FerlitschandGitHub 51529f370c fix: broken table 2022-06-16 13:41:01 -07:00
Andrew FerlitschandGitHub 5ddf98866c Update get_started_vertex_training_sklearn.ipynb 2022-06-16 13:40:22 -07:00
Andrew FerlitschandGitHub fbb6830876 fix: colab link 2022-06-16 13:30:01 -07:00
Andrew FerlitschandGitHub ee1bb281da fix: colab link 2022-06-16 13:28:16 -07:00
Andrew FerlitschandGitHub da2f7e88fe fix: update location of public dataset bucket 2022-06-16 12:43:15 -07:00
Andrew FerlitschandGitHub 3fb28e353f fix: remove internal link 2022-06-16 12:40:02 -07:00
Andrew FerlitschandGitHub c8e7f44f0a fix: updates from review (#640)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms

* review: updates from review

* review: updates from review
2022-06-16 12:36:28 -07:00
3d9049aeeb remove old hard-coded instances for prediction (#633)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-16 11:50:01 -07:00
Andrew FerlitschandGitHub 7b8726af24 fix: perms for using MR in BQML (#634)
* feat: add example of import from dataframe

* feat: add example of import from dataframe

* update: change in required perms

* update: change in required perms
2022-06-15 14:55:17 -07:00
Andrew FerlitschandGitHub 0443b05360 feat: add create tabular dataset from dataframe example (#632)
* feat: add example of import from dataframe

* feat: add example of import from dataframe
2022-06-14 11:44:30 -07:00
Ivan CheungandGitHub e422dbdef2 Added official version of tabular regression batch bq (#331)
* Added official version of tabular regression batch bq

* Ran linter

* Fixed cleanup

* Additional cleanup

* Added working version

* Refactored and made work

* Ran linter and cleaned up

* Renamed aip to aiplatform

* Replaced online with batch

* Renamed notebook

* Ran linter and cleaned up

* Fixed bug

* Fixed SQL by adding backticks

* Install google-cloud-bigquery[all]

* Refactored datasets

* Ran linter

* Removed GCS cells

* Fixed import file

* Fixed SQL issues and added cleanup of training dataset

* Fixed hardcorded table

* Fixed brand names

* Fixed header

* Fixed results table

* Addressed tech writing review comments

* Ran linter
2022-06-14 14:14:06 -04:00
Andrew FerlitschandGitHub ec5fc0b1c8 Update get_started_vertex_training_r.ipynb 2022-06-14 10:05:36 -07:00
Andrew FerlitschandGitHub c52e3f20ba Update get_started_vertex_training_pytorch.ipynb 2022-06-14 10:04:45 -07:00
Andrew FerlitschandGitHub e367dceceb Update get_started_vertex_training_lightgbm.ipynb 2022-06-14 10:04:11 -07:00
Andrew FerlitschandGitHub 19b8666808 Update get_started_vertex_training.ipynb 2022-06-14 10:03:24 -07:00
Andrew FerlitschandGitHub a2df0e9fca Update get_started_vertex_tensorboard.ipynb 2022-06-14 10:01:52 -07:00
Andrew FerlitschandGitHub 73b094550e Update get_started_vertex_feature_store.ipynb 2022-06-14 09:59:24 -07:00
Andrew FerlitschandGitHub d05ae109e1 Update get_started_vertex_experiments.ipynb 2022-06-14 09:57:55 -07:00
Andrew FerlitschandGitHub fdb25791d5 Update get_started_vertex_distributed_training.ipynb 2022-06-14 09:57:19 -07:00
Andrew FerlitschandGitHub 5a88492498 Update get_started_bqml_training.ipynb 2022-06-14 09:56:34 -07:00
Andrew FerlitschandGitHub f19a12b829 Update get_started_automl_training.ipynb 2022-06-14 09:55:53 -07:00
Andrew FerlitschandGitHub 3ed0ea73f4 Update get_started_bq_datasets.ipynb 2022-06-14 09:08:47 -07:00
Andrew FerlitschandGitHub b98fd24a72 Update get_started_bq_datasets.ipynb 2022-06-13 21:29:41 -07:00
Andrew FerlitschandGitHub eb4e9a0f91 Update get_started_vertex_datasets.ipynb 2022-06-13 21:27:16 -07:00
Andrew FerlitschandGitHub ec7c136b0a Update get_started_vertex_datasets.ipynb 2022-06-13 21:26:24 -07:00
Andrew FerlitschandGitHub ee7e43cc1a Update mlops_data_management.ipynb 2022-06-13 20:24:57 -07:00
Andrew FerlitschandGitHub ea9f5f3c5c Update get_started_with_data_labeling.ipynb 2022-06-13 20:24:22 -07:00
Andrew FerlitschandGitHub bd44798412 Update get_started_vertex_datasets.ipynb 2022-06-13 20:23:37 -07:00
Andrew FerlitschandGitHub 2af0cc0f80 fix: test for local execution 2022-06-13 20:22:57 -07:00
Andrew FerlitschandGitHub 5c0fa14d2d Update get_started_bq_datasets.ipynb 2022-06-13 20:21:44 -07:00
Andrew FerlitschandGitHub 7cc50d3203 Update README.md 2022-06-13 13:58:20 -07:00
Andrew FerlitschandGitHub 9c7da13177 Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:39:33 -07:00
Andrew FerlitschandGitHub 45e0645f0b Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:38:55 -07:00
Andrew FerlitschandGitHub cb884cc74a Update gapic-vizier-multi-objective-optimization.ipynb 2022-06-13 08:38:22 -07:00
Ivan CheungandGitHub d3a6475580 Fixed mistake in batch prediction request section (#617)
* Fixed mistake in batch prediction request section

* Fixed linter requirements
2022-06-10 17:13:45 -04:00
4e7061b2db added MLPerf benchmark reference and updated Criteo sample to use GRPC for stock containers (#630)
* added MLPerf benchmark reference and updated Criteo sample to use GRPC for stock containers

* addressed feedback for BERT sample and did similar changes to Criteo sample

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-10 12:06:25 -07:00
Ivan CheungandGitHub 0250879f65 Added notebook substitution for common case of 1 notebook (#625) 2022-06-10 14:44:43 -04:00
Andrew FerlitschandGitHub 5cee23ae68 Update get_started_with_autoscaling.ipynb 2022-06-09 15:02:28 -07:00
Andrew FerlitschandGitHub d518558b3d Update README.md 2022-06-09 15:01:55 -07:00
Andrew FerlitschandGitHub 5c085c843f feat: notebook on autoscaling (#629)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook

* feat: airflow+vertex

* feat: airflow+vertex

* feat: notebook on autoscaling

* feat: notebook on autoscaling
2022-06-09 14:57:41 -07:00
Michael HuandGitHub 936b434ac4 fix: typo in links in bqml arima notebook (#616)
Notebook used as template had incorrect link format. Apply the same fixes as #514 to the arima notebook.
2022-06-09 17:52:12 -04:00
Michael HuandGitHub 43059c9fd9 fix: pin protobuf version to 3.19.0 (#621) 2022-06-09 12:49:45 -07:00
Andrew FerlitschandGitHub 19f72d426d fix: typos 2022-06-08 11:59:37 -07:00
Andrew FerlitschandGitHub 14ecaf3023 Update README.md 2022-06-08 11:58:18 -07:00
Andrew FerlitschandGitHub 80c93a9b6d feat: airflow with vertex pipelines (#624)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook

* feat: airflow+vertex

* feat: airflow+vertex
2022-06-08 11:55:11 -07:00
Andrew FerlitschandGitHub 06a1b4dc57 Update README.md 2022-06-07 09:48:16 -07:00
Andrew FerlitschandGitHub 4e779eedf1 Update README.md 2022-06-07 09:45:10 -07:00
Andrew FerlitschandGitHub afb341f5fd feat: new R notebook (#618)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting

* feat: new R notebook

* feat: new R notebook
2022-06-07 09:39:44 -07:00
e34b0fa115 chore(deps): pin dependency protobuf to v (#606)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:13:56 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
6fa0345f25 build(deps): bump tensorflow (#596)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-06-06 18:09:52 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Andrew Ferlitsch
dd43ae6639 build(deps): bump tensorflow (#594)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:08:37 -07:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Ivan CheungAndrew Ferlitsch
840385e0a7 build(deps): bump tensorflow (#592)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.3 to 2.7.2.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.3...v2.7.2)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-06 18:07:48 -07:00
Michael HuandGitHub 9daaf51a1f add bqml arima and vertex forecasting comparison notebook (#581)
Adds a notebook that demonstrates how to compare a Vertex Forecasting model against a BQML ARIMA+ model trained using a first-party GCPC pipeline.
2022-06-06 20:48:30 -04:00
Andrew FerlitschandGitHub 9b2511e54e Update README.md 2022-06-06 13:38:55 -07:00
Andrew FerlitschandGitHub b6674e6540 feat: notebook for co-hosting models (#615)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD

* co-hosting

* co-hosting
2022-06-06 13:35:47 -07:00
Ivan CheungandGitHub a109cb6d44 fix: Added explanations output to forecasting notebook (#613)
* Added explanations output to forecasting notebook

* Simplified and added XAI

* Fix conflicts

* Ran linter

* Fixed batch prediction request explanation
2022-06-06 10:00:07 -07:00
Ivan CheungandGitHub f730d6b9de Added ability to test a single notebook (#608)
* Added ability to test a single notebook

* Added output_url to table

* Removed ML Ops notebooks
2022-06-06 10:30:31 -04:00
0947f2792d Made some minor changes to Sdk big query custom container training (#522)
* minor changes done

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:58:45 -07:00
dbf19acde4 Adds the updated telecom-subscriber-churn-prediction notebook to official and removes from community (#506)
* updates and adds the telecom-subscriber-churn-prediction notebook to official and removes from the community

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:53:21 -07:00
1aaa833153 Adds manual-scaling config and explanation to the Automl-forecasting-batch notebook in official folder (#514)
* adds manual-scaling config and explanation to the notebook

* ran linter test after installing linter requirement updates

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:50:23 -07:00
c73d995680 Made minor changes to sdk_automl_image_object_detection_batch.ipynb file (#513)
* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-05 12:45:55 -07:00
3fe5028724 Malansari automl vision api notebook update (#612)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

* Fixed sample dataset link to point to public version

* Fixed linting issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-04 09:14:23 -07:00
Andrew FerlitschandGitHub 44dd24f910 Update README.md 2022-06-02 15:57:04 -07:00
Andrew FerlitschandGitHub c20a9c4e63 update: AutoML + MLMD (#605)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH

* update: AutoML + MLMD

* update: AutoML + MLMD
2022-06-02 15:50:05 -07:00
Ivan CheungandGitHub edffdf34b7 Pin protobuf version to avoid broken dependencies. 2022-06-02 17:25:28 -04:00
340c24c5b4 Added custom container explainability notebook (#564)
* Commit for lint

* Commit after name change

* Commit of notebook and CODEOWNERS

Added custom container with xai notebook, and explainable_ai folder in the community folder

* Removed extra copy of file

* Remove extra file

* Updated per review from DPE

* Lint test updates

* linter ran

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-06-02 12:28:15 -07:00
Andrew FerlitschandGitHub 11f20f3f08 fix: replace BLAH (#600)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML

* fix: replace BLAH

* fix: replace BLAH
2022-06-01 11:19:02 -07:00
Andrew FerlitschandGitHub 199b330aa5 Update get_started_automl_mlmd.ipynb 2022-05-31 18:37:05 -07:00
Andrew FerlitschandGitHub 5143db1024 feat: Add DIY MLMD with AutoML (#598)
* feat: XAI + custom server

* feat: add DIY MLMD for AutoML

* feat: add DIY MLMD for AutoML
2022-05-31 18:35:23 -07:00
Andrew FerlitschandGitHub 2f0bd3de15 fix: correct reference to service 2022-05-31 13:50:51 -07:00
Andrew FerlitschandGitHub 4d6c541967 feat: XAI + custom server (#597) 2022-05-31 13:31:20 -07:00
Andrew FerlitschandGitHub 5228a5c978 Update README.md 2022-05-31 12:47:16 -07:00
Andrew FerlitschandGitHub c6118bd17d feat: start stage 7 (#591)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine

* feat: LightGBM

* feat: LightGBM

* feat: start stage7

* feat: start stage8
2022-05-31 09:48:49 -07:00
Andrew FerlitschandGitHub d2c9e84af4 Add files via upload 2022-05-26 09:30:17 -07:00
Andrew FerlitschandGitHub fe0a0ff055 Update README.md 2022-05-26 09:30:04 -07:00
Andrew FerlitschandGitHub 40e287245d Delete stage5v2.png 2022-05-26 09:29:50 -07:00
Andrew FerlitschandGitHub c79646a537 Add files via upload 2022-05-26 09:26:24 -07:00
Andrew FerlitschandGitHub e293e1c2fb Update README.md 2022-05-26 09:26:09 -07:00
Andrew FerlitschandGitHub f2ab65bd03 Delete stage4v2.png 2022-05-26 09:25:51 -07:00
Andrew FerlitschandGitHub aa686516d3 Add files via upload 2022-05-25 14:42:01 -07:00
Andrew FerlitschandGitHub 11c80a0251 Update README.md 2022-05-25 14:41:45 -07:00
Andrew FerlitschandGitHub c5e9e5812b Delete stage3v2.png 2022-05-25 14:41:29 -07:00
Andrew FerlitschandGitHub 98b126fa0b Update README.md 2022-05-25 14:34:29 -07:00
Andrew FerlitschandGitHub 55553f9e69 Update README.md 2022-05-25 14:33:56 -07:00
Andrew FerlitschandGitHub 563013c745 Add files via upload 2022-05-25 14:33:10 -07:00
Andrew FerlitschandGitHub fefb9778a7 Update README.md 2022-05-25 14:32:53 -07:00
Andrew FerlitschandGitHub be1831082c Update README.md 2022-05-25 14:11:47 -07:00
Andrew FerlitschandGitHub 9e15ee2e8a Add files via upload 2022-05-25 14:11:21 -07:00
Andrew FerlitschandGitHub ceff7d7271 Delete stage2v2.png 2022-05-25 14:10:51 -07:00
Andrew FerlitschandGitHub df9b5cd6f0 Add files via upload 2022-05-24 16:17:27 -07:00
Andrew FerlitschandGitHub bc57801525 Update README.md 2022-05-24 16:17:06 -07:00
Andrew FerlitschandGitHub 1b403373d3 Delete stage1.png 2022-05-24 16:16:49 -07:00
Andrew FerlitschandGitHub 987fb74ca6 Add files via upload 2022-05-24 15:13:15 -07:00
Andrew FerlitschandGitHub 65a209bc7b Update README.md 2022-05-24 15:12:55 -07:00
Andrew FerlitschandGitHub 16e6d9e90f Delete stage6c.png 2022-05-24 15:12:32 -07:00
Andrew FerlitschandGitHub 7ce6bee763 Delete stage6b.png 2022-05-24 15:12:18 -07:00
Andrew FerlitschandGitHub 6d7ca3eb55 Delete stage6a.png 2022-05-24 15:12:05 -07:00
Andrew FerlitschandGitHub 8e9f205e9a Add files via upload 2022-05-24 14:58:15 -07:00
Andrew FerlitschandGitHub 5fdb6c4368 Update README.md 2022-05-24 14:57:50 -07:00
Andrew FerlitschandGitHub 71ebfd402c Delete stage5.png 2022-05-24 14:57:33 -07:00
Andrew FerlitschandGitHub 6e4ca83531 Update README.md 2022-05-24 14:43:12 -07:00
Andrew FerlitschandGitHub 05793d6a3c Add files via upload 2022-05-24 14:42:39 -07:00
Andrew FerlitschandGitHub 3dc374b7db Delete stage4.png 2022-05-24 14:42:13 -07:00
Andrew FerlitschandGitHub 3ac8a4f617 Add files via upload 2022-05-24 14:22:20 -07:00
Andrew FerlitschandGitHub 21b4b5b063 Delete stage3v3.png 2022-05-24 14:22:11 -07:00
Andrew FerlitschandGitHub 9ffd921ca4 Update README.md 2022-05-24 14:21:38 -07:00
Andrew FerlitschandGitHub 14e6ebbb95 Add files via upload 2022-05-24 14:21:08 -07:00
Andrew FerlitschandGitHub 277b685a39 Delete stage3.png 2022-05-24 14:20:58 -07:00
Andrew FerlitschandGitHub 67e7715ed9 Update README.md 2022-05-24 13:59:19 -07:00
Andrew FerlitschandGitHub bb87900209 Add files via upload 2022-05-24 13:58:51 -07:00
Andrew FerlitschandGitHub 96ebe7286b Delete stage2.png 2022-05-24 13:58:24 -07:00
Andrew FerlitschandGitHub 0b3a5dde09 Add files via upload 2022-05-24 13:57:41 -07:00
Andrew FerlitschandGitHub 17a30360b4 Delete stage2.png 2022-05-24 13:57:24 -07:00
Andrew FerlitschandGitHub b386f51916 Update README.md 2022-05-24 13:40:25 -07:00
Andrew FerlitschandGitHub dd4f40c7f4 Add files via upload 2022-05-24 13:39:51 -07:00
Andrew FerlitschandGitHub d402fc085a Delete stage1.jpg 2022-05-24 13:39:38 -07:00
Andrew FerlitschandGitHub a12b9cd60f Add files via upload 2022-05-24 13:38:11 -07:00
Andrew FerlitschandGitHub bf1032d550 Delete stage1.jpg 2022-05-24 13:38:01 -07:00
Andrew FerlitschandGitHub dea05e1e36 Add files via upload 2022-05-24 13:36:59 -07:00
Andrew FerlitschandGitHub a9f0117c82 Update README.md 2022-05-23 17:09:39 -07:00
Andrew FerlitschandGitHub 83f1fe9ecd Add files via upload 2022-05-23 17:08:06 -07:00
Andrew FerlitschandGitHub 7344274037 Add files via upload 2022-05-23 17:06:53 -07:00
Andrew FerlitschandGitHub e36bfa9a3b Add files via upload 2022-05-23 17:03:27 -07:00
Andrew FerlitschandGitHub 950aa245b8 Update README.md 2022-05-23 16:55:52 -07:00
Andrew FerlitschandGitHub ac47b2e370 Update README.md 2022-05-20 13:01:42 -07:00
Andrew FerlitschandGitHub 6662fc809b Update README.md 2022-05-20 13:00:49 -07:00
Andrew FerlitschandGitHub 12b3171d5e feat: LightGBM (#583)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine

* feat: LightGBM

* feat: LightGBM
2022-05-20 12:58:37 -07:00
Andrew FerlitschandGitHub 579d4751bd Update README.md 2022-05-20 12:41:10 -07:00
Andrew FerlitschandGitHub d4c607323d feat: swivel + ME (#582)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* feat: swivel and matching engine

* feat: swivel and matching engine
2022-05-20 12:39:42 -07:00
nayaknishantandGitHub 3ad30738a7 docs: fixing CODEOWNERS and instructions hyperlinks (#580)
When opening a PR, the CODEOWNERS and instructions hyperlinks throw a 404 error because they point to a URL that has been changed. Fixing these hyperlinks.
2022-05-19 13:20:23 -07:00
Andrew FerlitschandGitHub 119273ae7e Ml.googleapis fix (#579)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:42:55 -07:00
Andrew FerlitschandGitHub 95bc39a685 fix: enable APIs stage5 (#578)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:30:11 -07:00
Andrew FerlitschandGitHub b054104851 fix: enable APIs stage4 (#577)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:23:49 -07:00
Andrew FerlitschandGitHub e0e0cf849a fix: enable APIs stage3 (#576)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 12:15:29 -07:00
Andrew FerlitschandGitHub c95b3d7088 fix : enable APIs stage2 (#575)
* fix: enable apis

* fix: enable apis

* fix: enable apis

* fix: enable apis
2022-05-19 11:51:49 -07:00
Andrew FerlitschandGitHub 19c2bdb008 fix: enable APIs stage1 (#574)
* fix: enable apis

* fix: enable apis
2022-05-19 11:36:12 -07:00
Andrew FerlitschandGitHub 3c815f3888 update: new template edition (#572)
* fix: new template review updates

* fix: new template review updates

* mport -> import

* fix: dummy code sample required an import

dummy code samples (not otherwise part of template) -- should be self contained since they will be deleted by the template user.

* fix: added install for self-contained code passes ingestion test

* fix: example code (not otherwise part of template) not self-contained.

* fix: continue update so code example is self-contained

* update: numpy already installed in test env
2022-05-19 11:24:19 -07:00
cfcd9b29fd Malansari automl vision api notebook (#573)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

* Formatting changes

Added additional APIs to be enabled

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-19 11:14:17 -07:00
Ivan CheungandGitHub 4fca7d98b2 Increases notebook concurrency and linted CI files (#512)
* Fixed private pool issues

* Ran linter

* Added worker timeouts

* Tweaked timeout

* Removed gcloud requirement

* Removed unneeded file
2022-05-18 18:58:54 -04:00
Andrew FerlitschandGitHub dea950bcb6 fix: DPE styling (#570)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:32:30 -07:00
Andrew FerlitschandGitHub 4c43755fb6 Mlops 8v3 (#569)
* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 14:11:31 -07:00
Andrew FerlitschandGitHub 374942a9e9 fix: DPE-style tuning (#568) 2022-05-18 14:01:13 -07:00
Andrew FerlitschandGitHub 8add418428 Mlops 8v2 (#567)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:46:24 -07:00
Andrew FerlitschandGitHub 9d73cc4574 fix: DPE style tuning (#566)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 13:29:45 -07:00
Andrew FerlitschandGitHub 5edb4bb1bf fix: DPE-styling (#565)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers

* fix: DPE-style tuning

* fix: DPE-style tuning
2022-05-18 12:29:01 -07:00
Andrew FerlitschandGitHub 0e811868d3 fix: links 2022-05-18 11:33:56 -07:00
Andrew FerlitschandGitHub 9efcfa25e8 fix: links 2022-05-18 11:27:11 -07:00
48036cf581 vision api notebook - updated link to open in Vertex AI Workbench (#562)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting

* Updated link to open in Vertex AI Workbench
to point to raw .ipynb file

* Fixed lint issues

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-18 11:20:39 -07:00
Andrew FerlitschandGitHub 79fd9b4049 Update README.md 2022-05-17 11:05:54 -07:00
Andrew FerlitschandGitHub 46b2181a4e fix: typos in two towers (#563)
* fix: two towers

* fix: two towers

* fix: typos in twotowers

* fix: typos in twotowers
2022-05-17 11:04:01 -07:00
Andrew FerlitschandGitHub d04f25a8bd Update README.md 2022-05-16 15:13:45 -07:00
Andrew FerlitschandGitHub 9f341c350c fix: two towers (#561)
* fix: two towers

* fix: two towers
2022-05-16 15:11:44 -07:00
Ivan CheungandGitHub f22f97f680 fix: Updated matching engine dependency and fixed cases (#557)
* fix: Updated dependency and fixed cases

* Ran linter

* Renamed to Vertex AI Workbench notebook

* Additional text fixes
2022-05-16 13:06:04 -04:00
Andrew FerlitschandGitHub fe75745d44 feat: WIP: twotowers+matching engine (#560)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine

* feat: wip: twotowers

* feat: wip: twotowers
2022-05-13 14:03:43 -07:00
Andrew FerlitschandGitHub bbc9f1337e Update README.md 2022-05-13 08:56:39 -07:00
Andrew FerlitschandGitHub eb1fa9213a feat: add notebook for matching engine (#559)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK

* feat: matching engine

* feat: matching engine
2022-05-12 15:55:21 -07:00
Mohammad Al-AnsariandGitHub a7033a6527 Updates to visionapi notebook (#556)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference

* Fixed the links for opening notebook (again!)

* Added attribution and references

* Removed references as covered at top

* Updated installation commands to match

* Updated Vertex AI region name to be more clear

* Added db-types dependency for pandas operations
that are now failing

* Minor edits

* Combined package installation and
added a note to ignore the errors

* Minor edit to message

* Added special thanks to andrewferlitsch@

* Updated andrewferlitsch@ GithHub profile link

* Updated sample files URLs to absolute URLs

* Removed empty code block

* Added additional attribution (and the one that did not make it into previous commit!)

* Fixed multi-package import formatting
Switched to pandas instead of db-dtypes

* Fixed isort issue

* Removed unnecessary pandas import

* Formatted the notebook with nbfmt

* Additional notebook formatting
2022-05-11 11:23:50 -07:00
Andrew FerlitschandGitHub 7e6c2d69c8 update: ModelEval as SDK (#555)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* update: ModelEvaluation SDK

* update: ModelEvaluation SDK
2022-05-10 15:33:52 -07:00
Andrew FerlitschandGitHub 1a21b81804 fix: stage5 DPE style (#554)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 14:11:31 -07:00
Andrew FerlitschandGitHub 2bbd520613 fix: stage4 DPE styling (#553)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 13:58:44 -07:00
Andrew FerlitschandGitHub 8285e4ebd1 Mlops 8 (#552)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:56:43 -07:00
Andrew FerlitschandGitHub 859849894e fix: stage3 workbench (#551)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:38:52 -07:00
Andrew FerlitschandGitHub e74dd48ae0 fix: 2nd round workbench (#550)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench

* fix: check for workbench
2022-05-10 12:12:27 -07:00
Andrew FerlitschandGitHub a14eb71210 fix: check for workbench (#549)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server

* fix: check for workbench

* fix: check for workbench
2022-05-10 11:37:44 -07:00
Mohammad Al-AnsariandGitHub 0b6a9718ff Added author / reviewer informationAdded sample files (#544)
* Delete revised version

* Copy notebook from /notebooks/official

* Renamed base notebook

* Added first version by mansari@

* Updated to revised version by andrewferlitsch@

* Added author / reviewer information

Added sample files

* Updated CODEOWNERS

* Fixed links for opening the notebook in Colab/Github/Vertex

Removed installation of and references to pandas

Fixed gcs_annotation_file_name string reference
2022-05-09 13:59:59 -07:00
Andrew FerlitschandGitHub 6ac0d8a029 Update README.md 2022-05-09 13:48:00 -07:00
Andrew FerlitschandGitHub 2ee013bcab Delete get_started_nvidia_triton_serving.ipynb 2022-05-09 13:47:18 -07:00
Andrew FerlitschandGitHub 1ebb3f5714 Mlops 8 (#547)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server

* feat: triton server

* feat: triton server
2022-05-09 13:46:35 -07:00
Andrew FerlitschandGitHub 11c5134961 Update README.md 2022-05-09 13:40:51 -07:00
Andrew FerlitschandGitHub e328b7268f feat: triton server (#546)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings

* feat: triton server

* feat: triton server
2022-05-09 13:38:37 -07:00
Andrew FerlitschandGitHub d297e99e5a Update get_started_with_machine_management.ipynb 2022-05-09 12:20:03 -07:00
Andrew FerlitschandGitHub 48c7a4c82e fix: spelling 2022-05-09 12:15:07 -07:00
Andrew FerlitschandGitHub eb3b52f863 Update README.md 2022-05-09 12:10:40 -07:00
Andrew FerlitschandGitHub 4e58cca127 Update get_started_with_machine_management.ipynb 2022-05-09 12:09:07 -07:00
Andrew FerlitschandGitHub 182a98768f feat: machine resource settings (#545)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data

* feat: component vs job resource settings

* feat: component vs job resource settings
2022-05-09 12:06:56 -07:00
Andrew FerlitschandGitHub f483447235 Update README.md 2022-05-06 19:07:16 -07:00
Andrew FerlitschandGitHub c59050608b feat: vision api and automl (#543)
* feat: using Vision API for preprocessing data

* feat: using Vision API for preprocessing data
2022-05-06 19:04:43 -07:00
Andrew FerlitschandGitHub 3b9844f92c update: add co-author (#542)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth

* update: add co-author

* update: add co-author
2022-05-06 15:27:05 -07:00
Andrew FerlitschandGitHub ee301a22f6 clean: remove BLAH 2022-05-06 12:38:30 -07:00
Andrew FerlitschandGitHub b7d16f66aa fix: workbench auth (#541)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility

* fix: workbench auth

* fix: workbench auth
2022-05-06 10:18:06 -07:00
Andrew FerlitschandGitHub 57aad5b802 fix: compat issue with Vertex AI and TFX Transform (#540)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes

* fix: vertex ai compatibility

* fix: vertex ai compatibility
2022-05-05 19:04:13 -07:00
Andrew FerlitschandGitHub 9e311433ba fix: mistakes in tfx notebook (#539)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX

* fix: mistakes

* fix: mistakes
2022-05-05 14:58:04 -07:00
Andrew FerlitschandGitHub 04b310927a Update README.md 2022-05-05 13:36:36 -07:00
Andrew FerlitschandGitHub 2fed3ad014 feat: add TFX pipeline (#538)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA

* feat: add notebook for TFX

* feat: add notebook for TFX

* feat: add notebook for TFX
2022-05-05 13:34:22 -07:00
Andrew FerlitschandGitHub 0ec94e0af6 fix: IS_COLAB (#535)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLABA
2022-05-04 13:55:11 -07:00
9470be0900 adds the updated service-account code to mlops/stage3/get_started_with_dataproc_serverless_pipeline_components notebook (#529)
* adds the updated service-account setting code to notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:55 -07:00
479a0c6271 adds the updated service-account code to mlops/stage3/get_started_with_automl_pipeline_components notebook (#528)
* adds the updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:04:13 -07:00
053f9c397f adds the updated service-account code to mlops/stage3/get_started_with_kubeflow_pipelines notebook (#527)
* adds updated service-account setting code to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-04 10:03:39 -07:00
Andrew FerlitschandGitHub 2c82469756 fix: service account 2022-05-03 08:33:17 -07:00
Andrew FerlitschandGitHub fdfc7009d0 fix: correct IS_COLAB (#531)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work

* fix: IS_COLAB

* fix: IS_COLAB
2022-05-02 14:25:08 -07:00
Andrew FerlitschandGitHub 59fcfe137d fix: typo in stage 2022-05-02 14:00:16 -07:00
Andrew FerlitschandGitHub 9b434b32bc feat: more eval examples (#530)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* feat: more model eval work

* feat: more model eval work
2022-05-02 13:19:07 -07:00
fc27cd8628 Added service account fetch code for colab in get_started_with_rapid_prototyping_bqml_automl file (#520)
* made changes

* ran linter test

* added minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:45 -07:00
a62f03c396 Added service account fetch code for colab in get_started_with_custom_training_pipeline_components file (#519)
* made changes

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:21:08 -07:00
a270439814 Added service account fetch code for colab in get_started_with_bqml_pipeline_components file (#518)
* changes made

* ran linter test

* made minor changes

* ran linter test

* made changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-05-02 09:20:18 -07:00
sudarshan-SpringMLandGitHub a97af4a078 Added service account fetch code for colab in get_started_with_bq_tfdv_pipeline_components file (#517)
* added service account code for colab

* ran linter test

* made changes

* ran linter test
2022-05-02 09:19:29 -07:00
Andrew FerlitschandGitHub d7127cc22f fix: IS_COLAB (#526)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:25:49 -07:00
Andrew FerlitschandGitHub 802ab4edd8 fix: DPE-styling (#525)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: IS_COLAB

* fix: IS_COLAB

* fix: IS_COLAB
2022-04-29 15:10:19 -07:00
Andrew FerlitschandGitHub ae7f28fb31 fix: DPE-styling updates (#524)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 14:06:59 -07:00
f63e3e6e4c Added colab link and made changes in the code in such a way that docker commands can run on colab environment for the file get_started_vertex_training_pytorch (#508)
* Added colab in the notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-29 11:55:51 -07:00
Andrew FerlitschandGitHub b9bb497ebc fix: IS_COLAB (#523)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag

* fix: add IS_COLAB flag
2022-04-29 11:54:21 -07:00
Andrew FerlitschandGitHub 4368b9e7f8 feat: GAPIC->SDK for private endpoint (#516)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model

* feat: GAPIC->SDK for private endpoints

* feat: GAPIC->SDK for private endpoints
2022-04-28 09:59:49 -07:00
2e9cb5d2cf minor change for 'Get started with dataflow pipeline components' (#500)
* Add minor changes to get_started_with_dataflow_pipeline_components

* minor changes and tested

* remove variable dataflow_wait_op, since not used in other places.

* remove variable dataflow_wait_op, since not used in other places

* removed unused import

* Run linter test

* Add gcloud project set when using colab

* Run linter

* correct anem toColab logo Run in Colab

* run linter

* correct the list of items to remove

* Run linter

* Run liinter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 16:45:20 -07:00
9ec8a93e05 Minor changes has been done to pipelines_intro_kfp (#494)
* minor changes done

* ran linter test

* chnanged the as per review coments

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:42:34 -07:00
3ed8778656 Made few changes to sdk-feature-store (#486)
* Added vertexai notebook

* Ran the linter test

* Made the required changes based on the comments

* Ran linter test again

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-27 09:39:03 -07:00
Andrew FerlitschandGitHub bf5e3cf870 fix: delete tmp BQ model (#510)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker

* fix: delete tmp BQ model

* fix: delete tmp BQ model
2022-04-27 09:30:35 -07:00
c23215893d minor changes on stage1 ml ops - Get started vertex datasets (#474)
* Add minor changes to get_started_vertex_datasets notebook

* run linter

* Run Linter test

* Add google authentication cell for colab execution

* run linter

* correct the project id definition

* Run linter

* Add project id cell

* run liner

* Added imports that are required

* run linter test

* Add gcloud project set

* Run linter

* add linter run

* Running linter test

* run linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-25 10:11:27 -07:00
Andrew FerlitschandGitHub 1c96f7ca71 fix: notebook run in colab (#505)
* feat: add colab code for docker

* feat: add colab code for docker

* fix: add colab support for docker

* fix: add colab support for docker
2022-04-22 18:50:29 -07:00
Andrew FerlitschandGitHub 0d5661835b feat: add docker support in Colab (#504)
* feat: add colab code for docker

* feat: add colab code for docker
2022-04-22 13:54:29 -07:00
fe1a3c0bc9 Adds Colab part and minor changes to ml_ops/stage2/get_started_bqml_training notebook (#491)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

* adds colab part and minor changes

* ran linter test

* retains the newly added code lost in conflicts

* ran linter test

* converts vertex to vertex ai

* ran linter test

* moves deletion of temporary BQ table outside delete_storage condition

* ran linter test

* adds bigquery-storage dependency to the notebook tested on Colab

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 11:09:49 -07:00
82bffb87f1 Made some minor changes to sdk-metric-parameter-tracking-for-locally-trained-models (#480)
* Added to correct path

* Ran linter test

* Made some changes

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-22 00:05:57 -07:00
sudarshan-SpringMLandGitHub 741c6732f1 Made minor changes to sdk-metric-parameter-tracking-for-custom-jobs file (#479)
* modified file

* modified file

* ran linter test

* deleted file in community folder

* ran linter test

* changed folder name in links

* ran linter test

* resolved comments

* ran linter test

* modified file

* ran linter test
2022-04-22 00:05:07 -07:00
9d8caf7888 Added markup text mentioning the role provided to service account used by notebook instance & provided key-version value while destroying it in notebook get_started_with_cmek_training (#495)
* Changes made to notebook

* Ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 23:37:19 -07:00
e63d354413 Made minor changes to rapid_prototyping_bqml_automl file and moved file from community to official (#496)
* added file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:44:18 -07:00
831c515477 Adding official version for Fraud detection notebook (#321)
* deleted file in community folder

* modified notebook

* ran linter test

* renamed managed_notebooks folder to workbench

* ran linter

* resolved comments

* ran linter test

* pulled new version of branch

* ran linter again

* resolved comments

* ran linter test

* removed %%time and added --user flag to all pip installs

* ran linter test

* added debug statements

* ran linter test

* added verbose

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 22:07:58 -07:00
Andrew FerlitschandGitHub 06ba5d6804 fix: SaraRob installation updates (#501)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-21 11:37:44 -07:00
0137cd106e adds Colab part and minor changes to ml_ops/stage2/get_started_vertex_experiments notebook in community folder (#493)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:20:29 -07:00
8b3b63d714 Adds Colab part and minor changes to ml_ops/stage2/get_started_automl_training notebook (#492)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

* adds colab part and minor changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-21 09:19:34 -07:00
bf79916f29 Adds Colab part to ml_ops/stage1/get_started_bq_datasets notebook (#490)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

* adds Colab part and minor changes

* ran linter test

* updates the enable apis step in setup project section

* ran linter test

* changes vertex to vertex ai

* ran linter test

* moves temporary BQ table deletion outside the delete_storage condition

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:17:49 -07:00
6bf462f79d Notebook fix to handle GCS outputs and resolve (AutoML Tabular Forecasting notebook error: no row field 'name' #453) (#477)
* notebook fix to handle gcs output

* linter test

* minor bug fix and markup added

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-21 09:13:52 -07:00
Andrew FerlitschandGitHub 106cdee495 feat: update model eval metrics for comparison (#498)
* feat: improve notebook for metric compare

* feat: improve notebook for metric compare

* feat: improve notebook for metric compare
2022-04-20 19:21:23 -07:00
dfb7301733 Inardini - feature store demo blog review (#484)
* review for blog

* linter code passed

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:17:17 -07:00
da707b2cbc Made minor changes to custom-tabular-bq-managed-dataset file (#473)
* modified notebook

* modified file

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:07:07 -07:00
873ba9dde9 Made minor changes to get_started_with_rapid_prototyping_bqml_automl file (#459)
* modified file

* made linter changes

* made changes

* linter test issues resolved

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-18 15:06:27 -07:00
Andrew FerlitschandGitHub 15c452f39d fix: Issue 451, add db-dtypes to requirements (#458)
* fix: issue 451

* fix: issue 451
2022-04-18 12:14:56 -07:00
Andrew FerlitschandGitHub be7111815b fix: getting SERVICE ACCOUNT 2022-04-18 10:59:44 -07:00
17db1a952b Tabnet - Add serving (#482)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

* Add deployment in Vertex AI

* Add delete the resource

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 12:51:55 -07:00
Andrew FerlitschandGitHub 455143d0f0 Update README.md 2022-04-15 12:26:06 -07:00
Andrew FerlitschandGitHub f0892852cb Update README.md 2022-04-15 12:24:39 -07:00
Andrew FerlitschandGitHub ca48556d0c feat: add tabnet notebook (#483)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example

* feat: add tabnet notebook

* feat: add tabnet notebook
2022-04-15 12:21:51 -07:00
Aleksey VlasenkoandGitHub f961aa3174 Minor updates basing on team feedback (#481) 2022-04-15 10:56:46 -07:00
64c8eca7df Refresh of Distributed Hyperparameter Tuning for Colab (#461)
* notebook refresh from vertex ai sdk project

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-15 08:49:36 -07:00
b3332c1742 minro changes to get_started_with_hpt_pipeline_components (#465)
* minor changes made to notebook

* ran lintertest

* added coment

* ran lintertest

* made changes sujjested in git review

* ran linter test

* changes done as per review

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-14 17:02:23 -07:00
Aleksey VlasenkoandGitHub b35f697a75 Adding samples for Vertex AI Prediction optimized TensorFlow runtime (#475)
* adding Vertex AI optimized TensorFlow runtime samples

* updated URLs, added code to import benchmark.py

* fixed 'Open in Vertex AI Workbench' links

* final cleanup

* added @vlasesnkoalexey as an owner of notebooks/community/vertex_endpoints/optimized_tensorflow_runtime

* rerun linter
2022-04-14 10:14:27 -07:00
3bc32a1d48 Adds Colab part to the ml_ops/stage3/get_started_with_automl_pipelines notebook (#472)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

* adds Colab part to the notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:52:06 -07:00
d66f851554 Adds Colab part to the ml_ops/stage3/get_started_with_kubeflow_pipelines notebook (#471)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

* adds colab changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:34 -07:00
d733f107e1 Made minor changes to get_started_with_custom_training_pipeline_components file (#470)
* added colab related content

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:51:01 -07:00
805e2e1c83 Made minor changes to get_started_with_bqml_pipeline_components file (#469)
* made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:50:18 -07:00
03dc17d9d7 updates ml_ops/stage3/get_started_with_dataproc_serverless_pipelines notebook (adds delete-batch code + adds colab part + updates textual content) in community folder (#464)
* updates: adds delete-batch code  + adds colab part + updates textual content

* sets delete_bucket to False as default

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:49:26 -07:00
a4909f823e Adds changes for Colab support to the ml_ops/stage2/get-started-with-vertex-featstore notebook (#462)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

* adds the colab changes and minor textual changes

* ran linter test

* adds the colab changes to the notebook and minor textual changes

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 11:48:58 -07:00
e91b259595 Made minor changes to file get_started_vertex_training_xgboost.ipynb (#436)
* modified file

* run linter test

* run in colab

* added coment

* run lintertest

* changed as per review coments

* ran lintertest

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:08:04 -07:00
14284046e4 Made minor changes to get_started_vertex_tensorboard (#437)
* Adding a notebook

* Ran linter test

* Added Colab

* Ran the linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:07:24 -07:00
59a9a5e6ba Notebook Refresh E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Distributed Training (#434)
* notebook refresh from vertex ai sdk project

* update with linter test changes

* linter fix

* linter issue

* notebook colab workbench links

* linter test

* linter fix

* linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-12 10:06:01 -07:00
Andrew FerlitschandGitHub f3b0a9e0c0 Update README.md 2022-04-11 18:56:52 -07:00
Andrew FerlitschandGitHub 92b572a364 feat: add raw predict example (#468)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed

* feat: add raw predict example

* feat: add raw predict example
2022-04-11 18:53:45 -07:00
014be9b530 Made minor changes to get_started_with_data_labeling_2 (#463)
* added colab link and made colab related changes

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:07:13 -07:00
fa675e0082 inardini real time churn feature store demo fixes (#455)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

* name fixes. linter code done. passed.

* fix project id and region

* test done

* format

* linter test done.

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-11 16:01:27 -07:00
Andrew FerlitschandGitHub 113cbb9709 Update README.md 2022-04-11 14:54:27 -07:00
Andrew FerlitschandGitHub b72bdc8112 Update README.md 2022-04-11 12:31:03 -07:00
Andrew FerlitschandGitHub 0842fa8354 Update README.md 2022-04-11 12:30:38 -07:00
Andrew FerlitschandGitHub 4e4f3f4095 Ml ops 7v6 (#467)
* feat: add BQML+MR example

* feat: add BQML+MR example

* feat: add TFE optimizzed

* feat: add TFE optimizzed
2022-04-11 12:16:47 -07:00
Andrew FerlitschandGitHub d014febeb9 Update README.md 2022-04-11 11:37:42 -07:00
Andrew FerlitschandGitHub a3264df643 feat: add BQML + MR example (#466)
* feat: add BQML+MR example

* feat: add BQML+MR example
2022-04-11 11:36:50 -07:00
f0208e3e37 Made minor changes to get_started_with_custom_training_pipeline_components (#456)
* modified file

* modified notebook

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:37 -07:00
f84e1b9cbc Updates ml_ops/stage3/get-started-kubeflow-pipeline-notebook in the community folder (#449)
* updates the mlops/stage3/get_started_with_kubeflow_pipelines.ipynb notebook

* fixes unused variables

* fixes conflicting function names

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:31:05 -07:00
16b2086031 Made minor changes to get_started_with_bqml_pipeline_components (#444)
* modified notebook

* linter modifications made

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:30:20 -07:00
0e24ba565d Updates ml_ops/stage3/get-started-automl-pipeline-notebook in the community folder (#440)
* updates the get-started-automl-pipelines in the mlops/stage3 folder inside community folder

* replaces the unused variable deploy_op with _

* removes the unused Model import

* adds the costs section

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:37 -07:00
49718b02a5 Made minor changes to get_started_with_bq_tfdv_pipeline_components (#439)
* modified notebook

* linter test issues resolved

* ran linter test

* added colab option

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:29:03 -07:00
63031ed364 Updates ml_ops/stage2/get_started_vertex_featurestore notebook in community folder. (#426)
* updates get-started-featurestore notebook in mlops/stage2

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:26:57 -07:00
9fd325e25b Made minor changes to file get_started_with_data_labeling (#425)
* modified notebook

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-04-08 09:22:12 -07:00
93af43419c Updates Mlops/stage2/get-started-automl-training notebook in the community folder (#409)
* updates the get-started-automl-training notebook

* ran linter test

* adds --user flag during installation step

* ran linter test

* updates the clean up step

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 13:03:29 -07:00
c8f0cdb74a Refresh of Distributed Hyperparameter Tuning Notebook (#454)
* notebook refresh

* linter test

* notebook refresh added corrected cleanup

* linter test

* notebook refresh added corrected cleanup

* linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 14:07:47 -05:00
19368fe5cc inardini google cloud pipelines dataproc tabular (#445)
* add dataproc components tabular notebook

* add src package

* add codeowner

* linter test done. almost ok except for the flake8 E231. need to follow up with andy

* fix typos based on andy review

* linter test done. review with andy

* hyperparameter_tuning_op fix

* project name

* add delete repo

* fix image

* linter test done

* fix image reference

* fix typo image reference

* minor fixes

* karl fixes

* karl fixes on links

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:10:33 -07:00
6a05e0eb6c inardini real time churn feature store demo (#448)
* add new notebook version

* linter test done. passed

* simple fix

* add images

* linter test done

* fix image name

* fix file name in the notebook

* linter code run. done

* linter code run. done

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 10:21:22 -05:00
40d643f11c Change bq://bigquery-public-data:iowa_liquor_sales_forecasting.2021_sales_predict for PREDICTION_DATASET_BQ_PATH (#423)
Co-authored-by: Jungwoon Lee <jungwoonlee@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-07 09:10:10 -05:00
Andrew FerlitschandGitHub 72009cd21b fix: misspelling of BigQuery 2022-04-06 20:15:07 -07:00
Andrew FerlitschandGitHub cc9a50f40b Update get_started_with_vertex_private_endpoints.ipynb 2022-04-06 19:56:51 -07:00
Andrew FerlitschandGitHub e3135e8875 Update README.md 2022-04-06 17:42:45 -07:00
Andrew FerlitschandGitHub 59eb297151 feat: add notebook for private endpoints (#450)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: notebook for private endpoints

* feat: notebook for private endpoints
2022-04-06 17:41:10 -07:00
32b0c1c89e Mco mvmm (#420) - move model monitoring notebook from community to official
* license tweak

* remove unused import json

* fixed a missing import

* add sleep(300) to test my theory

* add missing newline

* put sleep behind a conditional

* revert new notebook name to previous name for compatibility with extant links

* fix quoting syntax error

* reformatted due to relint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-06 22:37:53 +01:00
3328a8190d Adding sample to use (auto) scaling config for Feature Store online store (#367)
* Add example using auto scale

* Format with nbqa

* Complete sentence

* Give the sample for CreateFeaturestoreRequest only, instead of actual call to create FS to avoid duplicate resource or extra cleanup.

* Remove unused import

* Remove version pinning

* Add try block to avoid error when test was not cleanup properly.

* Lint

* Fix import

* Merge print lro result with the call in the same try block

* Fix typo

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-04-05 17:02:49 -07:00
7aa6acdca6 fix UnboundLocalError in TF-Agents Bandits Guide (#446)
In "Step by Step Guide to Building Reinforcement Learning Applications using Vertex AI", the replay_buffer was unbound if training_data_spec_transformation_fn was provided to the train() function

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-04-05 16:30:40 -05:00
Andrew FerlitschandGitHub 7926ff1264 Update README.md 2022-04-05 11:10:12 -07:00
Andrew FerlitschandGitHub 67b926dfb4 feat: add notebook for FastAPI server (#447)
* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server

* feat: add notebook for FastAPI server
2022-04-05 11:08:09 -07:00
327f9e7a4b Fix typo in notebook heading. (#443)
* Fix typo in notebook heading.

* Fix linting issues.

Co-authored-by: Win Woo <wwoo@google.com>
2022-04-05 08:43:47 -05:00
Andrew FerlitschandGitHub 8be220d089 fix missing + 2022-04-04 14:40:27 -07:00
Andrew FerlitschandGitHub 2dad40f49f bucket setting fine-tuning 2022-04-04 14:39:45 -07:00
Andrew FerlitschandGitHub 99b724028f Update README.md 2022-04-04 13:51:43 -07:00
Andrew FerlitschandGitHub 909fbcb0d4 feat: notebook for TF Serving binary (#442)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions

* feat: notebook for TF Serving

* feat: notebook for TF Serving
2022-04-04 13:49:39 -07:00
Andrew FerlitschandGitHub 351fc3e4d3 fix: remove unused print_op 2022-04-04 09:05:33 -07:00
252b3d31a3 Inardini bqml components pipeline official blog (#416)
* bqml pipeline notebook for official blog

* add notebook to CODEOWNERS

* add author name

* requirements commenting fix

* linter test done

* unpin the maintenance version for kfp

* fix: install conflicts

* Update google_cloud_pipeline_components_bqml_text.ipynb

* add karl fix

* lint test done

* add andy fixes

* linter test done

* flip order of the special METADATA fix

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
2022-04-04 09:00:17 -07:00
Andrew FerlitschandGitHub bfdfaab38c Update README.md 2022-04-01 16:11:28 -07:00
Andrew FerlitschandGitHub 21a5963f84 feat: notebook for tf serving functions (#438)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* feat: add get started with TF serving functions

* feat: add get started with TF serving functions
2022-04-01 16:09:39 -07:00
9452249dce Added a new section called "Grant Dataproc roles to the Service Account" (#433)
* Ml ops 7v2 (#429)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* Update README.md

* Add files via upload

* Update README.md

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* Delete stage6c.png

* Add files via upload

* Delete stage6b.png

* feat: new notebook on endpoints (#430)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* wrong location

* Create README.md

* Update README.md

* Update README.md

* Update README.md

* Update README.md

* fix: links

* fix: title

* fix: example for reconfiguring the traffic split (#431)

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint

* Add section on granting Dataproc IAM roles.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@gmail.com>
Co-authored-by: Win Woo <wwoo@google.com>
2022-03-31 20:14:16 -07:00
Andrew FerlitschandGitHub 49a9df058f fix: example for reconfiguring the traffic split (#431)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue

* fix: reconfigure endpoint

* fix: reconfigure endpoint
2022-03-31 15:27:27 -07:00
Andrew FerlitschandGitHub f99b7e5d17 fix: title 2022-03-31 12:28:15 -07:00
Andrew FerlitschandGitHub ac03c57a94 fix: links 2022-03-31 12:27:47 -07:00
Andrew FerlitschandGitHub 2e4cf648c5 Update README.md 2022-03-31 12:27:01 -07:00
Andrew FerlitschandGitHub f000baa328 Update README.md 2022-03-31 12:26:35 -07:00
Andrew FerlitschandGitHub 113f89604a Update README.md 2022-03-31 12:26:01 -07:00
Andrew FerlitschandGitHub 5019a004ce Update README.md 2022-03-31 12:25:42 -07:00
Andrew FerlitschandGitHub a577f3844a Create README.md 2022-03-31 12:25:31 -07:00
Andrew FerlitschandGitHub 88c7f0f690 wrong location 2022-03-31 12:24:20 -07:00
Andrew FerlitschandGitHub a18792499a feat: new notebook on endpoints (#430)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: workaround for blocking issue

* update: workaround for blocking issue
2022-03-31 12:23:22 -07:00
Andrew FerlitschandGitHub 0b5fc8bb3c Delete stage6b.png 2022-03-30 19:34:52 -07:00
Andrew FerlitschandGitHub 1f77410fda Add files via upload 2022-03-30 19:34:31 -07:00
Andrew FerlitschandGitHub 45fb57f29c Delete stage6c.png 2022-03-30 19:34:11 -07:00
Andrew FerlitschandGitHub 3380b394eb Delete stage6b.png 2022-03-30 19:34:03 -07:00
Andrew FerlitschandGitHub 1286cc5044 Add files via upload 2022-03-30 19:33:20 -07:00
Andrew FerlitschandGitHub 1ce1af791c Delete stage6c.png 2022-03-30 19:31:24 -07:00
Andrew FerlitschandGitHub 2587e329ee Delete stage6b.png 2022-03-30 19:31:15 -07:00
Andrew FerlitschandGitHub 37d4816051 Update README.md 2022-03-30 19:30:19 -07:00
Andrew FerlitschandGitHub d9dff882b8 Add files via upload 2022-03-30 19:29:41 -07:00
Andrew FerlitschandGitHub 26cc2c5278 Update README.md 2022-03-30 19:21:49 -07:00
Andrew FerlitschandGitHub 69aff1bdc4 Ml ops 7v2 (#429)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:20:41 -07:00
Andrew FerlitschandGitHub 567994f2b1 fix: add missing details to objective in endpoint notebooks (#428)
* update: more details to objective on endpoint notebook

* update: more details to objective on endpoint notebook
2022-03-30 19:16:02 -07:00
Andrew FerlitschandGitHub e316c7b8aa Update README.md 2022-03-30 17:31:59 -07:00
Andrew FerlitschandGitHub c07a059a8b Update README.md 2022-03-30 17:30:46 -07:00
Andrew FerlitschandGitHub 7b4bbffc41 feat: add endpoint notebook (#427)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example

* feat: add endpoint notebook

* feat: add endpoint notebook
2022-03-30 15:44:54 -07:00
bdc011ef34 Made some minor changes to get_started_vertex_training_pytorch (#406)
* Added notebook

* Ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-30 08:21:22 -05:00
Andrew FerlitschandGitHub 44ea0d7c61 Update README.md 2022-03-28 17:00:01 -07:00
Andrew FerlitschandGitHub aa950e5ee4 feat: add TFHub model example (#422)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition

* feat: add TFHub model example

* feat: add TFHub model example
2022-03-28 16:57:04 -07:00
Andrew FerlitschandGitHub 247906e50e fix: WORKDIR in Dockerfile 2022-03-28 15:52:28 -07:00
81b2493a44 Made minor changes to get_started_vertex_training_r (#417)
* addd file

* modified file

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-28 13:26:54 -07:00
WhiteSource RenovateandGitHub 97b0edb222 chore(deps): update dependency black to v22.3.0 (#421) 2022-03-28 14:23:25 -05:00
sudarshan-SpringMLandGitHub f0a9e4b9fe added mlops folder to tested_folders file (#418) 2022-03-28 10:37:21 -05:00
Andrew FerlitschandGitHub f35bbcaec5 update: details on dsl.Condition (#415)
* feat: add data labeling notebook

* feat: add data labeling notebook

* update: details on dsl.Condition

* update: details on dsl.Condition
2022-03-26 09:51:01 -07:00
Andrew FerlitschandGitHub 2822061dc9 Update README.md 2022-03-25 16:00:46 -07:00
Andrew FerlitschandGitHub be481c8d17 feat: add data labeling notebook (#414)
* feat: add data labeling notebook

* feat: add data labeling notebook
2022-03-25 15:56:22 -07:00
Andrew FerlitschandGitHub 605a972122 fix: testing issues (#413)
* fix: testing issues

* fix: testing issues
2022-03-25 13:26:53 -07:00
Andrew FerlitschandGitHub 66d98d9fe7 fix: testing issues (#412)
* fix: test failures

* fix: test failures
2022-03-25 10:58:39 -07:00
Krishna Chaitanya MovvaandGitHub 6445ed37c9 Updates the Mlops/stage2/ get-started-vertex-experiments notebook in the community folder (#410)
* updates the get-started-vertex-experiments notebook in the community folder

* ran linter test

* adds the costs section

* ran linter test
2022-03-25 10:52:21 -05:00
Andrew FerlitschandGitHub ca745aeee8 fix: better cleanup (#407)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook

* fix: better cleanup

* fix: better cleanup
2022-03-24 18:58:43 -07:00
f806b4927b Adds updated Mlops/stage1/get-started-bq notebook to the community folder (#392)
* adds the updated mlops-stage1-get_started_bq_datasets notebook to the official branch and removes it from the community branch

* removes second instance of create_bigquery_dataset() function

* ran linter test successfully

* adds costs section

* ran linter test successfully

* updates the dependency installation step and GCS bucket explanation

* ran linter test

* adds pyarrow to the installations

* ran linter test

* removes unnecessary installations + adds silent install + moves the notebook back from official to community folder + adds IS_TESTING condition during clean-up

* ran linter test

* resolves the move up?? comment and builtin comment

* ran linter test

* updates textual content about package installation

* ran linter test

* resolves the future-tense and  dependency installations comments

* ran linter test

* updates the header according to template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:51 -05:00
2942eb5d7f minor changes on Sdk automl tabular regression online bq1 (#369)
* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* add automl tabular regression online bq with minor changes

* Run Linter

* Fix errors from the CLA test

* run linter

* resolve issue.

* run Linter

* Merge

* test lint

* fix for linter test

* Fix Bucket name variable

* run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:16:30 -05:00
2a5d6650ee Adds updated Mlops/stage2/get-started-bqml-training notebook to the community folder (#397)
* adds the ml_ops/stage2/get_Started_bqml_training notebook to official and removes the same from community folder

* ran linter test

* updates the textual content

* ran linter test

* moves the updated stage2/get-started-bqml notebook back to the communit folder

* ran linter test

* updates the header according to the template

* ran linter test

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-24 14:11:01 -05:00
Andrew FerlitschandGitHub 43e971f57a Update README.md 2022-03-24 11:38:17 -07:00
Andrew FerlitschandGitHub 785779613b feat: add dataproc notebook (#405)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline

* feat: add dataproc notebook

* feat: add dataproc notebook
2022-03-23 15:43:53 -07:00
Andrew FerlitschandGitHub 481193f0ca cleanup: delete created resources in the pipeline (#404)
* update: for official

* update: for official

* cleanup: add deleting model/endpoint created from pipeline

* cleanup: add deleting model/endpoint created from pipeline
2022-03-23 14:06:58 -07:00
Karl WeinmeisterandGitHub 2cb3cccd14 Fix: Linting issues in two tower notebook (#402) 2022-03-22 16:08:12 -05:00
7c16766994 minor changes in sdk automl image object detection batch (#370)
* Add minor changes to automl image object detection

* run linter

* Correct the milli nodes hours

* fix errors

* fix getenv

* Run linter

* remove tabular notebook, wrongly added

* Correct the bucket varible and minor changes to text

* Run linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-03-22 13:18:27 -07:00
Andrew FerlitschandGitHub 448d18deca update: for official (#401)
* update: for official

* update: for official
2022-03-22 09:26:34 -07:00
97022b0733 Feat: Add Pluto on Workbench tutorial (#399)
* Initial commit

* Undo master commit

* Initial commit

* Update CODEOWNERS

* Add links to resolve PR comments

Co-authored-by: Ward K Harold <wkh@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 10:10:46 -05:00
c2a3e2d4cd deprecate: gapic XAI notebooks replaced by SDK notebooks (#394)
* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

* deprecate: replaced by SDK notebook

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-22 09:46:47 -05:00
manuelamunateguiandGitHub b2dfcf17c8 E2E ML on GCP: MLOps stage 2 : experimentation: get started with Vertex Training for Scikit-Learn (#398)
* notebook refresh

* linter test after refresh
2022-03-22 09:37:09 -05:00
Andrew FerlitschandGitHub d061f09281 fix: replace os.environ with os.getenv - 2nd batch (#396)
* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv

* fix: replace os.environ with os.getenv
2022-03-19 12:02:47 -05:00
daa64efd40 fix: replace os.environ with os.getenv (#393)
* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

* fix: use os.getenv()

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-18 16:44:34 -05:00
Andrew FerlitschandGitHub a37deabe27 Update README.md 2022-03-18 13:15:34 -07:00
Andrew FerlitschandGitHub 6009ef0def Update README.md 2022-03-18 13:14:34 -07:00
Andrew FerlitschandGitHub edc644b0d0 Update README.md 2022-03-18 13:13:15 -07:00
Andrew FerlitschandGitHub 1297af8baf Create README.md 2022-03-18 13:11:38 -07:00
Andrew FerlitschandGitHub b8b1b6675b Update README.md 2022-03-18 13:09:51 -07:00
Andrew FerlitschandGitHub 7d3b7abc44 fix: review updates (#395)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl

* review: edits per Erwin review

* review: edits per Erwin review
2022-03-18 12:09:53 -07:00
Rajesh ThallamandGitHub 9a572f298e [community-content] Notebook to demo NVIDIA Triton Inference Server on Vertex AI Prediction (#391)
* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction official notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Add NVIDIA Triton on Vertex AI Prediction community notebook

* Fixes based on feedback to NVIDIA Triton on Vertex AI Prediction community notebook
2022-03-18 11:31:01 -05:00
b53ca9e678 Tabnet (#375)
* Start a new branch for TabNet tutorial.

* Clean version Created using Colaboratory

* Created using Colaboratory

* Remove unused import

* format lint

* Remove unused import

* Created using Colaboratory

* Remove unused import

* Fix the first iteration of reviewing except the image location

* add import

* Update the image to vertex

* Force delete the BQ to avoid waiting

* Add codeowner for TabNet

* Remove - from folder name

Co-authored-by: Long Le <longtle@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-17 17:20:01 -05:00
Andrew FerlitschandGitHub 9aceec161a Update README.md 2022-03-17 14:50:24 -07:00
Andrew FerlitschandGitHub 98b186ed55 feat: notebook for bqml+automl combined (#390)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook

* feat: notebook for bqml+automl

* feat: notebook for bqml+automl
2022-03-17 14:46:29 -07:00
sudarshan-SpringMLandGitHub f23ee1b5a8 Made small changes to Get started vertex vizier notebook (#389)
* modified notebook

* ran linter test

* modified notebook changed copyright licence year

* ran linter test
2022-03-17 10:03:19 -05:00
c6d779f1fc Featurestore colab update (#387)
* update featurestore colab comment

* delete some changes

* delete some changes 2

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-16 21:31:22 -05:00
Andrew FerlitschandGitHub 8908b27b08 feat: finish CPR notebook (#388)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: finalize CPR notebook

* feat: finalize CPR notebook
2022-03-16 14:00:03 -07:00
Andrew FerlitschandGitHub 8947c9b116 feat: more CPR (#385)
* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook

* feat: add CPR notebook
2022-03-15 11:56:29 -07:00
Andrew FerlitschandGitHub 9464caac6e Update README.md 2022-03-14 17:40:15 -07:00
Andrew FerlitschandGitHub 98ce91c575 feat: add CPR notebook (#384)
* feat: add CPR notebook

* feat: add CPR notebook
2022-03-14 17:38:47 -07:00
Andrew FerlitschandGitHub 07f8feda3d Update README.md 2022-03-14 11:19:31 -07:00
Andrew FerlitschandGitHub a4e0496ff5 feat: CMEK training (#383)
* feat: add FS from panda

* feat: add FS from panda

* feat: add CMEK example

* feat: add CMEK example
2022-03-14 11:15:35 -07:00
cf162c02c8 chore(deps): update dependency pyupgrade to v2.31.1 (#381)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:34:58 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
831aae94df build(deps): bump pillow (#378)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:33:36 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
3fd9f28778 build(deps): bump pillow (#379)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-14 09:32:20 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a656e8e2a8 build(deps): bump pillow (#380)
Bumps [pillow](https://github.com/python-pillow/Pillow) from 9.0.0 to 9.0.1.
- [Release notes](https://github.com/python-pillow/Pillow/releases)
- [Changelog](https://github.com/python-pillow/Pillow/blob/main/CHANGES.rst)
- [Commits](https://github.com/python-pillow/Pillow/compare/9.0.0...9.0.1)

---
updated-dependencies:
- dependency-name: pillow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-03-14 09:30:19 -05:00
Morgan DuandGitHub 2f02152703 fix: pip install google-cloud-aiplatform (#376) 2022-03-10 12:00:08 -06:00
9d08f8ce67 Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components (#372)
* Using BQML 1st-party components and 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML 1st-party components and upgrading to 1.0.0 of google-cloud-pipeline-components

* Using BQML components and upgrade to 1.0.0 of GCPC

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:34:12 -06:00
ec6d508793 adds automl-text-sentiment-analysis-online notebook (#293)
* adds automl-text-sentiment-analysis-online notebook

* adds the cleaned up automl-text-sentiment-analysis notebook after running linter test

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* adds textual content on what the dataset predicts in the dataset section

* ran the linter test after the update

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* deletes the source file from the community/sdk folder

* updates the colab, git & workbench links in the notebook

* ran linter test

* updates the license year to 2022 and simplifies the clean-up step for bucket-deletion

* ran linter test

* adds TESTING env condition while deleting the buckets

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-09 13:09:10 -06:00
WhiteSource RenovateandGitHub 772e35ea75 chore(deps): update dependency nbqa to v1.3.1 (#374) 2022-03-09 08:24:16 -06:00
Andrew FerlitschandGitHub 1d28f886c8 feat: add example of FS values from dataframe (#373)
* feat: add FS from panda

* feat: add FS from panda
2022-03-08 17:44:59 -08:00
Andrew FerlitschandGitHub d3dc8aeb9a fix: missing create dataset schema (#371)
* fix: missing dataset create

* fix: missing dataset create
2022-03-07 11:53:39 -08:00
WhiteSource RenovateandGitHub a07d762934 chore(deps): update dependency nbqa to v1.3.0 (#368) 2022-03-07 09:53:42 -06:00
Andrew FerlitschandGitHub 85ac9e127d update: v1 (#366)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* update: v1

* update: v1
2022-03-04 17:47:56 -08:00
Gal ZahaviandGitHub 011c2823ff Update CODEOWNERS (#361) 2022-03-04 22:43:10 +02:00
Karl WeinmeisterandGitHub f28a94f03f docs: Add visualization of repo structure to README.md (#364) 2022-03-04 12:46:26 -06:00
5ecfc80cb9 Adds minor changes(license year and clean-up step) to Sdk automl video action recognition batch notebook (#355)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

* updates the license year to 2022 and simplifies the lean-up step for bucket created

* ran linter test

* removes the file from the community folder

* adds the TESTING env condition while deleting the buckets

* ran linter test successfully

* adds TESTING env condition while deleting the bucket

* ran linter test successfully

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-04 12:44:39 -06:00
Andrew FerlitschandGitHub e5e36ba050 fix: upgrades to v1 (#360)
* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 20:05:36 -08:00
Andrew FerlitschandGitHub 0ad9116d6a fix: v1 upgrades (#359)
* fix: v1 upgrades

* fix: v1 upgrades
2022-03-03 17:49:45 -08:00
0516032443 Update CODEOWNERS (#354)
* Update CODEOWNERS

* Update CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:23:19 -06:00
95d211c90f Fixing minor issues in sdk_automl_text_entity_extraction_online.ipynb (#329)
* modified colab,github,vertexAI links and added vertex logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:17:48 -06:00
12d6a75ef7 Fixing minor issues in sdk_automl_video_object_tracking_batch.ipynb (#328)
* changed master to main for links and added vertex AI logo

* ran linter

* resolved comments

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-03-03 10:07:50 -06:00
Andrew FerlitschandGitHub 06153dc373 Update README.md 2022-03-02 11:45:01 -08:00
Andrew FerlitschandGitHub 02afa91fc3 Ml ops 6v3 (#352)
* fix: eval comp improvement

* fix: eval comp improvement

* feat: add to KFP get started
2022-03-02 10:38:42 -08:00
Karl WeinmeisterandGitHub c8b212789f Revert "ci: Apply filter to format_and_lint_job (#348)" (#351)
This reverts commit 95256d3fcf.
2022-03-02 09:44:03 -06:00
Karl WeinmeisterandGitHub 95256d3fcf ci: Apply filter to format_and_lint_job (#348)
* ci: Apply filter to format_and_lint_job

Only run when PR contains a notebook file

* Minor fix
2022-03-02 09:29:38 -06:00
Karl WeinmeisterandGitHub 8a6d174c99 Create README.md for notebooks folder 2022-03-01 19:44:41 -06:00
WhiteSource RenovateandGitHub d36cf7f662 chore(deps): update actions/setup-python action to v3 (#337) 2022-03-01 19:04:32 -06:00
WhiteSource RenovateandGitHub 1b02a542c8 chore(deps): update actions/checkout action to v3 (#347) 2022-03-01 19:02:39 -06:00
Ivan CheungandGitHub 45430bb010 Fixed minor issues (#345) 2022-03-01 14:56:50 -06:00
Ivan CheungandGitHub be2a139ade Delete notebooks/community/feature_store/assets directory 2022-02-28 20:21:17 -05:00
70d77b24f6 feature store e2e with assets (#343)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)

* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>

* Added files in their old folder

* Deleted unneeded file

* Ran linter

* Fixed CODEOWNERS

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-28 19:23:15 -05:00
Ivan CheungandGitHub 50c25d6d7b Revert "A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)" (#338)
This reverts commit 5bcdc0bc64.
2022-02-28 11:01:39 -05:00
5bcdc0bc64 A notebook that shows Vertex AI feature store capabilities in a real-world scenario (#296)
* A notebook that shows Vertex AI feature store capabilities in a real-world scenario

* new notebook version

* fix CODEOWNERS

* comment to the feature store monitoring api

* format notebook

* fix CODEOWNERS

* fix CODEOWNERS as required

* new version

* new notebook version

* notebook cleaning

* new update

* add fix to pass lint test

* resolve conflict

* import libraries fix

* update image

* update notebook

* fix comment

* new notebook version

* new notebook and assets

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-28 07:47:26 -08:00
eff0f95b58 Automl links fix (#330)
* fixing links to open notebook - main and images

* linter test changes

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:57:25 -06:00
50b53d31bd Jfacevedo endpoints tfhub obj detect (#319)
* Deploying TF Hub object detection model using Vertex endpoints

* Add user to codeowners

* fix path in CODEOWNERS

* clear all outputs

* run linter

* manual lint fix

* fix more linting errors

* order imports in alphabetical order

* run linter

* made changes requested on feedback

* automate fetching endpoint model id

* fix hardcoded value in bash command

* generalize region endpoint and project in bash cell

* retrieve endpoint and model ids programatically

* fix formatting

* run linter

* Remove pipfile

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-27 15:55:54 -06:00
Andrew FerlitschandGitHub b5a56852f3 fix: automl eval component improvement (#333)
* fix: eval comp improvement

* fix: eval comp improvement
2022-02-25 12:07:06 -08:00
b7486e34ad Sdk automl video action recognition batch (#310)
* adds the automl-video-action-recognition-notebook

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* fixes the dag variable by replacing with job

* ran linter test

* corrects the IMPORT_FILE parameter in the notebook

* ran linter test after update

* updates the colab, git & vertex-ai links

* ran linter test

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 11:31:19 -06:00
3edc5f1425 Notebook template (#326)
* modified vertex AI link

* minor change

* changed master to main and added vertex logo

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-25 10:16:34 -06:00
65b4b73cb5 Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook (#288)
* Add google_cloud_pipeline_components_model_upload_predict_evaluate notebook.ipynb

* format with linter

* add import for tensorflow when in the testing environment

* linter

* fix dependency issues for testing env

* address comments

* eval component  does not output gcp_resources yet, still in experimental

* added location to aip.init

* add deletion for model and batch prediction jobs

* typo, missed a comma.

* linter

* Remove tensorflow import + use gsutil to check if artifacts exist.

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 15:36:35 -08:00
Ivan CheungandGitHub 186c08e8c3 Update sdk_matching_engine_for_indexing.ipynb 2022-02-24 17:47:53 -05:00
Ivan CheungandGitHub 7721aa0def Added matching engine with SDK notebook (#327)
* Matching engine

* Added notebook

* Updated CODEOWNERS

* Fixed links

* Added logo

* Renamed Workbench
2022-02-24 14:57:16 -05:00
4987c60e03 updating gcloud usage because a flag was renamed (#320)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-24 09:33:33 -06:00
Andrew FerlitschandGitHub cd845f7fdd feat: start on model eval notebook (#325)
* fix: bqml export format

* fix: bqml export format

* feat: start on custom model eval

* feat: start on custom model eval
2022-02-23 12:56:01 -08:00
Andrew FerlitschandGitHub 9e84d9e782 fix: bqml doc for exporting model (#324)
* fix: bqml export format

* fix: bqml export format
2022-02-23 12:44:43 -08:00
nayaknishantandGitHub 23c7fcc97f fix: changed bucket URL from pantheon to console (#323)
* moving REGION up

* moving REGION up and csv file name

* fix: changed bucket URL to console
2022-02-23 13:17:12 -06:00
e4024efbc7 feat: add community notebook for Vertex AI SDK Feature Store with Pandas (#311)
* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* feat: add sdk-feature-store-pandas notebook

* fix: add ldap to codeowners

* fix: lint

* fix: addressed feedback

* fix: format

* fix: lint

* Linted

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: ivanmkc <ivans.mailbox@gmail.com>
2022-02-23 10:22:28 -08:00
Ivan CheungandGitHub c4d53108af Matching Engine: Updated location for data (#322)
Switched to gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5
2022-02-23 12:03:48 -05:00
be8fe3564d Sdk automl video classification batch (#295)
* notebook refresh from vertex ai sdk project batch 1

* successfully ran linter test

* removed global variable import file

* update with linter test changes

* removing community version of dk_automl_video_classification_batch.ipynb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:11:42 -08:00
1f95775057 Sdk automl text entity extraction online (#283)
* added notebook

* ran linter

* fix aip not defined error

* ran lint

* resolved git comments

* ran linter

* deleted file in community folder and removed globals

* ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-22 21:07:55 -08:00
f2a4dd875e Sdk automl video object tracking batch (#281)
* added notebook

* changed folder

* reinstalled linter

* ran linter

* pulled new changes and merged

* resolved comments

* resolved comments

* ran linter

* deleted file in community folder and removed globals in file

* ran linter

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-22 21:06:52 -08:00
Aaron DietzandGitHub 67dd2300c8 updating text (#309) 2022-02-22 17:17:00 -05:00
Aaron DietzandGitHub b5391b06b4 Pricing optimization update (#308)
* updating text

* rename

* rename
2022-02-22 17:13:16 -05:00
Aaron DietzandGitHub 54f2c71c13 updating text (#307) 2022-02-22 16:51:54 -05:00
Aaron DietzandGitHub 6697900126 updating text (#306) 2022-02-22 16:39:46 -05:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
9ff3400b44 build(deps): bump tensorflow (#316)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.0 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.0...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 13:01:06 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
3ff0726ebf build(deps): bump tensorflow (#315)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-18 08:54:19 -06:00
Amy WuandGitHub c96c939dfe Fix RL samples (#270)
* Update step_by_step sample

* Update mlops sample and fix worker_pool_specs issue for thr trainer component

* Fix lint

* Fix lint

* Fix lint

* Fix import order

* Fix nbfmt

* Update component.yaml

* Format notebook

* Update component.yaml url

* Lint
2022-02-17 16:37:52 -08:00
719cf280c9 Updating markdown text to meet higher standard (#305)
* Updating markdown text to meet higher standard

* formatted nb

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-17 17:45:15 -06:00
4ec6e2df04 [community-content] PyTorch on Google Cloud Vertex AI - Fixes based on feedback (#290)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

* PyTorch on Vertex - fixes based on review

* PyTorch on Vertex - linter fixes

* PyTorch on Vertex - fixes based on feedback

* PyTorch on Vertex - fixes based on feedback

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 17:41:48 -06:00
031a9190c3 automl-tabular-classification.ipynb: Added missing code and removed unneeded text (#255)
* Added missing code and removed unneeded text

* Ran linter

* Ran linter

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-17 08:03:16 -08:00
5204dcf327 update training and batch predict notebook with importer (#303)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:56 -08:00
cad623ef84 update hp tuning sample to use importer (#302)
* update hp tuning sample to use importer

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

* Update get_started_with_hpt_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:16:23 -08:00
a59f58f8b6 Use importer for the bqml (#299)
* Use importer for the bqml

* Update get_started_with_bqml_pipeline_components.ipynb

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 18:00:44 -08:00
nayaknishantandGitHub d89c613f5d moving REGION up (#300)
* moving REGION up

* moving REGION up and csv file name
2022-02-16 17:11:46 -08:00
Andrew FerlitschandGitHub fa265ddb2f feat: fix for sklearn XAI (#301)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1

* fix: XAI for sklearn

* fix: XAI for sklearn
2022-02-16 17:00:16 -08:00
ec3dd04935 SDK Featurestore notebook (#284)
* SDK Featurestore notebook

* fixed issues, tried to make notebook more readable, style

* removed previous notebook

* moved sdk-feature-store to community (for now)

* made fixes

* moved BQ output table cells down

Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Morgan Du <morgandu@google.com>
2022-02-16 16:04:43 -08:00
Andrew FerlitschandGitHub 0c83e81410 fix: 0.3.0 breaking change 2022-02-16 14:13:57 -08:00
Andrew FerlitschandGitHub 7808a843cc fix: breaking 0.3.0 change 2022-02-16 14:02:36 -08:00
Andrew FerlitschandGitHub 615d7706af fix: breaking change in 0.3.0 2022-02-16 13:53:35 -08:00
Ivan CheungandGitHub f05ca4d06a Added project to BQ client instantiation (#285) 2022-02-16 16:27:08 -05:00
Andrew FerlitschandGitHub cb4145e2b6 test: fix for testing (#298)
* test: fixes for testing

* test: fixes for testing
2022-02-16 11:23:45 -08:00
6917c9aa7b adding initial sample notebook for Tensorboard (#286)
Co-authored-by: Yicheng Fang <yichengfang@google.com>
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
2022-02-16 09:45:01 -08:00
Andrew FerlitschandGitHub c1d2451656 feat: update to v1 (#294)
* feat: update to v1

* feat: update to v1

* feat: update to v1

* feat: update to v1
2022-02-16 09:35:41 -08:00
Ivan CheungandGitHub c41ec1fabd Cleaned up cleanup section (#291) 2022-02-16 10:28:42 -05:00
Ivan CheungandGitHub 273c91882e Delete setup_env.md 2022-02-15 20:45:06 -05:00
Ivan CheungandGitHub ad6b5e5830 Update test_notebook_vm.txt 2022-02-15 18:17:11 -05:00
Ivan CheungandGitHub d441eb9d7a Update test_notebook_vm.txt 2022-02-15 18:14:37 -05:00
Andrew FerlitschandGitHub 139d805c9f feat: update to v1 (#292)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK

* feat: update to v1

* feat: update to v1
2022-02-15 11:20:22 -08:00
Andrew FerlitschandGitHub 783347fc8e feat: update FS notebook to use SDK (#287)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example

* feat: upgrade FS to SDK

* feat: upgrade FS to SDK
2022-02-14 13:21:28 -08:00
6d722d081d Fix links (#274)
* Fixes and renames link to launch automl-text-classification.pynb in Vertex AI Workbench

* Fixes and renames link to launch sdk_automl_tabular_forecasting_batch.pynb in Vertex AI Workbench

* Fixes links for launching notebook in Vertex AI Workbench for Explainable AI samples

* Fixes link for launching notebook in Vertex AI Workbench for model monitoring sample

* Fixes links to launch pipelines notebook samples

* Fixed lint problem in automl-text-classification.ipynb

* Autofixed lint errors

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-14 11:48:41 -05:00
Andrew FerlitschandGitHub 33a8c6ca0e feat: add create component example (#279)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn

* feat: add covert component example

* feat: add covert component example
2022-02-10 14:23:22 -08:00
Karl WeinmeisterandGitHub ae043400f5 Add survey to README.md (#272) 2022-02-10 14:52:33 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
e41f96b31f build(deps): bump tensorflow (#275)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:37:36 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
7220f15158 build(deps): bump tensorflow (#276)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:33:59 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>Karl Weinmeister
b8d7eaa767 build(deps): bump tensorflow (#278)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-10 09:31:20 -06:00
dependabot[bot]GitHubdependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
a612b463a8 build(deps): bump tensorflow (#277)
Bumps [tensorflow](https://github.com/tensorflow/tensorflow) from 2.5.2 to 2.5.3.
- [Release notes](https://github.com/tensorflow/tensorflow/releases)
- [Changelog](https://github.com/tensorflow/tensorflow/blob/master/RELEASE.md)
- [Commits](https://github.com/tensorflow/tensorflow/compare/v2.5.2...v2.5.3)

---
updated-dependencies:
- dependency-name: tensorflow
  dependency-type: direct:production
...

Signed-off-by: dependabot[bot] <support@github.com>

Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2022-02-10 09:16:10 -06:00
Andrew FerlitschandGitHub 493e7e81b5 Update README.md 2022-02-09 10:19:58 -08:00
Andrew FerlitschandGitHub b6cf0dbefd feat: XAI with sklearn (#273)
* feat: get started XAI

* feat: get started XAI

* feat: XAI with sklearn

* feat: XAI with sklearn
2022-02-09 10:17:16 -08:00
Brian KangandGitHub 5d5c08f9e7 Pytorch lightning sdk example - Missed Notebook added (#269)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Added Notebook for PyTorch lightning distributed training of a ResNet model

* Notebook updates after review

* Notebook updates after review

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Revert "Adjust Tensorboard to TensorBoard"

This reverts commit 9aac52e358b4ccc27a9a5a9e3bc5ef3305553462.

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard

* Adjust Tensorboard to TensorBoard and and run lint
2022-02-08 16:36:30 -08:00
Andrew FerlitschandGitHub bfdfac0f81 feat: XAI notebook (#271)
* feat: get started XAI

* feat: get started XAI
2022-02-08 14:13:05 -08:00
Andrew FerlitschandGitHub 9c72b7e3e7 Update README.md 2022-02-08 12:57:22 -08:00
Andrew FerlitschandGitHub 46519e5c64 Update README.md 2022-02-08 12:26:57 -08:00
Brian KangandGitHub 0ff961e203 Pytorch lightning sdk example (#268)
* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit bcbe832c51.

* Added example for PyTorch lightning distributed training of a ResNet model

* Revert "Added example for PyTorch lightning distributed training of a ResNet model"

This reverts commit 2a792cb7ac.

* Added example for PyTorch lightning distributed training of a ResNet model
2022-02-07 17:36:40 -08:00
Andrew FerlitschandGitHub cbc17c6832 feat: use gcsfuse (#265)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU

* feat: use gcsfuse

* feat: use gcsfuse
2022-02-04 11:17:51 -08:00
Andrew FerlitschandGitHub 93e5b15cba Update README.md 2022-02-04 11:09:31 -08:00
Andrew FerlitschandGitHub 081e65d076 Update README.md 2022-02-04 10:09:45 -08:00
Ivan CheungandGitHub 4ab2cfb713 feat: Added test_notebook_vm.txt to only test fast-running notebooks. Also fix private_pool not being used for tests. (#248)
* feat: Added test_notebook_vm.txt

* Propagate private pool to child builds

* Fixed workerpool issue

* Removed private pool requirement

* Added default pool

* Fixed private pool region issue

* Added comment

* Made private_pool_id arg optionally present

* Fixed when private pool is optional

* Fix regional issue bug

* Fixed pandas requirement

* Removed flaky notebook
2022-02-03 15:48:40 -05:00
Andrew FerlitschandGitHub a73335c0af feat: add batch and TPU (#262)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling

* feat: add batch and TPU

* feat: add batch and TPU
2022-02-02 17:45:31 -08:00
0f3e257773 Pricingoptimization (#249)
* added notebook

* ran lint

* updated main

* ran lint

Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-02 13:25:41 -05:00
Andrew FerlitschandGitHub 57d734d84f fix: spelling (#260)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook

* fix: spelling

* fix: spelling
2022-02-01 17:07:10 -08:00
Andrew FerlitschandGitHub 07f2e9c999 Update README.md 2022-02-01 12:15:31 -08:00
Andrew FerlitschandGitHub 401883cae3 feat: add R notebook (#259)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook

* feat: add R notebook

* feat: add R notebook
2022-02-01 12:11:26 -08:00
7bc92e1e3c Update google_cloud_pipeline_components_automl_images.ipynb (#252)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-02-01 13:33:22 -06:00
de5f8b0653 Removed unneeded lines in linter (#257)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-02-01 12:19:19 -05:00
cfa73ed53b chore(deps): update dependency black to v22 (#254)
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-31 13:50:57 -06:00
Andrew FerlitschandGitHub 67370bb1c7 Update README.md 2022-01-31 10:39:28 -08:00
Andrew FerlitschandGitHub f60593255a feat: add Pytorch notebook (#256)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML

* feat: add Pytorch notebook

* feat: add Pytorch notebook
2022-01-31 10:38:28 -08:00
Andrew FerlitschandGitHub c6f9b97615 test: rm caching of components (#247)
* fix: testing

* fix: testing

* fix: not installing pandas
2022-01-31 13:33:18 -05:00
Andrew FerlitschandGitHub 6161a394c2 fix: predict on exported BQML model (#250)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training

* fix: predict on exported BQML

* fix: predict on exported BQML
2022-01-27 10:35:20 -08:00
ivanmkc b35cd42015 Added exception check for deletion method 2022-01-27 11:54:29 -05:00
Ivan CheungandGitHub 5e323993db [WIP] Relax requirements for DLVM's (#238)
* Update requirements.txt

* Relax all CI requirements
2022-01-26 16:47:09 -05:00
Andrew FerlitschandGitHub f1623e419e Update README.md 2022-01-26 12:10:16 -08:00
Andrew FerlitschandGitHub a3047fb1bb feat: xgboost notebook (#246)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn

* feat: xgb training

* feat: xgb training
2022-01-26 12:09:07 -08:00
Karl WeinmeisterandGitHub b4d02f486e Update CODEOWNERS with new community blog post (#244) 2022-01-26 09:16:48 -08:00
9e24893b9b feat: Add sentiment analysis notebook (#195)
* added notebook

* ran lint

* resolved comments

* ran lint

* resolved comments

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-26 08:56:40 -06:00
47dec6ecef chore(deps): update dependency pyupgrade to v2.31.0 (#241)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:53:32 -06:00
059fea672c chore(deps): update dependency nbqa to v1.2.3 (#240)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:49:47 -06:00
389e804426 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#236)
* PyTorch on Vertex - Updated to match GCPC v0.2.2 API

* PyTorch on Vertex - Fixes based on review comments

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-26 08:46:09 -06:00
Andrew FerlitschandGitHub 087a638c18 Update README.md 2022-01-25 22:16:55 -08:00
Andrew FerlitschandGitHub 97757c74ca feat: sklearn training (#243)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook

* feat: sklearn

* feat: sklearn
2022-01-25 22:15:51 -08:00
Andrew FerlitschandGitHub 08f3ad583b feat: finish hpt components notebook (#239)
* feat: friday update

* feat: friday update

* feat: hpt notebook

* feat: hpt notebook
2022-01-25 10:02:28 -08:00
Karl WeinmeisterandGitHub 16f01d31d3 chore: Update notebook template license date to 2022 (#237)
* chore: Update notebook template license date to 2022

* chore: Add extra space to address lint error
2022-01-25 11:20:00 -06:00
e0f6c66351 chore(deps): update dependency pandas to v1.4.0 (#233)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-24 13:58:50 -06:00
Ivan CheungandGitHub 3733b28772 Updated requirements (#235) 2022-01-24 14:54:31 -05:00
24f8912134 feat: Add inventory prediction notebook (#216)
* made changes

* made changes

* ran lint

Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
Co-authored-by: Ivan Cheung <ivans.mailbox@gmail.com>
2022-01-24 14:07:42 -05:00
WhiteSource RenovateandGitHub cdc8847f9b chore(deps): update dependency papermill to v2.3.4 (#234) 2022-01-24 10:46:31 -06:00
Andrew FerlitschandGitHub 25bd4b9eb5 Update README.md 2022-01-21 19:05:35 -08:00
Andrew FerlitschandGitHub d476191252 feat: add notebooks (#232)
* feat: friday update

* feat: friday update
2022-01-21 17:14:31 -08:00
nicainandGitHub bf35d6a07c Add metadata to hide cells (#226) 2022-01-21 14:57:24 -08:00
5378d38a05 chore(deps): update dependency ipython to v8.0.1 (#222)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-21 11:15:14 -06:00
Ivan CheungandGitHub 85984f1173 Fixed broken Colab link 2022-01-20 17:52:56 -05:00
Ivan CheungandGitHub 92bb40349f Cleaned up cloud build by renaming files and moving methods around (#219)
* Cleaned up cloud build

* Fixed bug

* More renaming and comment cleanup

* Added helper file

* Fixed missing return
2022-01-20 15:55:38 -05:00
Rajesh ThallamandGitHub fcee9bf738 [community-content] PyTorch on Google Cloud Vertex AI - Blog related notebook and scripts (#227)
* PyTorch on Vertex - Adding pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - Updating pipelines notebook, clearing outputs

* PyTorch on Vertex - Updating pipelines notebook

* PyTorch on Vertex - reverting serving Dockerfile changes

* PyTorch on Vertex - linting fixes

* PyTorch on Vertex - updates to README

* PyTorch on Vertex - linter related fixes
2022-01-20 13:20:00 -06:00
nicainandGitHub cc2f3408ad Update Run After --> Run Selected Cell and All Below (#228) 2022-01-20 08:07:31 -06:00
nicainandGitHub 89fb218041 Alphafold on gcp tutorial (#221)
* Original alphafold Dockerfile and notebook as a starting point

* Migrate dependencies from notebook into Dockerfile

* adding build_docker.sh script for building docker image

* remove cell, and replace with accelerator configuration cell. Also remove dependency on google.colab

* dockerfile remove redundant

* Changing text in launch button

* add vertexai.png

* update notebook, including permalink to vertexai.png

* updating notebook markdown and correcting the vertexai.png image display

* add div brackets and fix broken launch link

* table instead of div

* width=40

* resizing vertexai image

* updated FAQ

* updated Licence

* add back in the output_file zip

* launch button at top of notebook

* default workdir aligned with JuptyerLab home directory

* intro paragraph

* update CPU instructions

* exchange notebook title and launch header

* Dockerfile license

* collapsing cells

* splitting out sequences into un-collapsed cell

* Update licence

* update download instructions text

* Remove "double-click" text

* hide cells

* Increasing indent to pass linting for alphafold_on_gcp (#224)

* increasing indent to pass linting

* more linting

* wild

* AMBER relaxation f-string

* hidden cells

* wild commit

* move links to main
2022-01-19 18:47:21 -08:00
Andrew FerlitschandGitHub 4d0c3781e5 Update README.md 2022-01-19 12:30:01 -08:00
Andrew FerlitschandGitHub e2e319ac7f Update README.md 2022-01-19 11:08:55 -08:00
Andrew FerlitschandGitHub 63508cad3f feat: add ml metadata notebook (#223)
* weekly updates

* weekly updates

* feat: add metadata notebook

* feat: add metadata notebook
2022-01-19 10:58:03 -08:00
0b6eb6eed1 Updates to automl tabular beans pipeline (#220)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-18 15:34:57 -06:00
Polong LinandGitHub a41cfdeba5 Fix typo: Wikepedia --> Wikipedia (#217) 2022-01-18 08:28:04 -06:00
7a6763ca33 chore(deps): update dependency numpy to v1.22.1 (#214)
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 17:10:52 -06:00
Sara RobinsonandGitHub 2a6e19e4f9 Update MLMD notebook to use pipeline submit() method (#215) 2022-01-14 17:09:45 -06:00
9f9526b722 Delete Dockerfile (#198)
Co-authored-by: Andrew Ferlitsch <aferlitsch@google.com>
Co-authored-by: Karl Weinmeister <11586922+kweinmeister@users.noreply.github.com>
2022-01-14 14:28:30 -05:00
Ivan CheungandGitHub 267684b7c3 Added private pool to cloud build config (#211) 2022-01-14 14:27:34 -05:00
Andrew FerlitschandGitHub b74dd3d576 Update README.md 2022-01-13 16:22:14 -08:00
Andrew FerlitschandGitHub 278ae48842 Update README.md 2022-01-13 16:21:28 -08:00
Andrew FerlitschandGitHub 189ca12627 Update README.md 2022-01-13 16:20:39 -08:00
Andrew FerlitschandGitHub 5108f57ba8 feat: weekly updates (#212)
* weekly updates

* weekly updates
2022-01-13 16:19:21 -08:00
328 changed files with 1000324 additions and 25919 deletions
-194
View File
@@ -1,194 +0,0 @@
# Copyright 2020 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
# We want to use LTS ubuntu from our mirror because dockerhub has a
# rate limit.
# FROM mirror.gcr.io/library/ubuntu:18.04
# However, now the above image is not working, we're using our own cache
FROM gcr.io/cloud-devrel-kokoro-resources/ubuntu:20.04
ENV DEBIAN_FRONTEND noninteractive
# Ensure local Python is preferred over distribution Python.
ENV PATH /usr/local/bin:$PATH
# http://bugs.python.org/issue19846
# At the moment, setting "LANG=C" on a Linux system fundamentally breaks
# Python 3.
ENV LANG C.UTF-8
# Install dependencies.
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
apt-transport-https \
build-essential \
ca-certificates \
curl \
dirmngr \
git \
gcc \
gpg-agent \
graphviz \
libbz2-dev \
libdb5.3-dev \
libexpat1-dev \
libffi-dev \
liblzma-dev \
libmagickwand-dev \
libmemcached-dev \
libpython3-dev \
libreadline-dev \
libsnappy-dev \
libssl-dev \
libsqlite3-dev \
portaudio19-dev \
pkg-config \
redis-server \
software-properties-common \
ssh \
sudo \
systemd \
tcl \
tcl-dev \
tk \
tk-dev \
uuid-dev \
wget \
zlib1g-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install docker
RUN curl -fsSL https://download.docker.com/linux/ubuntu/gpg | sudo apt-key add -
RUN add-apt-repository \
"deb [arch=amd64] https://download.docker.com/linux/ubuntu \
$(lsb_release -cs) \
stable"
RUN apt-get update \
&& apt-get install -y --no-install-recommends \
docker-ce \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Bazel for compiling Tink in Cloud SQL Client Side Encryption Samples
# TODO: Delete this section once google/tink#483 is resolved
RUN apt install -y curl gpgconf gpg \
&& curl -fsSL https://bazel.build/bazel-release.pub.gpg | gpg --dearmor > bazel.gpg \
&& mv bazel.gpg /etc/apt/trusted.gpg.d/ \
&& echo "deb [arch=amd64] https://storage.googleapis.com/bazel-apt stable jdk1.8" | sudo tee /etc/apt/sources.list.d/bazel.list \
&& apt update && apt install -y bazel \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
# Install Microsoft ODBC 17 Driver and unixodbc for testing SQL Server samples
RUN curl https://packages.microsoft.com/keys/microsoft.asc | apt-key add - \
&& curl https://packages.microsoft.com/config/ubuntu/20.04/prod.list > /etc/apt/sources.list.d/mssql-release.list \
&& apt-get update \
&& ACCEPT_EULA=Y apt-get install -y --no-install-recommends \
msodbcsql17 \
unixodbc-dev \
&& apt-get clean autoclean \
&& apt-get autoremove -y \
&& rm -rf /var/lib/apt/lists/* \
&& rm -f /var/cache/apt/archives/*.deb
COPY fetch_gpg_keys.sh /tmp
# Install the desired versions of Python.
RUN set -ex \
&& export GNUPGHOME="$(mktemp -d)" \
&& echo "disable-ipv6" >> "${GNUPGHOME}/dirmngr.conf" \
&& /tmp/fetch_gpg_keys.sh \
&& for PYTHON_VERSION in 2.7.18 3.6.13 3.7.10 3.8.8 3.9.2; do \
wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz" \
&& wget --no-check-certificate -O python-${PYTHON_VERSION}.tar.xz.asc "https://www.python.org/ftp/python/${PYTHON_VERSION%%[a-z]*}/Python-$PYTHON_VERSION.tar.xz.asc" \
&& gpg --batch --verify python-${PYTHON_VERSION}.tar.xz.asc python-${PYTHON_VERSION}.tar.xz \
&& rm -r python-${PYTHON_VERSION}.tar.xz.asc \
&& mkdir -p /usr/src/python-${PYTHON_VERSION} \
&& tar -xJC /usr/src/python-${PYTHON_VERSION} --strip-components=1 -f python-${PYTHON_VERSION}.tar.xz \
&& rm python-${PYTHON_VERSION}.tar.xz \
&& cd /usr/src/python-${PYTHON_VERSION} \
&& ./configure \
--enable-shared \
# This works only on Python 2.7 and throws a warning on every other
# version, but seems otherwise harmless.
--enable-unicode=ucs4 \
--with-system-ffi \
--without-ensurepip \
&& make -j$(nproc) \
&& make install \
&& ldconfig \
; done \
&& rm -rf "${GNUPGHOME}" \
&& rm -rf /usr/src/python* \
&& rm -rf ~/.cache/
# Install pip on Python 3.6 only.
# If the environment variable is called "PIP_VERSION", pip explodes with
# "ValueError: invalid truth value '<VERSION>'"
ENV PYTHON_PIP_VERSION 20.2.4
RUN wget --no-check-certificate -O /tmp/get-pip.py 'https://bootstrap.pypa.io/get-pip.py' \
&& python3.6 /tmp/get-pip.py "pip==$PYTHON_PIP_VERSION" \
# we use "--force-reinstall" for the case where the version of pip we're trying to install is the same as the version bundled with Python
# ("Requirement already up-to-date: pip==8.1.2 in /usr/local/lib/python3.6/site-packages")
# https://github.com/docker-library/python/pull/143#issuecomment-241032683
&& pip3 install --no-cache-dir --upgrade --force-reinstall "pip==$PYTHON_PIP_VERSION" \
# then we use "pip list" to ensure we don't have more than one pip version installed
# https://github.com/docker-library/python/pull/100
&& [ "$(pip list |tac|tac| awk -F '[ ()]+' '$1 == "pip" { print $2; exit }')" = "$PYTHON_PIP_VERSION" ]
# Ensure Pip for python3
RUN python3 /tmp/get-pip.py
RUN rm /tmp/get-pip.py
# Install "virtualenv", since the vast majority of users of this image
# will want it.
RUN pip install --no-cache-dir virtualenv
# Setup Cloud SDK
ENV CLOUD_SDK_VERSION 339.0.0
# Use system python for cloud sdk.
ENV CLOUDSDK_PYTHON python3.6
RUN wget https://dl.google.com/dl/cloudsdk/channels/rapid/downloads/google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN tar xzf google-cloud-sdk-$CLOUD_SDK_VERSION-linux-x86_64.tar.gz
RUN /google-cloud-sdk/install.sh
ENV PATH /google-cloud-sdk/bin:$PATH
# Enable redis-server on boot.
RUN sudo systemctl enable redis-server.service
# Create a user and allow sudo
# kbuilder uid on the default Kokoro image
ARG UID=1000
ARG USERNAME=kbuilder
# Add a new user to the container image.
# This is needed for ssh and sudo access.
# Add a new user with the caller's uid and the username.
RUN useradd -d /h -u ${UID} ${USERNAME}
# Allow nopasswd sudo
RUN echo "${USERNAME} ALL=(ALL) NOPASSWD:ALL" >> /etc/sudoers
CMD ["python3.6"]
@@ -1 +1,2 @@
ratemate
google-cloud-aiplatform
+17 -10
View File
@@ -1,11 +1,14 @@
from typing import List
from ratemate import RateLimit
from resource_cleanup_manager import (
ResourceCleanupManager,
DatasetResourceCleanupManager,
EndpointResourceCleanupManager,
ModelResourceCleanupManager,
EndpointResourceCleanupManager,
ResourceCleanupManager,
)
rate_limit = RateLimit(max_count=25, per=60, greedy=False)
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
for manager in managers:
@@ -15,14 +18,18 @@ def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: boo
resources = manager.list()
print(f"Found {len(resources)} {type_name}'s")
for resource in resources:
if not manager.is_deletable(resource):
continue
try:
if not manager.is_deletable(resource):
continue
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
manager.delete(resource)
if is_dry_run:
resource_name = manager.resource_name(resource)
print(f"Will delete '{type_name}': {resource_name}")
else:
rate_limit.wait() # wait before deleting
manager.delete(resource)
except Exception as exception:
print(exception)
print("")
@@ -36,7 +43,7 @@ if is_dry_run:
managers = [
DatasetResourceCleanupManager(),
EndpointResourceCleanupManager(),
ModelResourceCleanupManager(),
ModelResourceCleanupManager(), # ModelResourceCleanupManager must follow EndpointResourceCleanupManager due to deployed models blocking model deletion.
]
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
@@ -1,8 +1,9 @@
import abc
from typing import Any, Type
from google.cloud import aiplatform
from typing import Any
from proto.datetime_helpers import DatetimeWithNanoseconds
from google.cloud.aiplatform import base
from proto.datetime_helpers import DatetimeWithNanoseconds
# If a resource was updated within this number of seconds, do not delete.
RESOURCE_UPDATE_BUFFER_IN_SECONDS = 60 * 60 * 8
@@ -40,7 +41,7 @@ class ResourceCleanupManager(abc.ABC):
# Check that it wasn't created too recently, to prevent race conditions
if time_difference <= RESOURCE_UPDATE_BUFFER_IN_SECONDS:
print(
f"Skipping '{resource}' due update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
f"Skipping '{resource}' due to update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
)
return False
@@ -50,7 +51,7 @@ class ResourceCleanupManager(abc.ABC):
class VertexAIResourceCleanupManager(ResourceCleanupManager):
@property
@abc.abstractmethod
def vertex_ai_resource(self) -> base.VertexAiResourceNounWithFutureManager:
def vertex_ai_resource(self) -> Type[base.VertexAiResourceNounWithFutureManager]:
pass
@property
@@ -60,7 +61,9 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
def list(self) -> Any:
return self.vertex_ai_resource.list()
def resource_name(self, resource: Any) -> str:
def resource_name(
self, resource: Type[base.VertexAiResourceNounWithFutureManager]
) -> str:
return resource.display_name
def delete(self, resource):
@@ -74,12 +77,33 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
class DatasetResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.datasets._Dataset
dataset_types = [
aiplatform.ImageDataset,
aiplatform.TabularDataset,
aiplatform.TextDataset,
aiplatform.TimeSeriesDataset,
aiplatform.VideoDataset,
]
def list(self) -> Any:
return [
dataset
for dataset_type in self.dataset_types
for dataset in dataset_type.list()
]
class EndpointResourceCleanupManager(VertexAIResourceCleanupManager):
vertex_ai_resource = aiplatform.Endpoint
def delete(self, resource):
# TODO: Remove this once https://github.com/googleapis/python-aiplatform/issues/1441 is fixed
resource._sync_gca_resource()
for deployed_model_id in [
models.id for models in resource._gca_resource.deployed_models
]:
resource._undeploy(deployed_model_id=deployed_model_id)
resource.delete(force=True)
+130
View File
@@ -0,0 +1,130 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
import argparse
import pathlib
import execute_changed_notebooks_helper
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_service_account",
type=str,
help="A service account. This is used to inject a variable value into the notebook before running. This is not the account that will run the notebook.",
required=True,
)
parser.add_argument(
"--variable_vpc_network",
type=str,
help="The full VPC network name. See https://cloud.google.com/compute/docs/networks-and-firewalls#networks. Format is projects/{project}/global/networks/{network}, where {project} is a project number, as in '12345', and {network} is network name. See <https://cloud.google.com/compute/docs/reference/rest/v1/networks/insert> for details. This is used to inject a variable value into the notebook before running.",
required=False,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--timeout",
type=int,
help="Timeout in seconds",
default=86400,
required=False,
)
parser.add_argument(
"--private_pool_id",
type=str,
help="The private pool id.",
required=False,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
test_paths_file=args.test_paths_file,
base_branch=args.base_branch,
)
execute_changed_notebooks_helper.process_and_execute_notebooks(
notebooks=notebooks,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
should_parallelize=args.should_parallelize,
timeout=args.timeout,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
variable_service_account=args.variable_service_account,
variable_vpc_network=args.variable_vpc_network,
private_pool_id=args.private_pool_id,
)
@@ -13,34 +13,28 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import concurrent
import dataclasses
import datetime
import functools
import git
import operator
import os
import pathlib
import nbformat
import re
import subprocess
from typing import List, Optional
from tabulate import tabulate
import operator
import execute_notebook_helper
import execute_notebook_remote
from utils import util, NotebookProcessors
import nbformat
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
from ratemate import RateLimit
from tabulate import tabulate
from utils import NotebookProcessors, util
def str2bool(v):
if isinstance(v, bool):
return v
if v.lower() in ("yes", "true", "t", "y", "1"):
return True
elif v.lower() in ("no", "false", "f", "n", "0"):
return False
else:
raise argparse.ArgumentTypeError("Boolean value expected.")
# A buffer so that workers finish before the orchestrating job
WORKER_TIMEOUT_BUFFER_IN_SECONDS: int = 60 * 60
def format_timedelta(delta: datetime.timedelta) -> str:
@@ -74,11 +68,20 @@ class NotebookExecutionResult:
build_id: str
error_message: Optional[str]
@property
def output_uri_web(self) -> Optional[str]:
if self.output_uri.startswith("gs://"):
return f"https://storage.googleapis.com/{self.output_uri[5:]}"
else:
return None
def _process_notebook(
notebook_path: str,
variable_project_id: str,
variable_region: str,
variable_service_account: str,
variable_vpc_network: Optional[str],
):
# Read notebook
with open(notebook_path) as f:
@@ -90,6 +93,8 @@ def _process_notebook(
replacement_map={
"PROJECT_ID": variable_project_id,
"REGION": variable_region,
"SERVICE_ACCOUNT": variable_service_account,
"VPC_NETWORK": variable_vpc_network,
},
)
@@ -115,17 +120,33 @@ def _create_tag(filepath: str) -> str:
return tag
def execute_notebook(
rate_limit = RateLimit(max_count=50, per=60, greedy=True)
def process_and_execute_notebook(
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
variable_project_id: str,
variable_region: str,
variable_service_account: str,
variable_vpc_network: Optional[str],
private_pool_id: Optional[str],
deadline: datetime.datetime,
notebook: str,
should_get_tail_logs: bool = False,
) -> NotebookExecutionResult:
rate_limit.wait() # wait before creating the task
print(f"Running notebook: {notebook}")
# Handle empty strings
if not variable_vpc_network:
variable_vpc_network = None
if not private_pool_id:
private_pool_id = None
# Create paths
notebook_output_uri = "/".join([artifacts_bucket, pathlib.Path(notebook).name])
@@ -151,17 +172,27 @@ def execute_notebook(
notebook_path=notebook,
variable_project_id=variable_project_id,
variable_region=variable_region,
variable_service_account=variable_service_account,
variable_vpc_network=variable_vpc_network,
)
# Upload the pre-processed code to a GCS bucket
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
# Calculate timeout in seconds
timeout_in_seconds = max(
int((deadline - datetime.datetime.now()).total_seconds()), 1
)
operation = execute_notebook_remote.execute_notebook_remote(
code_archive_uri=code_archive_uri,
notebook_uri=notebook,
notebook_output_uri=notebook_output_uri,
container_uri=container_uri,
tag=tag,
private_pool_id=private_pool_id,
private_pool_region=variable_region,
timeout_in_seconds=timeout_in_seconds,
)
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
@@ -202,15 +233,77 @@ def execute_notebook(
return result
def run_changed_notebooks(
def get_changed_notebooks(
test_paths_file: str,
base_branch: Optional[str] = None,
) -> List[str]:
"""
Get the notebooks that exist under the folders defined in the test_paths_file.
It only returns notebooks that have differences from the Git base_branch.
"""
test_paths = []
with open(test_paths_file) as file:
lines = [line.strip() for line in file.readlines()]
lines = [line for line in lines if len(line) > 0]
test_paths = [line for line in lines]
if len(test_paths) == 0:
raise RuntimeError("No test folders found.")
print(f"Checking folders: {test_paths}")
# Find notebooks
notebooks = []
# Instantiate GitPython objects
repo = git.Repo(os.getcwd())
index = repo.index
if base_branch:
# Get the point at which this branch branches off from main
branching_commits = repo.merge_base("HEAD", f"origin/{base_branch}")
if len(branching_commits) > 0:
branching_commit = branching_commits[0]
print(f"Looking for notebooks that changed from branch: {branching_commit}")
notebooks = [
diff.b_path
for diff in index.diff(branching_commit, paths=test_paths)
if diff.b_path is not None
]
else:
notebooks = []
else:
print(f"Looking for all notebooks.")
notebooks_str = subprocess.check_output(["git", "ls-files"] + test_paths)
notebooks = notebooks_str.decode("utf-8").split("\n")
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
if len(notebooks) > 0:
print(f"Found {len(notebooks)} notebooks:")
for notebook in notebooks:
print(f"\t{notebook}")
return notebooks
def process_and_execute_notebooks(
notebooks: List[str],
container_uri: str,
staging_bucket: str,
artifacts_bucket: str,
should_parallelize: bool,
timeout: int,
variable_project_id: str,
variable_region: str,
should_parallelize: bool,
base_branch: Optional[str] = None,
variable_service_account: str,
variable_vpc_network: Optional[str] = None,
private_pool_id: Optional[str] = None,
):
"""
Run the notebooks that exist under the folders defined in the test_paths_file.
@@ -237,171 +330,128 @@ def run_changed_notebooks(
Required. The value for REGION to inject into notebooks.
should_parallelize (bool):
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
timeout (str):
Required. Timeout string according to https://cloud.google.com/build/docs/build-config-file-schema#timeout.
"""
test_paths = []
with open(test_paths_file) as file:
lines = [line.strip() for line in file.readlines()]
lines = [line for line in lines if len(line) > 0]
test_paths = [line for line in lines]
# Calculate deadline
deadline = datetime.datetime.now() + datetime.timedelta(
seconds=max(timeout - WORKER_TIMEOUT_BUFFER_IN_SECONDS, 0)
)
if len(test_paths) == 0:
raise RuntimeError("No test folders found.")
if len(notebooks) > 1:
notebook_execution_results: List[NotebookExecutionResult] = []
print(f"Checking folders: {test_paths}")
# Find notebooks
notebooks = []
if base_branch:
print(f"Looking for notebooks that changed from branch: {base_branch}")
notebooks = subprocess.check_output(
["git", "diff", "--name-only", f"origin/{base_branch}..."] + test_paths
)
else:
print(f"Looking for all notebooks.")
notebooks = subprocess.check_output(["git", "ls-files"] + test_paths)
notebooks = notebooks.decode("utf-8").split("\n")
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
notebook_execution_results: List[NotebookExecutionResult] = []
if len(notebooks) > 0:
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
if should_parallelize and len(notebooks) > 1:
print(
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
)
with concurrent.futures.ThreadPoolExecutor(max_workers=None) as executor:
with concurrent.futures.ThreadPoolExecutor(max_workers=100) as executor:
print(f"Max workers: {executor._max_workers}")
notebook_execution_results = list(
executor.map(
functools.partial(
execute_notebook,
process_and_execute_notebook,
container_uri,
staging_bucket,
artifacts_bucket,
variable_project_id,
variable_region,
variable_service_account,
variable_vpc_network,
private_pool_id,
deadline,
),
notebooks,
)
)
else:
notebook_execution_results = [
execute_notebook(
process_and_execute_notebook(
container_uri=container_uri,
staging_bucket=staging_bucket,
artifacts_bucket=artifacts_bucket,
variable_project_id=variable_project_id,
variable_region=variable_region,
variable_service_account=variable_service_account,
variable_vpc_network=variable_vpc_network,
private_pool_id=private_pool_id,
deadline=deadline,
notebook=notebook,
)
for notebook in notebooks
]
print("\n=== RESULTS ===\n")
results_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
result.name,
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.log_url,
result.output_uri,
result.output_uri_web,
]
for result in results_sorted
],
headers=[
"build_tag",
"status",
"duration",
"log_url",
"output_uri",
"output_uri_web",
],
)
)
print("\n=== END RESULTS===\n")
total_notebook_duration = functools.reduce(
operator.add,
[datetime.timedelta(seconds=0)]
+ [result.duration for result in results_sorted],
)
print(
f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}"
)
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
elif len(notebooks) == 1:
notebook = notebooks[0]
# Pre-process notebook by substituting variable names
_process_notebook(
notebook_path=notebook,
variable_project_id=variable_project_id,
variable_region=variable_region,
variable_service_account=variable_service_account,
variable_vpc_network=variable_vpc_network,
)
execute_notebook_helper.execute_notebook(
notebook_source=notebook,
output_file_or_uri="/".join(
[artifacts_bucket, pathlib.Path(notebook).name]
),
should_log_output=True,
)
else:
print("No notebooks modified in this pull request.")
print("\n=== RESULTS ===\n")
results_sorted = sorted(
notebook_execution_results,
key=lambda result: result.is_pass,
reverse=True,
)
# Print results
print(
tabulate(
[
[
result.name,
"PASSED" if result.is_pass else "FAILED",
format_timedelta(result.duration),
result.log_url,
]
for result in results_sorted
],
headers=["build_tag", "status", "duration", "log_url"],
)
)
print("\n=== END RESULTS===\n")
total_notebook_duration = functools.reduce(
operator.add,
[datetime.timedelta(seconds=0)]
+ [result.duration for result in results_sorted],
)
print(f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}")
# Raise error if any notebooks failed
if not all([result.is_pass for result in results_sorted]):
raise RuntimeError("Notebook failures detected. See logs for details")
parser = argparse.ArgumentParser(description="Run changed notebooks.")
parser.add_argument(
"--test_paths_file",
type=pathlib.Path,
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
required=True,
)
parser.add_argument(
"--base_branch",
help="The base git branch to diff against to find changed files.",
required=False,
)
parser.add_argument(
"--container_uri",
type=str,
help="The container uri to run each notebook in.",
required=True,
)
parser.add_argument(
"--variable_project_id",
type=str,
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--variable_region",
type=str,
help="The GCP region. This is used to inject a variable value into the notebook before running.",
required=True,
)
parser.add_argument(
"--staging_bucket",
type=str,
help="The GCP directory for staging temporary files.",
required=True,
)
parser.add_argument(
"--artifacts_bucket",
type=str,
help="The GCP directory for storing executed notebooks.",
required=True,
)
parser.add_argument(
"--should_parallelize",
type=str2bool,
nargs="?",
const=True,
default=True,
help="Should run notebooks in parallel.",
)
args = parser.parse_args()
run_changed_notebooks(
test_paths_file=args.test_paths_file,
container_uri=args.container_uri,
staging_bucket=args.staging_bucket,
artifacts_bucket=args.artifacts_bucket,
variable_project_id=args.variable_project_id,
variable_region=args.variable_region,
should_parallelize=args.should_parallelize,
base_branch=args.base_branch,
)
+7 -4
View File
@@ -13,10 +13,13 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import argparse
import ExecuteNotebook
"""A CLI to download (optional) and run a single notebook locally"""
parser = argparse.ArgumentParser(description="Run changed notebooks.")
import argparse
import execute_notebook_helper
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
parser.add_argument(
"--notebook_source",
type=str,
@@ -31,7 +34,7 @@ parser.add_argument(
)
args = parser.parse_args()
ExecuteNotebook.execute_notebook(
execute_notebook_helper.execute_notebook(
notebook_source=args.notebook_source,
output_file_or_uri=args.output_file_or_uri,
should_log_output=True,
@@ -13,23 +13,29 @@
# See the License for the specific language governing permissions and
# limitations under the License.
import sys
import os
import errno
import papermill as pm
import shutil
"""Methods to run a notebook locally"""
from utils import util
import errno
import os
import shutil
import sys
import papermill as pm
from google.cloud.aiplatform import utils
from utils import util
# This script is used to execute a notebook and write out the output notebook.
# This is used to force papermill to use this kernel to run the notebook instead of any defined inside the notebook itself
DEFAULT_KERNEL_NAME = "python3"
def execute_notebook(
notebook_source: str,
output_file_or_uri: str,
should_log_output: bool,
):
"""Execute a single notebook using Papermill"""
file_name = os.path.basename(os.path.normpath(notebook_source))
# Download notebook if it's a GCS URI
@@ -47,6 +53,17 @@ def execute_notebook(
execution_exception = None
print("\n=== DOWNLOAD EXECUTED NOTEBOOK ===\n")
print(f"Please debug the executed notebook by downloading the executed notebook:")
print("Option 1. Using gsutil. Run the following command in your terminal.")
print(f'\tgsutil cp "{output_file_or_uri}" .')
print("Option 2. Using this link.")
print(f"\thttps://storage.googleapis.com/{output_file_or_uri[5:]}")
print("\n======\n")
# Execute notebook
try:
# Execute notebook
@@ -55,6 +72,7 @@ def execute_notebook(
output_path=notebook_source,
progress_bar=should_log_output,
request_save_on_cell_execute=should_log_output,
kernel_name=DEFAULT_KERNEL_NAME,
log_output=should_log_output,
stdout_file=sys.stdout if should_log_output else None,
stderr_file=sys.stderr if should_log_output else None,
@@ -68,10 +86,6 @@ def execute_notebook(
util.upload_file(notebook_source, remote_file_path=output_file_or_uri)
print("\n=== EXECUTION FINISHED ===\n")
print(
f"Please debug the executed notebook by downloading: {output_file_or_uri}"
)
print("\n======\n")
else:
# Create directories if they don't exist
if not os.path.exists(os.path.dirname(output_file_or_uri)):
+52 -24
View File
@@ -1,18 +1,34 @@
#!/usr/bin/env python
# Copyright 2021 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Methods to run a notebook on Google Cloud Build"""
from re import sub
from typing import Optional
import google.auth
import yaml
from google.api_core import client_options, operation
from google.cloud.aiplatform import utils
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from google.protobuf import duration_pb2
from yaml.loader import FullLoader
import google.auth
from google.cloud.devtools import cloudbuild_v1
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
from typing import Optional
import yaml
from google.cloud.aiplatform import utils
from google.api_core import operation
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
TIMEOUT_IN_SECONDS = 86400
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
def execute_notebook_remote(
@@ -20,20 +36,14 @@ def execute_notebook_remote(
notebook_uri: str,
notebook_output_uri: str,
container_uri: str,
private_pool_id: Optional[str],
private_pool_region: Optional[str],
tag: Optional[str],
timeout_in_seconds: Optional[int] = None,
) -> operation.Operation:
"""Create and execute a simple Google Cloud Build configuration,
print the in-progress status and print the completed status."""
"""Create and execute a single notebook on Google Cloud Build"""
# Load build steps from YAML
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient()
build = cloudbuild_v1.Build()
# The following build steps will output "hello world"
# For more information on build configuration, see
# https://cloud.google.com/build/docs/configuring-builds/create-basic-configuration
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
substitutions = {
@@ -42,6 +52,24 @@ def execute_notebook_remote(
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
}
build = cloudbuild_v1.Build()
options: Optional[client_options.ClientOptions] = None
if private_pool_id and private_pool_region:
# substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
build.options = cloudbuild_config.get("options")
build.options.pool = {"name": private_pool_id}
# Switch to the regional endpoint of the pool
options = client_options.ClientOptions(
api_endpoint=f"{private_pool_region}-{SERVICE_BASE_PATH}"
)
# Authorize the client with Google defaults
credentials, project_id = google.auth.default()
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
(
source_archived_file_gcs_bucket,
source_archived_file_gcs_object,
@@ -56,8 +84,8 @@ def execute_notebook_remote(
build.steps = cloudbuild_config["steps"]
build.substitutions = substitutions
build.timeout = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
build.queue_ttl = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
build.timeout = duration_pb2.Duration(seconds=timeout_in_seconds)
build.queue_ttl = duration_pb2.Duration(seconds=timeout_in_seconds)
if tag:
build.tags = [tag]
@@ -4,25 +4,35 @@ steps:
entrypoint: /bin/sh
args:
- -c
- 'gcloud config list'
- 'gcloud config list --quiet'
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 .cloud-build/CheckPythonVersion.py'
- python3 .cloud-build/CheckPythonVersion.py -q
# Create a virtual environment
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- python3 -m venv workspace/env
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
- . workspace/env/bin/activate &&
python3 -m pip -q install -U pip &&
python3 -m pip -q install -U -r .cloud-build/requirements.txt
# Install Python dependencies and run testing script
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"'
- |
. workspace/env/bin/activate &&
python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"
env:
- 'IS_TESTING=1'
timeout: 86400s
@@ -4,35 +4,42 @@ steps:
entrypoint: /bin/sh
args:
- -c
- 'gcloud config list'
# # Clone the Git repo
# - name: ${_PYTHON_IMAGE}
# entrypoint: git
# args: ['clone', "${_GIT_REPO}", "--branch", "${_GIT_BRANCH_NAME}", "."]
- gcloud config list --quiet
# Check the Python version
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 .cloud-build/CheckPythonVersion.py'
# Fetch base branch if required
- python3 .cloud-build/CheckPythonVersion.py -q
# Fetch full repo for diff purposes
- name: gcr.io/cloud-builders/git
args: [fetch, --unshallow, --quiet]
# Create a virtual environment
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'if [ -n "${_BASE_BRANCH}" ]; then git fetch origin "${_BASE_BRANCH}":refs/remotes/origin/"${_BASE_BRANCH}"; else echo "Skipping fetch."; fi'
- python3 -m venv workspace/env
# Install Python dependencies
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
- . workspace/env/bin/activate &&
python3 -m pip -q install -U pip &&
python3 -m pip -q install -U -r .cloud-build/requirements.txt
# Install Python dependencies and run testing script
# TODO: Only pass in private_pool_id if it is set
- name: ${_PYTHON_IMAGE}
entrypoint: /bin/sh
args:
- -c
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
- |
. workspace/env/bin/activate &&
python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} --variable_service_account ${_GCP_SERVICE_ACCOUNT} --variable_vpc_network "${_GPC_VPC_NETWORK_NAME}" `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`
env:
- 'IS_TESTING=1'
timeout: 86400s
options:
pool:
name: ${_PRIVATE_POOL_NAME}
+9 -8
View File
@@ -1,12 +1,13 @@
ipython==8.0.0
jupyter==1.0.0
nbconvert==6.4.0
papermill==2.3.3
numpy==1.22.0
pandas==1.3.5
matplotlib==3.5.1
ipython
numpy
jupyter
nbconvert
papermill
pandas
matplotlib
tabulate
google-cloud-aiplatform
google-cloud-storage
google-cloud-build
gcloud
ratemate
GitPython
+5
View File
@@ -0,0 +1,5 @@
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
notebooks/official/matching_engine/sdk_matching_engine_for_indexing.ipynb
+1
View File
@@ -0,0 +1 @@
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
+4 -2
View File
@@ -13,8 +13,10 @@
# See the License for the specific language governing permissions and
# limitations under the License.
from nbconvert.preprocessors import Preprocessor
from typing import Dict
from nbconvert.preprocessors import Preprocessor
from . import UpdateNotebookVariables as update_notebook_variables
@@ -60,4 +62,4 @@ class UpdateVariablesPreprocessor(Preprocessor):
executable_cells.append(cell)
notebook.cells = executable_cells
return notebook, resources
return notebook, resources
+26 -3
View File
@@ -35,8 +35,8 @@ Variables in conditionals can also be replaced:
def get_updated_value(content: str, variable_name: str, variable_value: str) -> str:
return re.sub(
rf"({variable_name}.*?=.*?[\",\'])\[.+?\]([\",\'].*?)",
rf"\1{variable_value}\2",
rf"({variable_name}.*? = .*?[\",\'])\[.+?\]([\",\'].*?)",
rf"\g<1>{variable_value}\g<2>",
content,
flags=re.M,
)
@@ -78,4 +78,27 @@ def test_region():
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
def test_region_equal_equals_ignore():
# Tests that == is ignored
new_content = get_updated_value(
content='REGION == "[your-region]" # @param {type:"string"}',
variable_name="REGION",
variable_value="us-central1",
)
assert new_content == 'REGION == "[your-region]" # @param {type:"string"}'
def test_service_account():
# Tests that == is ignored
new_content = get_updated_value(
content='SERVICE_ACCOUNT = "[your-service-account]" # @param {type:"string"}',
variable_name="SERVICE_ACCOUNT",
variable_value="12345-compute@developer.gserviceaccount.com",
)
assert (
new_content
== 'SERVICE_ACCOUNT = "12345-compute@developer.gserviceaccount.com" # @param {type:"string"}'
)
+9 -9
View File
@@ -1,17 +1,17 @@
from datetime import datetime
from typing import Optional
from google.cloud import storage
from google.cloud.aiplatform import utils
from google.auth import credentials as auth_credentials
import os
import subprocess
import tarfile
import uuid
from datetime import datetime
from typing import Optional
from google.auth import credentials as auth_credentials
from google.cloud import storage
from google.cloud.aiplatform import utils
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
"""Copies a remote GCS file to a local path."""
"""Copies a remote GCS file to a local path"""
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
subprocess.check_output(
@@ -25,7 +25,7 @@ def upload_file(
local_file_path: str,
remote_file_path: str,
) -> str:
"""Copies a local file to a GCS path."""
"""Copies a local file to a GCS path"""
subprocess.check_output(
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
)
@@ -57,4 +57,4 @@ def archive_code_and_upload(staging_bucket: str):
print(f"Uploaded source code archive to {source_archived_file_gcs}")
return source_archived_file_gcs
return source_archived_file_gcs
+19 -9
View File
@@ -1,18 +1,28 @@
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.
<br>
--- YOUR PR SUMMARY GOES HERE ---
<br><br><br>
**REQUIRED:** Fill out the below checklists or remove if irrelevant
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
- [ ] Follow the style and grammar rules outlined in the above notebook template.
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
<br>
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
2. If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
<br>
3. If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
+4 -2
View File
@@ -7,9 +7,11 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Set up Python
uses: actions/setup-python@v2
uses: actions/setup-python@v4
with:
python-version: '3.x'
- name: Fetch pull request branch
uses: actions/checkout@v2
uses: actions/checkout@v3
with:
fetch-depth: 0
- name: Fetch base main branch
+4 -3
View File
@@ -2,8 +2,9 @@ git+https://github.com/tensorflow/docs
ipython
jupyter
nbconvert
black==21.10b0
pyupgrade==2.29.1
black==22.6.0
pyupgrade==2.34.0
isort==5.10.1
flake8==4.0.1
nbqa==1.2.2
nbqa==1.4.0
+6 -6
View File
@@ -68,7 +68,7 @@ if [ ${#notebooks[@]} -gt 0 ]; then
if [ "$is_test" = true ]; then
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs --test "$notebook"
python3 -m tensorflow_docs.tools.nbfmt --test "$notebook"
NBFMT_RTN=$?
# echo "Running black..."
# python3 -m nbqa black "$notebook" --check
@@ -84,19 +84,19 @@ if [ ${#notebooks[@]} -gt 0 ]; then
FLAKE8_RTN=$?
else
echo "Running black..."
python3 -m nbqa black "$notebook" --nbqa-mutate
python3 -m nbqa black "$notebook"
BLACK_RTN=$?
echo "Running pyupgrade..."
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
python3 -m nbqa pyupgrade "$notebook"
PYUPGRADE_RTN=$?
echo "Running isort..."
python3 -m nbqa isort "$notebook" --nbqa-mutate
python3 -m nbqa isort "$notebook"
ISORT_RTN=$?
echo "Running nbfmt..."
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
python3 -m tensorflow_docs.tools.nbfmt "$notebook"
NBFMT_RTN=$?
echo "Running flake8..."
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291 --nbqa-mutate
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
FLAKE8_RTN=$?
fi
+1 -1
View File
@@ -48,8 +48,8 @@ then you will need to manually address them before submitting your PR.
nbqa black "$notebook"
nbqa pyupgrade "$notebook"
nbqa isort "$notebook"
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
nbqa flake8 "$notebook" --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
```
## Code Reviews
+17 -1
View File
@@ -6,7 +6,19 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
## Overview
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [Community Content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
## Repository structure
```bash
├── community-content - Sample code and tutorials contributed by the community
├── notebooks
│ ├── community - Notebooks contributed by the community
│ ├── official - Notebooks demonstrating use of each Vertex AI service
│ │ ├── automl
│ │ ├── custom
│ │ ├── ...
```
## Contributing
@@ -19,3 +31,7 @@ Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-sa
## Disclaimer
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
## Feedback
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
+5 -1
View File
@@ -1,4 +1,8 @@
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
/pytorch_pre_built_images_deployment @googleapis/vertex-prediction-team
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
/pluto_on_workbench @wkharold
/cpr-examples @samthrasher
@@ -0,0 +1,824 @@
{
"cells": [
{
"cell_type": "markdown",
"metadata": {
"id": "pc5-mbsX9PZC"
},
"source": [
"# AlphaFold On Vertex AI Workbench\n",
"\n",
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
"\n",
"## ![](https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/community-content/alphafold_on_workbench/vertexai_40.png) [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
"\n",
"**Differences to AlphaFold v2.1.0**\n",
"\n",
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
"\n",
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
"\n",
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
"\n",
"**Citing this work**\n",
"\n",
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
"\n",
"**Licenses**\n",
"\n",
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
"\n",
"\n",
"**More information**\n",
"\n",
"You can find more information about how AlphaFold works in the following papers:\n",
"\n",
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
"\n",
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b7a02613eb1a"
},
"source": [
"## Download AlphaFold Data"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "woIxeCPygt7K"
},
"outputs": [],
"source": [
"import os\n",
"import subprocess\n",
"import sys\n",
"\n",
"import alphafold.common\n",
"import tqdm.notebook\n",
"from IPython.utils import io\n",
"\n",
"TQDM_BAR_FORMAT = (\n",
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
")\n",
"\n",
"SOURCE_URL = (\n",
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
")\n",
"PARAMS_DIR = \"alphafold/data/params\"\n",
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
"\n",
"try:\n",
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" with io.capture_output() as captured:\n",
"\n",
" # Download and store stereo_chemical_props.txt\n",
" !mkdir -p ~/content/alphafold/alphafold/common\n",
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
" pbar.update(18)\n",
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
"\n",
" # Download alphafold_params_colab_2021-10-27.tar\n",
" !mkdir --parents \"{PARAMS_DIR}\"\n",
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
" pbar.update(27)\n",
"\n",
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
" # !rm \"{PARAMS_PATH}\"\n",
" pbar.update(55)\n",
"\n",
"except subprocess.CalledProcessError:\n",
" print(captured)\n",
" raise"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d8926b7d5529"
},
"source": [
"## Configure GPU Acceleration"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "VzJ5iMjTtoZw"
},
"outputs": [],
"source": [
"# Confirm accelerator configuration\n",
"import jax\n",
"\n",
"if jax.local_devices()[0].platform == \"tpu\":\n",
" raise RuntimeError(\n",
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
" )\n",
"elif jax.local_devices()[0].platform == \"cpu\":\n",
" print(\n",
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
" )\n",
"else:\n",
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
"\n",
"# Make sure all necessary environment variables are set.\n",
"import os\n",
"\n",
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "W4JpOs6oA-QS"
},
"source": [
"## Making a prediction\n",
"\n",
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
"\n",
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
"\n",
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
"\n",
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b310d44229d0"
},
"outputs": [],
"source": [
"# Input sequences (type: str)\n",
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
"sequence_2 = \"\"\n",
"sequence_3 = \"\"\n",
"sequence_4 = \"\"\n",
"sequence_5 = \"\"\n",
"sequence_6 = \"\"\n",
"sequence_7 = \"\"\n",
"sequence_8 = \"\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "rowN0bVYLe9n"
},
"outputs": [],
"source": [
"from alphafold.notebooks import notebook_utils\n",
"\n",
"input_sequences = (\n",
" sequence_1,\n",
" sequence_2,\n",
" sequence_3,\n",
" sequence_4,\n",
" sequence_5,\n",
" sequence_6,\n",
" sequence_7,\n",
" sequence_8,\n",
")\n",
"\n",
"# If folding a complex target and all the input sequences are\n",
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
"# otherwise or if the origin is unknown.\n",
"\n",
"is_prokaryote = False # @param {type:\"boolean\"}\n",
"\n",
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
"MAX_MULTIMER_LENGTH = 2500\n",
"\n",
"# Validate the input.\n",
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
" input_sequences=input_sequences,\n",
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "db551d4877ea"
},
"source": [
"## Search against genetic databases\n",
"\n",
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "2tTeTTsLKPjB"
},
"outputs": [],
"source": [
"import collections\n",
"import copy\n",
"import random\n",
"from concurrent import futures\n",
"from urllib import request\n",
"\n",
"import matplotlib.pyplot as plt\n",
"import numpy as np\n",
"import py3Dmol\n",
"from alphafold.common import protein\n",
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
" pipeline_multimer)\n",
"from alphafold.data.tools import jackhmmer\n",
"from alphafold.model import config, data, model\n",
"from alphafold.relax import relax, utils\n",
"from IPython import display\n",
"from ipywidgets import GridspecLayout, Output\n",
"\n",
"# Color bands for visualizing plddt\n",
"PLDDT_BANDS = [\n",
" (0, 50, \"#FF7D45\"),\n",
" (50, 70, \"#FFDB13\"),\n",
" (70, 90, \"#65CBF3\"),\n",
" (90, 100, \"#0053D6\"),\n",
"]\n",
"\n",
"# --- Find the closest source ---\n",
"test_url_pattern = (\n",
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
")\n",
"ex = futures.ThreadPoolExecutor(3)\n",
"\n",
"\n",
"def fetch(source):\n",
" request.urlretrieve(test_url_pattern.format(source))\n",
" return source\n",
"\n",
"\n",
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
"source = None\n",
"for f in futures.as_completed(fs):\n",
" source = f.result()\n",
" ex.shutdown()\n",
" break\n",
"\n",
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
"# The z_value is the number of sequences in a database.\n",
"MSA_DATABASES = [\n",
" {\n",
" \"db_name\": \"uniref90\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 59,\n",
" \"z_value\": 135_301_051,\n",
" },\n",
" {\n",
" \"db_name\": \"smallbfd\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
" \"num_streamed_chunks\": 17,\n",
" \"z_value\": 65_984_053,\n",
" },\n",
" {\n",
" \"db_name\": \"mgnify\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
" \"num_streamed_chunks\": 71,\n",
" \"z_value\": 304_820_129,\n",
" },\n",
"]\n",
"\n",
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
" MSA_DATABASES.extend(\n",
" [\n",
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
" {\n",
" \"db_name\": \"uniprot\",\n",
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
" \"num_streamed_chunks\": 98,\n",
" \"z_value\": 219_174_961 + 565_254,\n",
" },\n",
" ]\n",
" )\n",
"\n",
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
"\n",
"MAX_HITS = {\n",
" \"uniref90\": 10_000,\n",
" \"smallbfd\": 5_000,\n",
" \"mgnify\": 501,\n",
" \"uniprot\": 50_000,\n",
"}\n",
"\n",
"\n",
"def get_msa(fasta_path):\n",
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
"\n",
" # Run the search against chunks of genetic databases.\n",
" raw_msa_results = collections.defaultdict(list)\n",
" with tqdm.notebook.tqdm(\n",
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
" ) as pbar:\n",
"\n",
" def jackhmmer_chunk_callback(i):\n",
" pbar.update(n=1)\n",
"\n",
" for db_config in MSA_DATABASES:\n",
" db_name = db_config[\"db_name\"]\n",
" pbar.set_description(f\"Searching {db_name}\")\n",
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
" binary_path=JACKHMMER_BINARY_PATH,\n",
" database_path=db_config[\"db_path\"],\n",
" get_tblout=True,\n",
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
" streaming_callback=jackhmmer_chunk_callback,\n",
" z_value=db_config[\"z_value\"],\n",
" )\n",
" # Group the results by database name.\n",
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
"\n",
" return raw_msa_results\n",
"\n",
"\n",
"features_for_chain = {}\n",
"raw_msa_results_for_sequence = {}\n",
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
"\n",
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
" with open(fasta_path, \"wt\") as f:\n",
" f.write(f\">query\\n{sequence}\")\n",
"\n",
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
" if sequence not in raw_msa_results_for_sequence:\n",
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
" else:\n",
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
"\n",
" # Extract the MSAs from the Stockholm files.\n",
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
" single_chain_msas = []\n",
" uniprot_msa = None\n",
" for db_name, db_results in raw_msa_results.items():\n",
" merged_msa = notebook_utils.merge_chunked_msa(\n",
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
" )\n",
" if merged_msa.sequences and db_name != \"uniprot\":\n",
" single_chain_msas.append(merged_msa)\n",
" msa_size = len(set(merged_msa.sequences))\n",
" print(\n",
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
" )\n",
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
" uniprot_msa = merged_msa\n",
"\n",
" notebook_utils.show_msa_info(\n",
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
" )\n",
"\n",
" # Turn the raw data into model features.\n",
" feature_dict = {}\n",
" feature_dict.update(\n",
" pipeline.make_sequence_features(\n",
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
" )\n",
" )\n",
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
" feature_dict.update(\n",
" notebook_utils.empty_placeholder_template_features(\n",
" num_templates=0, num_res=len(sequence)\n",
" )\n",
" )\n",
"\n",
" # Construct the all_seq features only for heteromers, not homomers.\n",
" if (\n",
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
" and len(set(sequences)) > 1\n",
" ):\n",
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
" \"msa_uniprot_accession_identifiers\",\n",
" \"msa_species_identifiers\",\n",
" )\n",
" all_seq_features = {\n",
" f\"{k}_all_seq\": v\n",
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
" if k in valid_feats\n",
" }\n",
" feature_dict.update(all_seq_features)\n",
"\n",
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
"\n",
"\n",
"# Do further feature post-processing depending on the model type.\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
"\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" all_chain_features = {}\n",
" for chain_id, chain_features in features_for_chain.items():\n",
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
" chain_features, chain_id\n",
" )\n",
"\n",
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
"\n",
" np_example = feature_processing.pair_and_merge(\n",
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
" )\n",
"\n",
" # Pad MSA to avoid zero-sized extra_msa.\n",
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9640643486bd"
},
"source": [
"## Run AlphaFold\n",
"\n",
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"collapsed": true,
"jupyter": {
"source_hidden": true
},
"cellView": "form",
"id": "XUo6foMQxwS2"
},
"outputs": [],
"source": [
"run_relax = True\n",
"\n",
"# --- Run the model ---\n",
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
"\n",
"output_dir = \"prediction\"\n",
"os.makedirs(output_dir, exist_ok=True)\n",
"\n",
"plddts = {}\n",
"ranking_confidences = {}\n",
"pae_outputs = {}\n",
"unrelaxed_proteins = {}\n",
"\n",
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
" for model_name in model_names:\n",
" pbar.set_description(f\"Running {model_name}\")\n",
"\n",
" cfg = config.model_config(model_name)\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" cfg.data.eval.num_ensemble = 1\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" cfg.model.num_ensemble_eval = 1\n",
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
" model_runner = model.RunModel(cfg, params)\n",
" processed_feature_dict = model_runner.process_features(\n",
" np_example, random_seed=0\n",
" )\n",
" prediction = model_runner.predict(\n",
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
" )\n",
"\n",
" mean_plddt = prediction[\"plddt\"].mean()\n",
"\n",
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
" if \"predicted_aligned_error\" in prediction:\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
" else:\n",
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
" # should never get selected.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" # Multimer models are sorted by pTM+ipTM.\n",
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
" plddts[model_name] = prediction[\"plddt\"]\n",
" pae_outputs[model_name] = (\n",
" prediction[\"predicted_aligned_error\"],\n",
" prediction[\"max_predicted_aligned_error\"],\n",
" )\n",
"\n",
" # Set the b-factors to the per-residue plddt.\n",
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
" unrelaxed_protein = protein.from_prediction(\n",
" processed_feature_dict,\n",
" prediction,\n",
" b_factors=b_factors,\n",
" remove_leading_feature_dimension=(\n",
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
" ),\n",
" )\n",
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
"\n",
" # Delete unused outputs to save memory.\n",
" del model_runner\n",
" del params\n",
" del prediction\n",
" pbar.update(n=1)\n",
"\n",
" # --- AMBER relax the best model ---\n",
"\n",
" # Find the best model according to the mean pLDDT.\n",
" best_model_name = max(\n",
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
" )\n",
"\n",
" if run_relax:\n",
" pbar.set_description(\"AMBER relaxation\")\n",
" amber_relaxer = relax.AmberRelaxation(\n",
" max_iterations=0,\n",
" tolerance=2.39,\n",
" stiffness=10.0,\n",
" exclude_residues=[],\n",
" max_outer_iterations=3,\n",
" )\n",
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
" prot=unrelaxed_proteins[best_model_name]\n",
" )\n",
" else:\n",
" print(\"Warning: Running without the relaxation stage.\")\n",
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
" pbar.update(n=1) # Finished AMBER relax.\n",
"\n",
"# Construct multiclass b-factors to indicate confidence bands\n",
"# 0=very low, 1=low, 2=confident, 3=very high\n",
"banded_b_factors = []\n",
"for plddt in plddts[best_model_name]:\n",
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
" if plddt >= min_val and plddt <= max_val:\n",
" banded_b_factors.append(idx)\n",
" break\n",
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
"\n",
"\n",
"# Write out the prediction\n",
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
"with open(pred_output_path, \"w\") as f:\n",
" f.write(relaxed_pdb)\n",
"\n",
"\n",
"# --- Visualise the prediction & confidence ---\n",
"show_sidechains = True\n",
"\n",
"\n",
"def plot_plddt_legend():\n",
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
" thresh = [\n",
" \"Very low (pLDDT < 50)\",\n",
" \"Low (70 > pLDDT > 50)\",\n",
" \"Confident (90 > pLDDT > 70)\",\n",
" \"Very high (pLDDT > 90)\",\n",
" ]\n",
"\n",
" colors = [x[2] for x in PLDDT_BANDS]\n",
"\n",
" plt.figure(figsize=(2, 2))\n",
" for c in colors:\n",
" plt.bar(0, 0, color=c)\n",
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
" plt.xticks([])\n",
" plt.yticks([])\n",
" ax = plt.gca()\n",
" ax.spines[\"right\"].set_visible(False)\n",
" ax.spines[\"top\"].set_visible(False)\n",
" ax.spines[\"left\"].set_visible(False)\n",
" ax.spines[\"bottom\"].set_visible(False)\n",
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
" return plt\n",
"\n",
"\n",
"# Show the structure coloured by chain if the multimer model has been used.\n",
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
" multichain_view = py3Dmol.view(width=800, height=600)\n",
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
" multichain_view.zoomTo()\n",
" multichain_view.show()\n",
"\n",
"# Color the structure by per-residue pLDDT\n",
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
"view = py3Dmol.view(width=800, height=600)\n",
"view.addModelsAsFrames(to_visualize_pdb)\n",
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
"if show_sidechains:\n",
" style[\"stick\"] = {}\n",
"view.setStyle({\"model\": -1}, style)\n",
"view.zoomTo()\n",
"\n",
"grid = GridspecLayout(1, 2)\n",
"out = Output()\n",
"with out:\n",
" view.show()\n",
"grid[0, 0] = out\n",
"\n",
"out = Output()\n",
"with out:\n",
" plot_plddt_legend().show()\n",
"grid[0, 1] = out\n",
"\n",
"display.display(grid)\n",
"\n",
"# Display pLDDT and predicted aligned error (if output by the model).\n",
"if pae_outputs:\n",
" num_plots = 2\n",
"else:\n",
" num_plots = 1\n",
"\n",
"plt.figure(figsize=[8 * num_plots, 6])\n",
"plt.subplot(1, num_plots, 1)\n",
"plt.plot(plddts[best_model_name])\n",
"plt.title(\"Predicted LDDT\")\n",
"plt.xlabel(\"Residue\")\n",
"plt.ylabel(\"pLDDT\")\n",
"\n",
"if num_plots == 2:\n",
" plt.subplot(1, 2, 2)\n",
" pae, max_pae = list(pae_outputs.values())[0]\n",
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
" plt.colorbar(fraction=0.046, pad=0.04)\n",
"\n",
" # Display lines at chain boundaries.\n",
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
" chain_ids = best_unrelaxed_prot.chain_index\n",
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
" if chain_boundary.size:\n",
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
"\n",
" plt.title(\"Predicted Aligned Error\")\n",
" plt.xlabel(\"Scored residue\")\n",
" plt.ylabel(\"Aligned residue\")\n",
"\n",
"# Save the predicted aligned error (if it exists).\n",
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
"if pae_outputs:\n",
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
" with open(pae_output_path, \"w\") as f:\n",
" f.write(pae_data)\n",
"\n",
"!zip -q -r {output_dir}.zip {output_dir}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "lUQAn5LYC5n4"
},
"source": [
"### Interpreting the prediction\n",
"\n",
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
"\n",
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "jeb2z8DIA4om"
},
"source": [
"## FAQ & Troubleshooting\n",
"\n",
"\n",
"* How do I get a predicted protein structure for my protein?\n",
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
"* How long will this take?\n",
" * The search against genetic databases can take minutes to hours.\n",
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
"* My notebook no longer seems to be doing anything, what should I do?\n",
" * Some steps may take minutes to hours to complete.\n",
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
"* How does this compare to the open-source version of AlphaFold?\n",
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
"* Does this tool install anything on my computer?\n",
" * No, everything happens in the VM instance within your Google Cloud project.\n",
"* How should I share feedback and bug reports?\n",
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
"\n",
"\n",
"## Related work\n",
"\n",
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
"\n",
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "YfPhvYgKC81B"
},
"source": [
"# License and Disclaimer\n",
"\n",
"This is not an officially-supported Google product.\n",
"\n",
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
"\n",
"Copyright 2021 DeepMind Technologies Limited.\n",
"\n",
"\n",
"## AlphaFold Code License\n",
"\n",
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
"\n",
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
"\n",
"## Model Parameters License\n",
"\n",
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
"\n",
"\n",
"## Third-party software\n",
"\n",
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
"\n",
"\n",
"## Mirrored Databases\n",
"\n",
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
]
}
],
"metadata": {
"accelerator": "GPU",
"colab": {
"collapsed_sections": [],
"name": "AlphaFold.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,82 @@
# Copyright 2022 Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
ARG CUDA_MAJOR=11
ARG CUDA_MINOR=0
FROM gcr.io/deeplearning-platform-release/base-cu110
ARG CUDA_MAJOR
ARG CUDA_MINOR
SHELL ["/bin/bash", "-c"]
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
build-essential \
cmake \
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
git \
hmmer \
kalign \
tzdata \
wget \
&& rm -rf /var/lib/apt/lists/*
# Compile HHsuite from source.
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
&& mkdir /tmp/hh-suite/build \
&& pushd /tmp/hh-suite/build \
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
&& make -j 4 && make install \
&& ln -s /opt/hhsuite/bin/* /usr/bin \
&& popd \
&& rm -rf /tmp/hh-suite
ENV PATH="/opt/conda/bin:$PATH"
RUN conda update -qy conda \
&& conda install -y -c conda-forge \
openmm=7.5.1 \
cudatoolkit==${CUDA_VERSION} \
pdbfixer \
pip \
python=3.7
COPY . /app/alphafold
# Install pip packages.
RUN pip3 install --upgrade pip \
&& pip3 install -r /app/alphafold/requirements.txt \
&& pip3 install py3Dmol tqdm \
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
https://storage.googleapis.com/jax-releases/jax_releases.html
# Install alphafold.
WORKDIR /app/alphafold
RUN python setup.py install
# Apply OpenMM patch.
WORKDIR /opt/conda/lib/python3.7/site-packages
RUN patch -p0 < /app/alphafold/docker/openmm.patch
# Creating a tmp location for jackhmmr; not mounting through to host though.
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
# details.
# ENTRYPOINT does not support easily running multiple commands, so instead we
# write a shell script to wrap them up.
WORKDIR /home/jupyter
RUN echo '#!/bin/bash\nldconfig\n\'
+20
View File
@@ -0,0 +1,20 @@
#!/usr/bin/env bash
set -e
# Prod (Publicly viewable)
PROJECT=cloud-devrel-public-resources
REPOSITORY=alphafold
LOCAL_IMAGE=alphafold-on-gcp
REMOTE_IMAGE=${LOCAL_IMAGE?}
TAG=latest
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
git clone https://github.com/deepmind/alphafold.git
cp Dockerfile alphafold/docker/Dockerfile
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
sudo docker push ${REGISTRY?}
Binary file not shown.

After

Width:  |  Height:  |  Size: 3.1 KiB

@@ -0,0 +1,5 @@
testdata/*
build.py
test.py
state_dict.pth
config.json
@@ -0,0 +1,5 @@
cpr_model_server.py
entrypoint.py
state_dict.pth
config.json
**/__pycache__
@@ -0,0 +1,93 @@
# CPR Example: PyTorch Image Models (timm)
## About CPR
CPR ([custom prediction routines](https://github.com/googleapis/python-aiplatform/blob/custom-prediction-routine/google/cloud/aiplatform/prediction/README.md)) is a framework designed by Google Cloud developers to make it easier to combine machine learning models with custom preprocessing and postprocessing logic in a real-time serving application.
## Using this example
This code is a self-contained example of a custom model server project built using CPR.
As is, you can use it to serve the ViT-Small image classification model from Ross Wightman's [`timm`](https://github.com/rwightman/pytorch-image-models) library of image model implementations in PyTorch. Both CPU and GPU are supported.
You can also consider using the code here as a template for your own CPR project if you want to use a different model from `timm`, a different PyTorch model, or an entirely different framework.
### Requirements
In order to use this example, you'll need Docker and Python 3 installed on your system.
To get started, first create a virtual environment in an empty directory:
```sh
mkdir cpr-example
python3 -m venv cpr-example
cd cpr-example && source bin/activate
```
Then, clone the [vertex-ai-samples repo](https://github.com/GoogleCloudPlatform/vertex-ai-samples) in that directory:
```sh
git clone https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
cd vertex-ai-samples/community-content/cpr-examples/timm_serving
```
Finally, install the Python modules required to build and run the model server:
```sh
pip install -r requirements.txt
```
### Predictor
The `TimmPredictor` class in `timm_serving/predictor.py` implements most of the important logic for the server.
- `load(artifacts_dir)`: The predictor's `load` method is called when the server starts up in order to set up the predictor, usually by loading model weights and any artifacts needed for preprocessing and postprocessing. In this example, we initialize the saved model from the `state_dict.pth` file located inside the `artifacts_dir` folder and create the preprocessing transform from the model config.
- `preprocess`, `predict`, `postprocess`: These methods are applied in sequence to the deserialized JSON data from each request.
- `preprocess` decodes images from base64 and apply cropping, scaling and normalizing transforms.
- `predict` runs the ViT-Small model on the preprocessed images and returns class scores.
- `postprocess` finds the top five classes and packs the class names, probabilities, and indices in a serializable result.
### Building the container
To build the model server locally, run the build command:
```sh
python build.py build
```
You can edit configuration values such as the model server's base image, the name and tag assigned to the image, and the path where model weights are stored locally.
When you run the build command, model weights are downloaded and the model server container is built.
### Running local tests
`test.py` contains a suite of unit tests for the predictor as well as end-to-end tests for the model server.
To run the tests:
```sh
python test.py
```
All of the test images are public domain.
- [Cat](https://commons.wikimedia.org/wiki/File:Stray_cat_on_wall.jpg)
- [Airplane](https://commons.wikimedia.org/wiki/File:Airplanes_jets.jpg)
- The infamous [mandrill](https://commons.wikimedia.org/wiki/File:Wikipedia-sipi-image-db-mandrill-4.2.03.png)
### Deploying to Vertex AI
Before uploading or deploying the container, you'll need to modify `config.py` to set appropriate values for:
- `project_id`: Your GCP project id.
- `region`: Region where the model will be uploaded and deployed.
- `repository`: [Artifact Registry repository](https://cloud.google.com/artifact-registry/docs/repositories/create-repos) in your project where the container image will be uploaded.
- `artifacts_gcs_dir`: Folder in a [Google Cloud Storage bucket](https://cloud.google.com/storage/docs/creating-buckets) where the model weights will be uploaded.
Once this is done, first upload the model:
```sh
python build.py upload
```
Then deploy it:
```sh
python build.py deploy
```
If you run the deploy command again, it will create a new endpoint. If you want to undeploy the model, you can do so using the Vertex AI dashboard on the Google Cloud console, or use `gcloud ai endpoints undeploy` from the command line.
After deploying successfully, you can run `python build.py probe` to send a sample request to the deployed model.
@@ -0,0 +1,117 @@
# Copyright 2022 Google LLC
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# https://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Build the model server container."""
import json
import logging
import os
import pathlib
from typing import Sequence
from absl import app
from absl import logging
from config import CPRConfig
from google.cloud import aiplatform
from google.cloud.aiplatform import prediction as cpr
import smart_open
import timm
from timm_serving import predictor
import torch
def build_container(config: CPRConfig, tag: str) -> cpr.LocalModel:
"""Build the model server container.
Args:
tag: Output image tag.
Returns:
LocalModel exposing the built model server.
"""
return cpr.LocalModel.build_cpr_model(
src_dir=os.path.join(os.getcwd()),
output_image_uri=tag,
base_image=config.base_image,
predictor=predictor.TimmPredictor,
requirements_path=os.path.join(os.getcwd(), "requirements.txt"),
)
def save_model_artifact(destination: str) -> None:
"""Save a copy of the model state dict."""
model = timm.create_model(predictor.TimmPredictor.TIMM_MODEL_NAME, pretrained=True)
dest_file = os.path.join(destination, predictor.TimmPredictor.WEIGHTS_FILE)
with smart_open.open(dest_file, "wb") as f:
torch.save(model, f)
logging.info("Saved model to %s", dest_file)
logging.info("%s parameters", sum(p.numel() for p in model.parameters()))
def upload_model(config: CPRConfig) -> aiplatform.Model:
"""Tag and upload the model server."""
ar_tag = (
f"{config.region}-docker.pkg.dev/{config.project_id}"
f"/{config.repository}/{config.image}"
)
local_model = build_container(config, tag=ar_tag)
aiplatform.init(project=config.project_id, location=config.region)
local_model.push_image()
aip_model = aiplatform.Model.upload(
local_model=local_model,
display_name=predictor.TimmPredictor.TIMM_MODEL_NAME,
artifact_uri=config.artifact_gcs_dir,
)
config.model_name = aip_model.resource_name
config.save()
return aip_model
def deploy_model(config: CPRConfig) -> aiplatform.Endpoint:
"""Deploy the model server to a Vertex Prediction endpoint."""
aiplatform.init(project=config.project_id, location=config.region)
aip_model = aiplatform.Model(model_name=config.model_name)
endpoint = aip_model.deploy(machine_type=config.machine_type)
config.endpoint_name = endpoint.resource_name
config.save()
return endpoint
def probe_prediction(config: CPRConfig, request_path: str) -> None:
"""Send a sample prediction request to the Vertex Prediction endpoint."""
aiplatform.init(project=config.project_id, location=config.region)
aip_endpoint = aiplatform.Endpoint(endpoint_name=config.endpoint_name)
with open(request_path) as f:
logging.info(aip_endpoint.predict(**json.load(f)))
def main(argv: Sequence[str]):
config = CPRConfig()
if pathlib.Path(config.config_file).exists():
config.load()
actions = set(argv[1:])
if "build" in actions:
build_container(config, config.image)
save_model_artifact(config.artifact_local_dir)
if "upload" in actions:
save_model_artifact(config.artifact_gcs_dir)
upload_model(config)
if "deploy" in actions:
deploy_model(config)
if "probe" in actions:
probe_prediction(config, request_path="sample_request.json")
if __name__ == "__main__":
app.run(main)
@@ -0,0 +1,76 @@
# Copyright 2022 Google LLC
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# https://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
import dataclasses
import json
@dataclasses.dataclass
class CPRConfig(object):
"""Configure the build process by editing the default values here.
config_file: File path used to save values in this config. (Some
values, such as the model name, are generated at build time and
depended on by future steps, so saving it allows this script to
deploy the model without re-uploading it, for example.)
base_image: Base Docker image on top of which the model server will
be built. By default, a Debian-based Python 3 image without GPU
support will be used.
image: Name and tag assigned to the built model server image.
artifact_local_dir: Local directory where a copy of the pretrained model weights
will be saved.
region: Google Cloud Region where the model will be uploaded during the
build process.
project_id: Google Cloud project ID.
repository: Name of the Artifact Registry repository where the container
will be uploaded.
artifact_gcs_dir: Location on GCS where a copy of the pretrained model
weights will be uploaded.
model_name: Full resource path of the uploaded model. This is a write-only
field, the value is generated by Vertex AI when the model is uploaded.
endpoint_name: Full resource path of the created endpoint. This is a
write-only field, the value is generated by Vertex AI when the model is
deployed to an endpoint.
machine_type: Machine type to use when deploying the model.
"""
config_file: str = "config.json"
base_image: str = "python:3.10-bullseye"
image: str = "timm_predictor:latest"
artifact_local_dir: str = ""
region: str = "us-central1"
project_id: str = "samthrasher-experimental"
repository: str = "cpr-images"
artifact_gcs_dir: str = "gs://samthrasher-cpr-example/timm-vit224/"
model_name: str = ""
endpoint_name: str = ""
machine_type: str = "n1-standard-2"
def save(self):
with open(self.config_file, "w") as f:
json.dump(dataclasses.asdict(self), f, indent=2)
def load(self):
with open(self.config_file) as f:
self.__init__(**json.load(f))
@@ -0,0 +1,8 @@
absl-py==1.1.0
fastapi==0.75.2
uvicorn==0.18.2
timm==0.5.4
smart_open==6.0.0
google-cloud-storage>=1.26.0,<2.0.0dev
google-cloud-aiplatform[prediction] @ git+https://github.com/googleapis/python-aiplatform.git@custom-prediction-routine
File diff suppressed because one or more lines are too long
@@ -0,0 +1,249 @@
"""Test the timm_serving predictor."""
import base64
import json
import logging
import os
import pickle
from typing import List, Dict
from absl import flags
from absl import logging
from absl.testing import absltest
from config import CPRConfig
import fastapi
from google.cloud import aiplatform
from google.cloud.aiplatform import prediction as cpr
import PIL
from timm_serving import predictor
import torch
VIT_SMALL_PARAMS = 22878952
def b64_encode_file(path: str) -> str:
"""Encode a file's contents as base64.
Args:
path: Path to the file.
Returns:
Base64-encoded contents of the file.
"""
with open(path, "rb") as f:
return str(base64.b64encode(f.read()), encoding="utf-8")
def make_instance_dict(
image_paths: List[str], base64_encodings: List[str]
) -> Dict[str, List[str]]:
"""Generate a dictionary similar to a parsed prediction server request.
Args:
image_paths: Paths to image files to include.
base64_encodings: Pre-encoded base64 strings.
Returns:
Dictionary of instances in the format accepted by the preprocessor.
"""
instances = [s for s in base64_encodings]
for path in image_paths:
instances.append(b64_encode_file(path))
return {"instances": instances}
def count_parameters(model: torch.nn.Module):
"""Count the parameters in a Pytorch model.
Args:
model: Pytorch model (nn.Module).
Returns:
Number of parameters in the model.
"""
return sum(p.numel() for p in model.parameters())
class PredictorUnitTests(absltest.TestCase):
"""Unit tests for timm_serving.predictor."""
def setUp(self):
super().setUp()
self.config = CPRConfig()
self.config.load()
self.predictor = predictor.TimmPredictor()
def test_load_from_saved_state_dict_ok(self):
self.predictor.load(self.config.artifact_local_dir)
self.assertEqual(count_parameters(self.predictor._model), VIT_SMALL_PARAMS)
def test_load_bad_path(self):
with self.assertRaises(FileNotFoundError):
self.predictor.load("testdata/")
with self.assertRaisesRegex(ValueError, "not a directory"):
self.predictor.load("blah")
def test_load_bad_data(self):
with self.assertRaises(pickle.UnpicklingError):
self.predictor.load("testdata/bad_model_1")
with self.assertRaisesRegex(RuntimeError, "Invalid magic number"):
self.predictor.load("testdata/bad_model_2")
def test_preprocess_ok(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = make_instance_dict(
base64_encodings=[],
image_paths=[
"testdata/airplane.jpg",
"testdata/mandrill.tiff",
"testdata/mandrill.tiff",
"testdata/cat_alpha.png",
],
)
result = self.predictor.preprocess(instance_dict)
self.assertEqual(result.size(), torch.Size([4, 3, 224, 224]))
self.assertEqual(result.dtype, torch.float32)
def test_preprocess_no_instances(self):
self.predictor.load(self.config.artifact_local_dir)
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess({})
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, 'must contain "instances"')
def test_preprocess_wrong_shape_instances(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = {"instances": [[b64_encode_file("testdata/mandrill.tiff")]]}
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess(instance_dict)
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, "not 'list'")
def test_preprocess_bad_base64(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = make_instance_dict(base64_encodings=["!@#$"], image_paths=[])
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess(instance_dict)
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, "[Bb]ase64")
def test_preprocess_not_image_data(self):
self.predictor.load(self.config.artifact_local_dir)
instance_dict = make_instance_dict(
base64_encodings=[], image_paths=["testdata/bad.jpg"]
)
with self.assertRaises(fastapi.HTTPException) as ctx:
self.predictor.preprocess(instance_dict)
self.assertEqual(ctx.exception.status_code, 400)
self.assertRegex(ctx.exception.detail, "image file")
def test_predict_ok(self):
self.predictor.load(self.config.artifact_local_dir)
inputs = torch.zeros(size=[2, 3, 224, 224], dtype=torch.float32)
if torch.cuda.device_count() > 0:
inputs = inputs.cuda()
result = self.predictor.predict(inputs)
self.assertEqual(result.size(), torch.Size([2, 1000]))
self.assertEqual(result.dtype, torch.float32)
def test_postprocess_ok(self):
class_probs = torch.zeros(size=[2, 1000])
class_probs[0, 0] = 1
class_probs[1, 123] = 1
result = self.predictor.postprocess(class_probs)
predictions = result["predictions"]
self.assertLen(predictions[0]["class_names"], 5)
self.assertLen(predictions[0]["indices"], 5)
self.assertLen(predictions[0]["probabilities"], 5)
self.assertLen(predictions[1]["class_names"], 5)
self.assertLen(predictions[1]["indices"], 5)
self.assertLen(predictions[1]["probabilities"], 5)
self.assertContainsSubsequence(predictions[0]["class_names"][0], "tench")
self.assertContainsSubsequence(
predictions[1]["class_names"][0], "spiny lobster"
)
class ServerEndToEndTests(absltest.TestCase):
"""End-to-end tests for the model server, using LocalEndpoint."""
def setUp(self):
super().setUp()
self.config = CPRConfig()
self.config.load()
self.local_model = cpr.LocalModel(
serving_container_spec=aiplatform.gapic.ModelContainerSpec(
image_uri=self.config.image
)
)
self.local_endpoint = self.local_model.deploy_to_local_endpoint(
artifact_uri=self.config.artifact_local_dir or os.getcwd()
)
self.local_endpoint.serve()
def tearDown(self):
self.local_endpoint.stop()
super().tearDown()
def test_e2e_healthcheck_ok(self):
health_check_response = self.local_endpoint.run_health_check()
self.assertEqual(health_check_response.status_code, 200)
self.assertEqual(health_check_response.content, b"{}")
def test_e2e_predict_ok(self):
predict_request = json.dumps(
make_instance_dict(
base64_encodings=[],
image_paths=[
"testdata/mandrill.tiff",
],
)
)
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 200)
predictions = response.json()["predictions"]
self.assertContainsSubsequence(predictions[0]["class_names"][0], "baboon")
def test_e2e_predict_bad_json_returns_400(self):
predict_request = "blah"
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
def test_e2e_predict_no_instances_returns_400(self):
predict_request = json.dumps({})
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
def test_e2e_predict_bad_base64_returns_400(self):
predict_request = json.dumps(
make_instance_dict(base64_encodings=["blah"], image_paths=[])
)
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
def test_e2e_predict_bad_image_returns_400(self):
predict_request = json.dumps(
make_instance_dict(base64_encodings=[], image_paths=["testdata/bad.jpg"])
)
response = self.local_endpoint.predict(
request=predict_request, headers={"Content-Type": "application/json"}
)
logging.info(response.content)
self.assertEqual(response.status_code, 400)
if __name__ == "__main__":
absltest.main()
Binary file not shown.

After

Width:  |  Height:  |  Size: 30 KiB

@@ -0,0 +1 @@
some non-image data
@@ -0,0 +1 @@
some non-image data
Binary file not shown.

After

Width:  |  Height:  |  Size: 348 KiB

File diff suppressed because it is too large Load Diff
@@ -0,0 +1,178 @@
# Copyright 2022 Google LLC
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# https://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Adapts a pretrained TIMM image classification model to the CPR framework.
Documentation for the TIMM (Torch IMage Models) library is here:
https://rwightman.github.io/pytorch-image-models/
Its source can also be found here:
https://github.com/rwightman/pytorch-image-models
"""
import base64
import binascii
import io
import os
from typing import Dict, List, Union
from fastapi import HTTPException
from google.cloud.aiplatform import prediction as cpr
from pathlib import Path
import PIL
import smart_open
import timm
import torch
import torch.nn.functional as F
with open(Path(__file__).parent.absolute().joinpath("imagenet.txt")) as f:
IMAGENET_CLASSES = f.read().splitlines()
class TimmPredictor(cpr.predictor.Predictor):
"""Predictor class for image models based on TIMM."""
TIMM_MODEL_NAME = os.getenv("TIMM_MODEL_NAME", default="vit_small_patch32_224")
WEIGHTS_FILE = "state_dict.pth"
NUM_TOP_CLASSES_TO_RETURN = 5
def __init__(self):
self._cuda = torch.cuda.device_count() > 0
def load(self, artifacts_uri: str = ""):
"""Initializes the model and preprocessing transforms.
Args:
artifacts_uri: Directory where state dict is stored. Can be a
GCS URI or local path.
"""
if artifacts_uri:
artifact_path = os.path.join(artifacts_uri)
if not (os.path.isdir(artifact_path) or artifact_path.startswith("gs://")):
raise ValueError("Provided artifact_uri is not a directory.")
else:
artifact_path = os.getcwd()
artifact_path = os.path.join(artifact_path, self.WEIGHTS_FILE)
with smart_open.open(artifact_path, "rb") as f:
self._model = torch.load(f)
if self._cuda:
self._model.cuda()
config = timm.data.resolve_data_config(model=self.TIMM_MODEL_NAME, args=[])
self._transform = timm.data.create_transform(
is_training=False, use_prefetcher=False, **config
)
def preprocess(self, request_dict: Dict[str, List[str]]) -> torch.Tensor:
"""Performs preprocessing.
By default, the server expects a request body consisting of a valid JSON
object. This will be parsed by the handler before it's evaluated by the
preprocess method.
Args:
request_dict: Parsed request body. We expect that the input consists of
a list of base64-encoded image files under the "instances" key. (Any
image format that PIL.image.open can handle is okay.)
Returns:
torch.Tensor containing the preprocessed images as a batch. If GPU is
available, the result tensor will be stored on GPU.
"""
if "instances" not in request_dict:
raise HTTPException(
status_code=400,
detail='Request must contain "instances" as a top-level key.',
)
tensors = []
for (i, image) in enumerate(request_dict["instances"]):
# We use Base64 encoding to handle image data.
# This is probably the best we can do while still using JSON input.
# Overriding the input format requires building a custom Handler.
try:
image_bytes = base64.b64decode(image, validate=True)
except (binascii.Error, TypeError) as e:
raise HTTPException(
status_code=400,
detail=f"Base64 decoding of the input image at index {i} failed:"
f" {str(e)}",
)
try:
pil_image = PIL.Image.open(io.BytesIO(image_bytes)).convert("RGB")
except PIL.UnidentifiedImageError:
raise HTTPException(
status_code=400,
detail=f"The input image at index {i} could not be identified as an"
" image file.",
)
tensors.append(self._transform(pil_image))
with torch.inference_mode():
result = torch.stack(tensors)
if self._cuda:
result = result.cuda()
return result
def predict(self, instances: torch.Tensor) -> torch.Tensor:
"""Performs prediction.
Args:
instances: torch.Tensor with type torch.float32 and shape
[?, 3, 224, 224], containing the pre-processed input images.
Returns:
Vector of scores with type torch.float32 and shape [?, 1000],
representing the model's estimate of the likelihood that the
input belongs to the Imagenet class with that index.
"""
with torch.inference_mode():
class_scores = self._model(instances)
return class_scores
def postprocess(
self, class_scores: torch.Tensor
) -> Dict[str, List[Dict[str, Union[str, int, float]]]]:
"""Translate the model output into a classification result.
Args:
class_scores: torch.Tensor with type torch.float32 and shape
[?, 1000], containing the scores assigned to each class by
the model.
Returns:
Dictionary containing the list of classification results. Each
classification result contains the probabilities, class names, and
class indices of the classes with the top class scores as reported by
the model.
"""
class_probs = F.softmax(class_scores, dim=1)
top_k = class_probs.topk(self.NUM_TOP_CLASSES_TO_RETURN)
top_k_values = top_k.values.numpy().tolist()
top_k_indices = top_k.indices.numpy().tolist()
predictions = [
dict(
probabilities=values,
indices=indices,
class_names=[IMAGENET_CLASSES[int(class_num)] for class_num in indices],
)
for (values, indices) in zip(top_k_values, top_k_indices)
]
return {"predictions": predictions}
@@ -0,0 +1,52 @@
# Overview
*Pluto* is a programming environment for Julia, designed to be interactive and helpful. It provides a familiar notebook interface but it is not a Jupyter notebook. The biggest difference is that Pluto notebooks are reactive, changing a variable or function in one cell causes the cells that depend on that variable or function to be reevaluated. Pluto also provides useful interaction mechanisms that allow users to dynamically interact with the notebooks computation state.
The JuliaCon 2020 presentation: [Interactive notebooks ~ Pluto.jl]() provides a good introduction to Pluto. The source is at [fonsp/Pluto.jl]()
# Install Pluto
## Create a Vertex AI JupyterLab Instance
1. From the [GCP console](https://console.cloud.google.com) "hamburger menu"
select Vertex AI > Workbench
2. Click NEW NOTEBOOK
* Choose Python 3 if you won't be using a GPU
* Choose Python 3 (CUDA Toolkit xx.y) if you do want use a GPU
3. Give the notebook an appropriate name
4. Edit Notebook properties if you have special requirements otherwise accept the defaults and click CREATE
5. When the notebook instance is ready click OPEN JUPYTERLAB
## Configure JupyterLab
1. Open a terminal by clicking the Terminal icon.
1. Install the plutoserver
pip3 install git+https://github.com/fonsp/pluto-on-jupyterlab.git
1. In a browser go to [julialang.org/downloads](https://julialang.org/downloads/)
1. In the Current stable release right click on the `Generic Linux on x86 / 64-bit (glibc)` link
Select copy link address
1. Back in the terminal switch to root via
sudo -i
1. Download the release to /opt and install julia in /usr/local/bin
```bash
cd /opt
wget <paste the release link address>
tar xf <name of the downloaded tar file>
ln -s /opt/<julia-x.y.z>/bin/julia /usr/local/bin
^d
```
1. Add the Pluto package to Julia
```bash
julia
julia> ]add Pluto
julia> bksp
julia> using Pluto
julia> ^d
```
1. From the JupyterLab menu bar select File > Shut Down
# Start Pluto
1. Click OPEN JUPYTERLAB in the Workbench
1. In the Notebook section of the Launcher click Pluto.jl
1. The welcome to Pluto.jl screen should appear
@@ -1,474 +0,0 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "c414a395a19b"
},
"source": [
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on CPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "b98238e32cf7"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b5ae674177e"
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "19a9b3bdd553"
},
"outputs": [],
"source": [
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "57bf6f8b4361"
},
"source": [
"## Local Training"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e5d8a3443da0"
},
"outputs": [],
"source": [
"! ls trainer"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "07f79309472d"
},
"outputs": [],
"source": [
"! cat trainer/requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "e16cd8bb7483"
},
"outputs": [],
"source": [
"! pip install -r trainer/requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b8a210718c4"
},
"outputs": [],
"source": [
"! cat trainer/task.py"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c0c6e7dfb3c6"
},
"outputs": [],
"source": [
"%run trainer/task.py --epochs 5 --no-cuda --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "31dfdeede587"
},
"outputs": [],
"source": [
"! ls ./tmp"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "48d56ec621cc"
},
"outputs": [],
"source": [
"! rm -rf ./tmp"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8f3ea1210749"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "93002a20a2a6"
},
"source": [
"### Build Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "4130ce43fd08"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "2f1fc5b05240"
},
"outputs": [],
"source": [
"! cd trainer && docker build -t $custom_container_image_uri -f Dockerfile ."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b4f274f499ac"
},
"outputs": [],
"source": [
"! docker run --rm $custom_container_image_uri --epochs 5 --no-cuda --local-mode"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ee1a0a06d0b4"
},
"outputs": [],
"source": [
"! docker push $custom_container_image_uri"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cb763be12fc9"
},
"outputs": [],
"source": [
"! gcloud container images list --repository $hostname/$PROJECT_ID"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "10c8cc6b3334"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "1a12348169fa"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "42e981cefe41"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "73c92c9298e9"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bde509558cd5"
},
"outputs": [],
"source": [
"content_name = content_name + \"-cpu\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6d7908c0083c"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a1f0a4f54037"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "a4cac84e04ac"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "f92e8fdd44ee"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 4\n",
"machine_type = \"n1-standard-4\"\n",
"\n",
"args = [\n",
" \"--backend\",\n",
" \"gloo\",\n",
" \"--no-cuda\",\n",
" \"--batch-size\",\n",
" \"128\",\n",
" \"--epochs\",\n",
" \"25\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "ae4c57df7e07"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "35cf3ecdf0df"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "49d10dded73b"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "78398f52807b"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "fc74422de1d1"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5e99a6a05b10"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "b0c1b3f7466b"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -1,347 +0,0 @@
{
"cells": [
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a6b56b1c7b76"
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
"# You may obtain a copy of the License at\n",
"#\n",
"# https://www.apache.org/licenses/LICENSE-2.0\n",
"#\n",
"# Unless required by applicable law or agreed to in writing, software\n",
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
"# See the License for the specific language governing permissions and\n",
"# limitations under the License."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "20a5ea0081d0"
},
"source": [
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "8752d4a255fb"
},
"source": [
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" </td>\n",
"</table>"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "03d216c7f7b1"
},
"source": [
"## Setup"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c5ac73516218"
},
"outputs": [],
"source": [
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
"REGION = \"YOUR REGION\"\n",
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0b5ae674177e"
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "19a9b3bdd553"
},
"outputs": [],
"source": [
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "5307fe28b633"
},
"source": [
"## Vertex Training using Vertex SDK and Custom Container"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "46cb58c7fbf9"
},
"source": [
"### Built Custom Container"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "97e66e9f9bab"
},
"outputs": [],
"source": [
"hostname = \"gcr.io\"\n",
"image_name = content_name\n",
"tag = \"latest\"\n",
"\n",
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ae9b29c4773f"
},
"source": [
"### Initialize Vertex SDK"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "dc1e84d5dec2"
},
"outputs": [],
"source": [
"! pip install -r requirements.txt"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "6964be27b98e"
},
"outputs": [],
"source": [
"from google.cloud import aiplatform\n",
"\n",
"aiplatform.init(\n",
" project=PROJECT_ID,\n",
" staging_bucket=BUCKET_NAME,\n",
" location=REGION,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "594a91f438f2"
},
"source": [
"### Create a Vertex Tensorboard Instance"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "93134273261e"
},
"outputs": [],
"source": [
"content_name = content_name + \"-gpu\""
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "c2bd82dbcd9b"
},
"outputs": [],
"source": [
"tensorboard = aiplatform.Tensorboard.create(\n",
" display_name=content_name,\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "ebc593c6472e"
},
"source": [
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
"\n",
"```\n",
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
"```"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "0769e8e34c2f"
},
"source": [
"### Run a Vertex SDK CustomContainerTrainingJob"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "023f33ece826"
},
"outputs": [],
"source": [
"display_name = content_name\n",
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
"\n",
"replica_count = 1\n",
"machine_type = \"n1-standard-4\"\n",
"accelerator_count = 4\n",
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
"\n",
"args = [\n",
" \"--backend\",\n",
" \"nccl\",\n",
" \"--batch-size\",\n",
" \"128\",\n",
" \"--epochs\",\n",
" \"25\",\n",
"]"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "d4b599e726ef"
},
"outputs": [],
"source": [
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
" display_name=display_name,\n",
" container_uri=custom_container_image_uri,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "81321e3bdf7f"
},
"outputs": [],
"source": [
"custom_container_training_job.run(\n",
" args=args,\n",
" base_output_dir=gcs_output_uri_prefix,\n",
" replica_count=replica_count,\n",
" machine_type=machine_type,\n",
" accelerator_count=accelerator_count,\n",
" accelerator_type=accelerator_type,\n",
" tensorboard=tensorboard.resource_name,\n",
" service_account=SERVICE_ACCOUNT,\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "5100712c2c4c"
},
"outputs": [],
"source": [
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "f9b77676e5a6"
},
"source": [
"### Training Output Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "0e171ce95ace"
},
"outputs": [],
"source": [
"! gsutil ls $gcs_output_uri_prefix"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "cf1b74a12b87"
},
"source": [
"## Clean Up Artifact"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "a0b15089c341"
},
"outputs": [],
"source": [
"! gsutil rm -rf $gcs_output_uri_prefix"
]
}
],
"metadata": {
"colab": {
"name": "multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb",
"toc_visible": true
},
"kernelspec": {
"display_name": "Python 3",
"name": "python3"
}
},
"nbformat": 4,
"nbformat_minor": 0
}
@@ -0,0 +1,30 @@
# PyTorch Deployment on Google Cloud: Text Classification
**This is an Experimental release**, covered by the Pre-GA Offerings Terms of your Google Cloud Platform [Terms of Service](https://cloud.google.com/terms).
Experiments are focused on validating a prototype and are not guaranteed to be released. They are not intended for production use or covered by any SLA, support obligation, or deprecation policy and might be subject to backward-incompatible changes.
**Kindly drop us a note before you run any scale tests.**
**Do not hesitate to contact vertexai-prediction-preview-feedback@google.com if you have any questions or run into any issues.**
The projects need to be added to the allowlist in order to deploy PyTorch models using Vertex AI Prediction pre-built PyTorch images. If you are interested in the feature, please send an email to vertexai-prediction-preview-feedback@google.com to provide your project numbers OR project ids.
## Overview
In the PyTorch on Google Cloud series of blog posts, we aim to share how to deploy PyTorch models at scale on [Vertex AI](https://cloud.google.com/vertex-ai).
This tutorial on text classification shows how to deploy a PyTorch based text classification model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
## Notebooks
| <h4>Notebook</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [pytorch-text-classification-vertex-ai-deploy.ipynb](./pytorch-text-classification-vertex-ai-deploy.ipynb) | Notebook to show deploying a PyTorch model on Vertex AI |
## Folders
| <h4>Folder Name</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [`predictor`](./predictor) | Folder with custom prediction handler to deploy a PyTorch model to Vertex Prediction. In the [notebook](./pytorch-text-classification-vertex-ai-deploy.ipynb), this folder is used for deploying a PyTorch model on Vertex AI using Vertex Prediction pre-built PyTorch images |
@@ -52,7 +52,8 @@ class TransformersClassifierHandler(BaseHandler):
with open(mapping_file_path) as f:
self.mapping = json.load(f)
else:
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
logger.warning('Missing the index_to_name.json file. Inference output will default.')
self.mapping = {"0": "Negative", "1": "Positive"}
self.initialized = True
@@ -88,4 +89,3 @@ class TransformersClassifierHandler(BaseHandler):
def postprocess(self, inference_output):
return inference_output
@@ -0,0 +1,5 @@
{
"0": "Negative",
"1": "Positive"
}
@@ -1,6 +1,6 @@
# PyTorch on Google Cloud: Text Classification
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
@@ -9,6 +9,7 @@ This tutorial on text classification shows how to train a PyTorch based text cla
| <h4>Notebook</h4> | <h4>Description</h4> |
| :-------- | :------- |
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
## Folders
@@ -1,6 +1,7 @@
# Use pytorch GPU base image
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
# set working directory
WORKDIR /app
@@ -22,15 +22,18 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
# BUCKET_NAME: Change to your bucket name.
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# JOB_NAME: the name of your job running on AI Platform.
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# This can be a GCS location to a zipped and uploaded package
PACKAGE_PATH=./trainer
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
# or use the default '`us-central1`'. The region is where the job will be run.
REGION="us-central1"
@@ -41,11 +44,8 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
# IMAGE_TAG: an easily identifiable tag for your docker image
IMAGE_TAG=latest
# IMAGE_URI: the complete URI location for Cloud Container Registry
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
# Build the docker image
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
@@ -53,11 +53,19 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
# Deploy the docker image to Cloud Container Registry
docker push ${CUSTOM_TRAIN_IMAGE_URI}
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
Binary file not shown.

After

Width:  |  Height:  |  Size: 45 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 37 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 248 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 38 KiB

@@ -2,10 +2,13 @@
FROM pytorch/torchserve:latest-cpu
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
USER model-server
# copy model artifacts, custom handler and other dependencies
COPY ./custom_text_handler.py /home/model-server/
COPY ./custom_handler.py /home/model-server/
COPY ./index_to_name.json /home/model-server/
COPY ./model/finetuned-bert-classifier/ /home/model-server/
@@ -21,7 +24,7 @@ EXPOSE 7080
EXPOSE 7081
# create model archive file packaging model artifacts and dependencies
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
# run Torchserve HTTP serve to respond to prediction requests
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
@@ -0,0 +1,37 @@
FROM pytorch/torchserve:latest-cpu
USER root
# run and update some basic packages software packages, including security libs
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
# Install gcloud tools for gsutil as well as debugging
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
USER model-server
# install dependencies
RUN python3 -m pip install --upgrade pip
RUN pip3 install transformers
ARG MODEL_NAME=finetuned-bert-classifier
ENV MODEL_NAME="${MODEL_NAME}"
# health and prediction listener ports
ARG AIP_HTTP_PORT=7080
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
ARG MODEL_MGMT_PORT=7081
# expose health and prediction listener ports from the image
EXPOSE "${AIP_HTTP_PORT}"
EXPOSE "${MODEL_MGMT_PORT}"
EXPOSE 8080 8081 8082 7070 7071
# create torchserve configuration file
USER root
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
USER model-server
# run Torchserve HTTP serve to respond to prediction requests
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
@@ -0,0 +1,91 @@
import os
import json
import logging
import torch
from transformers import AutoModelForSequenceClassification, AutoTokenizer
from ts.torch_handler.base_handler import BaseHandler
logger = logging.getLogger(__name__)
class TransformersClassifierHandler(BaseHandler):
"""
The handler takes an input string and returns the classification text
based on the serialized transformers checkpoint.
"""
def __init__(self):
super(TransformersClassifierHandler, self).__init__()
self.initialized = False
def initialize(self, ctx):
""" Loads the model.pt file and initialized the model object.
Instantiates Tokenizer for preprocessor to use
Loads labels to name mapping file for post-processing inference response
"""
self.manifest = ctx.manifest
properties = ctx.system_properties
model_dir = properties.get("model_dir")
self.device = torch.device("cuda:" + str(properties.get("gpu_id")) if torch.cuda.is_available() else "cpu")
# Read model serialize/pt file
serialized_file = self.manifest["model"]["serializedFile"]
model_pt_path = os.path.join(model_dir, serialized_file)
if not os.path.isfile(model_pt_path):
raise RuntimeError("Missing the model.pt or pytorch_model.bin file")
# Load model
self.model = AutoModelForSequenceClassification.from_pretrained(model_dir)
self.model.to(self.device)
self.model.eval()
logger.debug('Transformer model from path {0} loaded successfully'.format(model_dir))
# Ensure to use the same tokenizer used during training
self.tokenizer = AutoTokenizer.from_pretrained('bert-base-cased')
# Read the mapping file, index to object name
mapping_file_path = os.path.join(model_dir, "index_to_name.json")
if os.path.isfile(mapping_file_path):
with open(mapping_file_path) as f:
self.mapping = json.load(f)
else:
logger.warning('Missing the index_to_name.json file. Inference output will default.')
self.mapping = {"0": "Negative", "1": "Positive"}
self.initialized = True
def preprocess(self, data):
""" Preprocessing input request by tokenizing
Extend with your own preprocessing steps as needed
"""
text = data[0].get("data")
if text is None:
text = data[0].get("body")
sentences = text.decode('utf-8')
logger.info("Received text: '%s'", sentences)
# Tokenize the texts
tokenizer_args = ((sentences,))
inputs = self.tokenizer(*tokenizer_args,
padding='max_length',
max_length=128,
truncation=True,
return_tensors = "pt")
return inputs
def inference(self, inputs):
""" Predict the class of a text using a trained transformer model.
"""
prediction = self.model(inputs['input_ids'].to(self.device))[0].argmax().item()
if self.mapping:
prediction = self.mapping[str(prediction)]
logger.info("Model predicted: '%s'", prediction)
return [prediction]
def postprocess(self, inference_output):
return inference_output
@@ -19,13 +19,19 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
# BUCKET_NAME: Change to your bucket name
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# The PyTorch image provided by Vertex AI Training.
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
# JOB_NAME: the name of your job running on Vertex AI.
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
@@ -35,19 +41,21 @@ REGION="us-central1"
# JOB_DIR: Where to store prepared package and upload output model.
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
# validate bucket name
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
then
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
exit 1
fi
# worker pool spec
worker_pool_spec="\
replica-count=1,\
machine-type=n1-standard-8,\
accelerator-type=NVIDIA_TESLA_V100,\
accelerator-count=1,\
executor-image-uri=${IMAGE_URI},\
python-module=trainer.task,\
local-package-path=../python_package/"
# Submit Custom Job to Vertex AI
gcloud beta ai custom-jobs create \
--display-name=${JOB_NAME} \
--region ${REGION} \
--python-package-uris=${PACKAGE_PATH} \
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
--worker-pool-spec="${worker_pool_spec}" \
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
@@ -122,6 +122,9 @@ def run(args):
# Train / Test the model
trainer = train(args, text_classifier, train_dataset, test_dataset)
metrics = trainer.evaluate(eval_dataset=test_dataset)
trainer.save_metrics("all", metrics)
# Export the trained model
trainer.save_model(os.path.join("/tmp", args.model_name))
@@ -63,20 +63,20 @@
"- [Training](#Training)\n",
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
"- [Tuning](#Hyperparameter-Tuning) \n",
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
"- [Deploying](#Deploying)\n",
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
"\n",
"### Costs \n",
"\n",
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
"\n",
"* [Notebooks](https://cloud.google.com/notebooks)\n",
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
"* [Cloud Storage](https://cloud.google.com/storage)\n",
"* [Container Registry](https://cloud.google.com/container-registry)\n",
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
@@ -202,9 +202,9 @@
"id": "e0c1dcadc2c8"
},
"source": [
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
"\n",
"#### Install Vertex SDK for Python"
"#### Install Vertex AI SDK for Python"
]
},
{
@@ -658,8 +658,8 @@
},
"outputs": [],
"source": [
"datasets = load_dataset(\"imdb\")\n",
"datasets"
"dataset = load_dataset(\"imdb\")\n",
"dataset"
]
},
{
@@ -668,7 +668,7 @@
"id": "RzfPtOMoIrIu"
},
"source": [
"The `datasets` object itself is [`DatasetDict`](https://huggingface.co/docs/datasets/package_reference/main_classes.html#datasetdict), which contains one key for the training, validation and test set."
"The `dataset` object itself is [`DatasetDict`](https://huggingface.co/docs/datasets/package_reference/main_classes.html#datasetdict), which contains one key for the training, validation and test set."
]
},
{
@@ -681,12 +681,12 @@
"source": [
"print(\n",
" \"Total # of rows in training dataset {} and size {:5.2f} MB\".format(\n",
" datasets[\"train\"].shape[0], datasets[\"train\"].size_in_bytes / (1024 * 1024)\n",
" dataset[\"train\"].shape[0], dataset[\"train\"].size_in_bytes / (1024 * 1024)\n",
" )\n",
")\n",
"print(\n",
" \"Total # of rows in test dataset {} and size {:5.2f} MB\".format(\n",
" datasets[\"test\"].shape[0], datasets[\"test\"].size_in_bytes / (1024 * 1024)\n",
" dataset[\"test\"].shape[0], dataset[\"test\"].size_in_bytes / (1024 * 1024)\n",
" )\n",
")"
]
@@ -708,7 +708,7 @@
},
"outputs": [],
"source": [
"datasets[\"train\"][0]"
"dataset[\"train\"][0]"
]
},
{
@@ -728,7 +728,7 @@
},
"outputs": [],
"source": [
"label_list = datasets[\"train\"].unique(\"label\")\n",
"label_list = dataset[\"train\"].unique(\"label\")\n",
"label_list"
]
},
@@ -779,7 +779,7 @@
},
"outputs": [],
"source": [
"show_random_elements(datasets[\"train\"])"
"show_random_elements(dataset[\"train\"])"
]
},
{
@@ -883,7 +883,7 @@
},
"outputs": [],
"source": [
"example = datasets[\"train\"][4]\n",
"example = dataset[\"train\"][4]\n",
"print(example)"
]
},
@@ -920,7 +920,7 @@
"source": [
"# Dataset loading repeated here to make this cell idempotent\n",
"# Since we are over-writing datasets variable\n",
"datasets = load_dataset(\"imdb\")\n",
"dataset = load_dataset(\"imdb\")\n",
"\n",
"# Mapping labels to ids\n",
"# NOTE: We can extract this automatically but the `Unique` method of the datasets\n",
@@ -948,7 +948,7 @@
"\n",
"\n",
"# apply preprocessing function to input examples\n",
"datasets = datasets.map(preprocess_function, batched=True, load_from_cache_file=True)"
"dataset = dataset.map(preprocess_function, batched=True, load_from_cache_file=True)"
]
},
{
@@ -1091,8 +1091,8 @@
"trainer = Trainer(\n",
" model,\n",
" args,\n",
" train_dataset=datasets[\"train\"],\n",
" eval_dataset=datasets[\"test\"],\n",
" train_dataset=dataset[\"train\"],\n",
" eval_dataset=dataset[\"test\"],\n",
" data_collator=default_data_collator,\n",
" tokenizer=tokenizer,\n",
" compute_metrics=compute_metrics,\n",
@@ -1199,7 +1199,7 @@
"source": [
"### Run predictions locally with sample examples\n",
"\n",
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
]
},
{
@@ -1382,7 +1382,7 @@
"id": "f7466d414a0e"
},
"source": [
"### Run Custom Job on Vertex Training with a pre-built container"
"### Run Custom Job on Vertex AI Training with a pre-built container"
]
},
{
@@ -1395,7 +1395,7 @@
"\n",
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
"\n",
"![Training with Prebuilt Containers on Vertex Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
"![Training with Prebuilt Containers on Vertex AI Training](./images/training-with-prebuilt-containers-on-vertex-training.png)"
]
},
{
@@ -1569,7 +1569,7 @@
"source": [
"#### **Run custom training job on Vertex AI**\n",
"\n",
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
]
},
{
@@ -1578,7 +1578,7 @@
"id": "5d2957ef04fd"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1598,7 +1598,7 @@
"id": "6b0fed34b728"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**"
"##### **Configure and submit Custom Job to Vertex AI Training service**"
]
},
{
@@ -1609,7 +1609,7 @@
"source": [
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
]
},
{
@@ -1686,7 +1686,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job.png)"
]
},
{
@@ -1798,7 +1798,7 @@
"id": "c170d386492b"
},
"source": [
"### Run Custom Job on Vertex Training with custom container"
"### Run Custom Job on Vertex AI Training with custom container"
]
},
{
@@ -1807,7 +1807,7 @@
"id": "035227b6e581"
},
"source": [
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
"\n",
"![Training with custom containers on Vertex AI](./images/training-with-custom-containers-on-vertex-training.png)"
]
@@ -1834,7 +1834,7 @@
"%%writefile ./custom_container/Dockerfile\n",
"\n",
"# Use pytorch GPU base image\n",
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
"\n",
"# set working directory\n",
"WORKDIR /app\n",
@@ -1968,7 +1968,7 @@
"id": "a23e5e34bea9"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -1988,11 +1988,11 @@
"id": "abf1fa4085cb"
},
"source": [
"##### **Configure and submit Custom Job to Vertex Training service**\n",
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
"\n",
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
"\n",
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
]
},
{
@@ -2044,7 +2044,7 @@
},
"outputs": [],
"source": [
"# submit the custom job to Vertex training service\n",
"# submit the custom job to Vertex AI training service\n",
"model = job.run(\n",
" replica_count=1,\n",
" machine_type=\"n1-standard-8\",\n",
@@ -2065,7 +2065,7 @@
"\n",
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor custom job progress in Vertex Training](./images/vertex-training-monitor-custom-job-container.png)"
"![Monitor custom job progress in Vertex AI Training](./images/vertex-training-monitor-custom-job-container.png)"
]
},
{
@@ -2148,11 +2148,11 @@
"id": "ba6122f929e3"
},
"source": [
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
"\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
"\n",
"![Hyperparameter Tuning with Custom Containers on Vertex Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
"![Hyperparameter Tuning with Custom Containers on Vertex AI Training](./images/hp-tuning-with-custom-containers-on-vertex-training.png)"
]
},
{
@@ -2163,7 +2163,7 @@
"source": [
"### How hyperparameter tuning works in Vertex AI?\n",
"\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
"\n",
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
@@ -2297,7 +2297,7 @@
"source": [
"### Run Hyperparameter Tuning Job on Vertex AI\n",
"\n",
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
]
},
{
@@ -2326,7 +2326,7 @@
"id": "f60fab07d67c"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -2346,7 +2346,7 @@
"id": "6652aa63ddff"
},
"source": [
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
"\n",
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
"\n",
@@ -2374,7 +2374,7 @@
"id": "9d46db3a8b23"
},
"source": [
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
]
},
{
@@ -2548,7 +2548,7 @@
"\n",
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
"\n",
"![Monitor hyperparameter tuning job progress in Vertex Training](./images/vertex-training-monitor-hptuning-job-container.png)"
"![Monitor hyperparameter tuning job progress in Vertex AI Training](./images/vertex-training-monitor-hptuning-job-container.png)"
]
},
{
@@ -2557,7 +2557,7 @@
"id": "ba934b434f03"
},
"source": [
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
]
},
{
@@ -2612,7 +2612,7 @@
"id": "5dbccb2b7d32"
},
"source": [
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
]
},
{
@@ -2701,8 +2701,8 @@
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
"\n",
"# BUCKET_NAME: Change to your bucket name\n",
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
"# BUCKET_NAME is a required parameter to run the cell.\n",
"BUCKET_NAME=$1\n",
"\n",
"# APP_NAME: get application name\n",
"APP_NAME=$2\n",
@@ -2711,7 +2711,7 @@
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
"\n",
"# custom container image URI\n",
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
"\n",
"# ========================================================\n",
"# create hyperparameter tuning configuration file\n",
@@ -2772,20 +2772,20 @@
"source": [
"## Deploying\n",
"\n",
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
"\n",
"### Deploying model on Vertex Predictions with custom container\n",
"### Deploying model on Vertex AI Predictions with custom container\n",
"\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
"\n",
"![Serving with Custom Containers on Vertex Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"![Serving with Custom Containers on Vertex AI Predictions](./images/serve-pytorch-model-on-vertex-predictions-with-custom-containers.png)\n",
"\n",
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
"\n",
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
]
},
{
@@ -2815,7 +2815,7 @@
},
"outputs": [],
"source": [
"%%writefile predictor/custom_text_handler.py\n",
"%%writefile predictor/custom_handler.py\n",
"\n",
"import os\n",
"import json\n",
@@ -2870,7 +2870,8 @@
" with open(mapping_file_path) as f:\n",
" self.mapping = json.load(f)\n",
" else:\n",
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
"\n",
" self.initialized = True\n",
"\n",
@@ -3047,10 +3048,13 @@
"FROM pytorch/torchserve:latest-cpu\n",
"\n",
"# install dependencies\n",
"RUN python3 -m pip install --upgrade pip\n",
"RUN pip3 install transformers\n",
"\n",
"USER model-server\n",
"\n",
"# copy model artifacts, custom handler and other dependencies\n",
"COPY ./custom_text_handler.py /home/model-server/\n",
"COPY ./custom_handler.py /home/model-server/\n",
"COPY ./index_to_name.json /home/model-server/\n",
"COPY ./model/$APP_NAME/ /home/model-server/\n",
"\n",
@@ -3070,7 +3074,7 @@
" --model-name=$APP_NAME \\\n",
" --version=1.0 \\\n",
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
" --handler=/home/model-server/custom_text_handler.py \\\n",
" --handler=/home/model-server/custom_handler.py \\\n",
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
" --export-path=/home/model-server/model-store\n",
"\n",
@@ -3129,7 +3133,7 @@
"source": [
"#### **Run the container locally** ***[Optional]***\n",
"\n",
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
]
},
{
@@ -3267,9 +3271,9 @@
"id": "69477b3a00c0"
},
"source": [
"#### **Deploying the serving container to Vertex Predictions**\n",
"#### **Deploying the serving container to Vertex AI Predictions**\n",
"\n",
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
]
},
{
@@ -3300,7 +3304,7 @@
"id": "a3da91e19af4"
},
"source": [
"##### **Initialize the Vertex SDK for Python**"
"##### **Initialize the Vertex AI SDK for Python**"
]
},
{
@@ -3437,7 +3441,7 @@
"id": "bc4673478269"
},
"source": [
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
]
},
{
@@ -3487,7 +3491,7 @@
"source": [
"##### **Formatting input for online prediction**\n",
"\n",
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
"\n",
"```\n",
"[\n",
@@ -3560,9 +3564,9 @@
},
"source": [
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
"\n",
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
]
},
{
@@ -3653,12 +3657,12 @@
},
"outputs": [],
"source": [
"delete_custom_job = True\n",
"delete_hp_tuning_job = True\n",
"delete_custom_job = False\n",
"delete_hp_tuning_job = False\n",
"delete_endpoint = True\n",
"delete_model = True\n",
"delete_bucket = True\n",
"delete_image = True"
"delete_model = False\n",
"delete_bucket = False\n",
"delete_image = False"
]
},
{
@@ -3686,7 +3690,7 @@
"\n",
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
"\n",
"# Initialize Vertex SDK\n",
"# Initialize Vertex AI SDK\n",
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
]
},
@@ -3924,7 +3928,7 @@
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" print(\n",
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
" )\n",
@@ -3932,7 +3936,7 @@
" # uncomment below line to delete contents of the bucket\n",
" # ! gsutil rm -r $BUCKET_NAME\n",
"\n",
" shell_output=! gsutil du -as $BUCKET_NAME\n",
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
" if float(shell_output[0].split()[0]) > 0:\n",
" print(\n",
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
@@ -188,11 +188,14 @@
},
"outputs": [],
"source": [
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
"! pip3 install {USER_FLAG} --upgrade kfp\n",
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow"
"! pip3 install {USER_FLAG} numpy\n",
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
"! pip3 install {USER_FLAG} --upgrade pillow\n",
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
"! pip3 install {USER_FLAG} --upgrade fastapi"
]
},
{
@@ -287,7 +290,7 @@
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
@@ -518,6 +521,7 @@
"import os\n",
"import sys\n",
"\n",
"from google.cloud import aiplatform\n",
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
"from kfp.v2 import compiler, dsl\n",
"from kfp.v2.google.client import AIPlatformClient"
@@ -561,13 +565,34 @@
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
"id": "895ac243c125"
},
"outputs": [],
"source": [
"# Dataset parameters\n",
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
"\n",
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "62bfb9a820f6"
},
"outputs": [],
"source": [
"# Download the sample data into your RAW_DATA_PATH\n",
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "H3530hdGGilo"
},
"outputs": [],
"source": [
"# Pipeline parameters\n",
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
@@ -635,7 +660,7 @@
"source": [
"#### Run unit tests on the Generator component\n",
"\n",
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
]
},
{
@@ -713,12 +738,12 @@
"TRAINING_ARTIFACTS_DIR = (\n",
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
")\n",
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
"TRAINING_MACHINE_TYPE = (\n",
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
")\n",
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -769,8 +794,12 @@
"TRAINED_POLICY_DISPLAY_NAME = (\n",
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
")\n",
"TRAFFIC_SPLIT = {\"0\": 100}\n",
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
]
},
{
@@ -900,16 +929,17 @@
},
"outputs": [],
"source": [
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
"from kfp.components import load_component_from_url\n",
"\n",
"generate_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
")\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -978,7 +1008,7 @@
" bigquery_location=bigquery_location,\n",
" bigquery_table_id=bigquery_table_id,\n",
" )\n",
"\n",
" \n",
" # Run the Ingester component.\n",
" ingest_task = ingest_op(\n",
" project_id=project_id,\n",
@@ -988,7 +1018,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -996,28 +1035,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1034,11 +1055,14 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" traffic_split=TRAFFIC_SPLIT,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -1053,12 +1077,11 @@
"# Compile the authored pipeline.\n",
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
"\n",
"# Createa Vertex AI client.\n",
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
"\n",
"# Create a pipeline run job.\n",
"response = api_client.create_run_from_job_spec(\n",
" job_spec_path=PIPELINE_SPEC_PATH,\n",
"job = aiplatform.PipelineJob(\n",
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
" template_path=PIPELINE_SPEC_PATH,\n",
" pipeline_root=PIPELINE_ROOT,\n",
" parameter_values={\n",
" # Pipeline configs\n",
" \"project_id\": PROJECT_ID,\n",
@@ -1070,7 +1093,9 @@
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
" },\n",
" enable_caching=ENABLE_CACHING,\n",
")"
")\n",
"\n",
"job.run()"
]
},
{
@@ -1111,7 +1136,11 @@
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
")"
")\n",
"# TF-Agents RL configs\n",
"BATCH_SIZE = 8\n",
"RANK_K = 20\n",
"NUM_ACTIONS = 20"
]
},
{
@@ -1221,7 +1250,7 @@
},
"outputs": [],
"source": [
"endpoints = ! gcloud beta ai endpoints list \\\n",
"endpoints = ! gcloud ai endpoints list \\\n",
" --region=$REGION \\\n",
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
"print(\"\\n\".join(endpoints), \"\\n\")\n",
@@ -1424,13 +1453,11 @@
},
"outputs": [],
"source": [
"from kfp.components import load_component_from_url\n",
"\n",
"ingest_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
")\n",
"train_op = load_component_from_url(\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
")\n",
"\n",
"\n",
@@ -1481,7 +1508,16 @@
" )\n",
"\n",
" # Run the Trainer component and submit custom job to Vertex AI.\n",
" train_task = train_op(\n",
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
" component_spec=train_op,\n",
" replica_count=TRAINING_REPLICA_COUNT,\n",
" machine_type=TRAINING_MACHINE_TYPE,\n",
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
" )\n",
"\n",
" train_task = custom_job_training_op(\n",
" training_artifacts_dir=training_artifacts_dir,\n",
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
" num_epochs=num_epochs,\n",
@@ -1489,28 +1525,10 @@
" num_actions=num_actions,\n",
" tikhonov_weight=tikhonov_weight,\n",
" agent_alpha=agent_alpha,\n",
" project=PROJECT_ID,\n",
" location=REGION,\n",
" )\n",
"\n",
" worker_pool_specs = [\n",
" {\n",
" \"containerSpec\": {\n",
" \"imageUri\": train_task.container.image,\n",
" },\n",
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
" \"machineSpec\": {\n",
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
" },\n",
" },\n",
" ]\n",
" train_task.custom_job_spec = {\n",
" \"displayName\": train_task.name,\n",
" \"jobSpec\": {\n",
" \"workerPoolSpecs\": worker_pool_specs,\n",
" },\n",
" }\n",
"\n",
" # Run the Deployer components.\n",
" # Upload the trained policy as a model.\n",
" model_upload_op = gcc_aip.ModelUploadOp(\n",
@@ -1527,11 +1545,13 @@
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
" # has to occur after both model uploading and endpoint creation complete.)\n",
" gcc_aip.ModelDeployOp(\n",
" project=project_id,\n",
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
" model=model_upload_op.outputs[\"model\"],\n",
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
" )"
]
},
@@ -39,14 +39,15 @@ outputs:
- {name: bigquery_table_id, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
- sh
- -ec
- |
@@ -296,7 +297,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -20,7 +20,7 @@ outputs:
- {name: tfrecord_file, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
@@ -187,7 +187,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -1,3 +1,4 @@
google-cloud-bigquery==2.20.0
tensorflow==2.5.2
tensorflow==2.7.2
pillow==9.0.1
tf-agents==0.8.0
@@ -1,2 +1,4 @@
google-cloud-pubsub==2.5.0
pillow==9.0.1
tf-agents==0.8.0
tensorflow==2.5.2
tensorflow==2.7.2
@@ -0,0 +1,5 @@
dataclasses==0.6
google-cloud-aiplatform==1.8.1
tensorflow==2.7.2
pillow==9.0.1
tf-agents==0.8.0
@@ -27,14 +27,14 @@ outputs:
- {name: training_artifacts_dir, type: String}
implementation:
container:
image: tensorflow/tensorflow:2.5.0
image: python:3.7
command:
- sh
- -c
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
--user) && "$0" "$@"
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
- sh
- -ec
- |
@@ -270,7 +270,8 @@ implementation:
def _serialize_str(str_value: str) -> str:
if not isinstance(str_value, str):
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
str(str_value), str(type(str_value))))
return str_value
import argparse
@@ -22,13 +22,13 @@ from src.training import task
# Paths and configurations
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
"[your-file-name].json") # FILL IN
"result.json") # FILL IN
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
# Hyperparameters
@@ -1 +1 @@
tensorflow==2.5.2
tensorflow==2.7.2
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -113,8 +113,8 @@
},
"outputs": [],
"source": [
"! gcloud beta ai custom-jobs local-run \\\n",
" --base-image=$BASE_IMAGE_URI \\\n",
"! gcloud ai custom-jobs local-run \\\n",
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
" --script=$SCRIPT_PATH \\\n",
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
" -- \\\n",
+5
View File
@@ -0,0 +1,5 @@
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product. These are tested weekly and maintained by Google.
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that may be created by Google or external contributors. They are not necessary maintained.
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
+22 -10
View File
@@ -3,16 +3,28 @@
# @global-owner1 and @global-owner2 will be requested for
# review when someone opens a pull request.
/sdk/sdk_* @aferlitsch
/gapic @aferlitsch
/ml_ops @aferlitsch
/model_monitoring/* @mco
/sdk/sdk_* @andrewferlitsch
/gapic @andrewferlitsch
/gapic/custom/showcase_custom_image_classification_online_explain_example_based_api.ipynb @inardini
/ml_ops @andrewferlitsch
/model_monitoring/* @mco-gh
/structured_data/rapid_prototyping_* @rafael-carvalho
/managed_notebooks/ @notebooks-team
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/managed_notebooks/
/bigquery_ml/ @polong
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
/sdk/SDK_AutoML_Forecasting_Model_Training_Example.ipynb @thehardikv
/sdk/sdk_automl_forecasting_evaluating_a_model.ipynb @thehardikv
/matching_engine @yinghsienwu
/neo4j @benofben @htappen
/explainable_ai/SDK_Custom_Container_XAI.ipynb @brianchunkang
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
/tensorboard @yfang1
/feature_store @nayaknishant @morgandu
/prediction @googleapis/vertex-prediction-team
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
/vertex_endpoints/optimized_tensorflow_runtime @vlasenkoalexey
/notebooks/community/ml_ops/stage2/get_started_with_visionapi_and_automl.ipynb @mansari
/notebooks/community/neo4j/graph_paysim.ipynb @benofben @laeg
/notebooks/community/ml_ops/stage1/get_started_with_visionapi_and_vertex_datasets.ipynb @mansari
/notebooks/community/pipelines/google_cloud_pipeline_components_bqml_pipeline_demand_forecasting.ipynb @inardini
File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -171,7 +171,7 @@
},
"outputs": [],
"source": [
"! pip install {USER_FLAG} --upgrade git+https://github.com/googleapis/python-aiplatform.git@v1.6.0"
"! pip install {USER_FLAG} --upgrade google-cloud-aiplatform"
]
},
{
@@ -266,7 +266,7 @@
"\n",
"# Get your Google Cloud project ID from gcloud\n",
"if not os.getenv(\"IS_TESTING\"):\n",
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
" PROJECT_ID = shell_output[0]\n",
" print(\"Project ID: \", PROJECT_ID)"
]
@@ -292,6 +292,37 @@
" PROJECT_ID = \"python-docs-samples-tests\" # @param {type:\"string\"}"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "d9f118b92c74"
},
"source": [
"#### UUID\n",
"\n",
"If you are in a live tutorial session, you might be using a shared test account or project. To avoid name collisions between users on resources created, you create a uuid for each instance session, and append it onto the name of resources you create in this tutorial."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "3ee72715c0fd"
},
"outputs": [],
"source": [
"import random\n",
"import string\n",
"\n",
"\n",
"# Generate a uuid of a specifed length(default=8)\n",
"def generate_uuid(length: int = 8) -> str:\n",
" return \"\".join(random.choices(string.ascii_lowercase + string.digits, k=length))\n",
"\n",
"\n",
"UUID = generate_uuid()"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -478,7 +509,6 @@
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore_service as featurestore_service_pb2\n",
"from google.cloud.aiplatform_v1.types import io as io_pb2\n",
"from google.protobuf.duration_pb2 import Duration\n",
"\n",
"# Create admin_client for CRUD and data_client for reading feature values.\n",
"admin_client = FeaturestoreServiceClient(client_options={\"api_endpoint\": API_ENDPOINT})\n",
@@ -542,30 +572,23 @@
},
"outputs": [],
"source": [
"FEATURESTORE_ID = \"movie_prediction\"\n",
"create_lro = admin_client.create_featurestore(\n",
" featurestore_service_pb2.CreateFeaturestoreRequest(\n",
" parent=BASE_RESOURCE_PATH,\n",
" featurestore_id=FEATURESTORE_ID,\n",
" featurestore=featurestore_pb2.Featurestore(\n",
" online_serving_config=featurestore_pb2.Featurestore.OnlineServingConfig(\n",
" fixed_node_count=1\n",
"FEATURESTORE_ID = f\"movie_prediction_{UUID}\"\n",
"try:\n",
" create_lro = admin_client.create_featurestore(\n",
" featurestore_service_pb2.CreateFeaturestoreRequest(\n",
" parent=BASE_RESOURCE_PATH,\n",
" featurestore_id=FEATURESTORE_ID,\n",
" featurestore=featurestore_pb2.Featurestore(\n",
" online_serving_config=featurestore_pb2.Featurestore.OnlineServingConfig(\n",
" fixed_node_count=1\n",
" ),\n",
" ),\n",
" ),\n",
" )\n",
" )\n",
")"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "57V8eVcB5VFZ"
},
"outputs": [],
"source": [
"# Wait for LRO to finish and get the LRO result.\n",
"print(create_lro.result())"
" # Wait for LRO to finish and get the LRO result.\n",
" print(create_lro.result())\n",
"except Exception as e:\n",
" print(e)"
]
},
{
@@ -574,7 +597,7 @@
"id": "ag8pCQ7rNjVf"
},
"source": [
"You can use [GetFeaturestore](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.GetFeaturestore) or [ListFeaturestores](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.ListFeaturestores) to check if the Featurestore was successfully created. The following example gets the details of the Featurestore.\n"
"You can use [GetFeaturestore](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.GetFeaturestore) or [ListFeaturestores](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.ListFeaturestores) to check if the Featurestore was successfully created. The following example gets the details of the Featurestore.\n"
]
},
{
@@ -590,6 +613,41 @@
")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "018ab19d934f"
},
"source": [
"Auto scaling is available in v1 since v1.11. Below is the example for the `CreateFeaturestoreRequest` with auto-scaling, use it with `aiplatform_v1.FeaturestoreServiceClient` to create Featurestore:"
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "aea39718b5d3"
},
"outputs": [],
"source": [
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore as v1_featurestore_pb2\n",
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore_service as v1_featurestore_service_pb2\n",
"\n",
"create_featurestore_request = v1_featurestore_service_pb2.CreateFeaturestoreRequest(\n",
" parent=BASE_RESOURCE_PATH,\n",
" featurestore_id=FEATURESTORE_ID,\n",
" featurestore=v1_featurestore_pb2.Featurestore(\n",
" online_serving_config=v1_featurestore_pb2.Featurestore.OnlineServingConfig(\n",
" scaling=v1_featurestore_pb2.Featurestore.OnlineServingConfig.Scaling(\n",
" min_node_count=1, max_node_count=5\n",
" )\n",
" ),\n",
" ),\n",
")"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -607,18 +665,20 @@
},
"outputs": [],
"source": [
"users_entity_type_lro = admin_client.create_entity_type(\n",
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
" entity_type_id=\"users\",\n",
" entity_type=entity_type_pb2.EntityType(\n",
" description=\"Users entity\",\n",
" ),\n",
"try:\n",
" users_entity_type_lro = admin_client.create_entity_type(\n",
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
" entity_type_id=\"users\",\n",
" entity_type=entity_type_pb2.EntityType(\n",
" description=\"Users entity\",\n",
" ),\n",
" )\n",
" )\n",
")\n",
"\n",
"# Similarly, wait for EntityType creation operation.\n",
"print(users_entity_type_lro.result())"
" # Similarly, wait for EntityType creation operation.\n",
" print(users_entity_type_lro.result())\n",
"except Exception as e:\n",
" print(e)"
]
},
{
@@ -630,16 +690,73 @@
"outputs": [],
"source": [
"# Create movies entity type without a monitoring configuration.\n",
"movies_entity_type_lro = admin_client.create_entity_type(\n",
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
" entity_type_id=\"movies\",\n",
" entity_type=entity_type_pb2.EntityType(description=\"Movies entity\"),\n",
"try:\n",
" movies_entity_type_lro = admin_client.create_entity_type(\n",
" featurestore_service_pb2.CreateEntityTypeRequest(\n",
" parent=admin_client.featurestore_path(PROJECT_ID, REGION, FEATURESTORE_ID),\n",
" entity_type_id=\"movies\",\n",
" entity_type=entity_type_pb2.EntityType(description=\"Movies entity\"),\n",
" )\n",
" )\n",
"\n",
" # Similarly, wait for EntityType creation operation.\n",
" print(movies_entity_type_lro.result())\n",
"except Exception as e:\n",
" print(e)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dPkT7KDuEvWv"
},
"source": [
"Feature [monitoring](https://cloud.google.com/vertex-ai/docs/featurestore/monitoring) is in preview, so you need to use v1 Python. Import feature analysis is only available through SDK for now."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "9kiqrBN6E28r"
},
"outputs": [],
"source": [
"from google.cloud.aiplatform_v1 import \\\n",
" FeaturestoreServiceClient as v1_FeaturestoreServiceClient\n",
"from google.cloud.aiplatform_v1.types import entity_type as v1_entity_type_pb2\n",
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore_monitoring as v1_featurestore_monitoring_pb2\n",
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore_service as v1_featurestore_service_pb2\n",
"\n",
"v1_admin_client = v1_FeaturestoreServiceClient(\n",
" client_options={\"api_endpoint\": API_ENDPOINT}\n",
")\n",
"\n",
"# Similarly, wait for EntityType creation operation.\n",
"print(movies_entity_type_lro.result())"
"# Enable import feature analysis for users entity type.\n",
"# All Features belonging to this EntityType will by default inherit the monitoring config.\n",
"v1_admin_client.update_entity_type(\n",
" v1_featurestore_service_pb2.UpdateEntityTypeRequest(\n",
" entity_type=v1_entity_type_pb2.EntityType(\n",
" name=admin_client.entity_type_path(\n",
" PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"\n",
" ),\n",
" monitoring_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig(\n",
" import_features_analysis=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ImportFeaturesAnalysis(\n",
" anomaly_detection_baseline=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ImportFeaturesAnalysis.Baseline.LATEST_STATS,\n",
" state=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ImportFeaturesAnalysis.State.ENABLED,\n",
" ),\n",
" numerical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
" value=0.001,\n",
" ),\n",
" categorical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
" value=0.001,\n",
" ),\n",
" ),\n",
" ),\n",
" )\n",
")"
]
},
{
@@ -648,7 +765,9 @@
"id": "85b1f59fbf6d"
},
"source": [
"Feature [monitoring](https://cloud.google.com/vertex-ai/docs/featurestore/monitoring) is in preview, so you need to use v1beta1 Python. The easiest way to set this for now is using [console UI](https://console.cloud.google.com/vertex-ai/features). For completeness, below is example to do this using v1beta1 SDK\n"
"The easiest way to set up snapshot analysis for now is using [console UI](https://console.cloud.google.com/vertex-ai/features). For completeness, below is example to do this using v1 SDK.\n",
"\n",
"You can view monitoring statistics on [console UI](https://console.cloud.google.com/vertex-ai/features)."
]
},
{
@@ -659,30 +778,36 @@
},
"outputs": [],
"source": [
"from google.cloud.aiplatform_v1beta1 import \\\n",
" FeaturestoreServiceClient as v1beta1_FeaturestoreServiceClient\n",
"from google.cloud.aiplatform_v1beta1.types import \\\n",
" entity_type as v1beta1_entity_type_pb2\n",
"from google.cloud.aiplatform_v1beta1.types import \\\n",
" featurestore_monitoring as v1beta1_featurestore_monitoring_pb2\n",
"from google.cloud.aiplatform_v1beta1.types import \\\n",
" featurestore_service as v1beta1_featurestore_service_pb2\n",
"from google.cloud.aiplatform_v1 import \\\n",
" FeaturestoreServiceClient as v1_FeaturestoreServiceClient\n",
"from google.cloud.aiplatform_v1.types import entity_type as v1_entity_type_pb2\n",
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore_monitoring as v1_featurestore_monitoring_pb2\n",
"from google.cloud.aiplatform_v1.types import \\\n",
" featurestore_service as v1_featurestore_service_pb2\n",
"\n",
"v1beta1_admin_client = v1beta1_FeaturestoreServiceClient(\n",
"v1_admin_client = v1_FeaturestoreServiceClient(\n",
" client_options={\"api_endpoint\": API_ENDPOINT}\n",
")\n",
"\n",
"# Enable monitoring for users entity type.\n",
"# Enable snapshot analysis for users entity type.\n",
"# All Features belonging to this EntityType will by default inherit the monitoring config.\n",
"v1beta1_admin_client.update_entity_type(\n",
" v1beta1_featurestore_service_pb2.UpdateEntityTypeRequest(\n",
" entity_type=v1beta1_entity_type_pb2.EntityType(\n",
"v1_admin_client.update_entity_type(\n",
" v1_featurestore_service_pb2.UpdateEntityTypeRequest(\n",
" entity_type=v1_entity_type_pb2.EntityType(\n",
" name=admin_client.entity_type_path(\n",
" PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"\n",
" ),\n",
" monitoring_config=v1beta1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig(\n",
" snapshot_analysis=v1beta1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.SnapshotAnalysis(\n",
" monitoring_interval=Duration(seconds=86400), # 1 day\n",
" monitoring_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig(\n",
" snapshot_analysis=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.SnapshotAnalysis(\n",
" monitoring_interval_days=1, # 1 day\n",
" staleness_days=30,\n",
" ),\n",
" numerical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
" value=0.001,\n",
" ),\n",
" categorical_threshold_config=v1_featurestore_monitoring_pb2.FeaturestoreMonitoringConfig.ThresholdConfig(\n",
" value=0.001,\n",
" ),\n",
" ),\n",
" ),\n",
@@ -708,32 +833,40 @@
"outputs": [],
"source": [
"# Create features for the 'users' entity.\n",
"admin_client.batch_create_features(\n",
" parent=admin_client.entity_type_path(PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"),\n",
" requests=[\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.INT64,\n",
" description=\"User age\",\n",
" ),\n",
" feature_id=\"age\",\n",
"try:\n",
" admin_client.batch_create_features(\n",
" parent=admin_client.entity_type_path(\n",
" PROJECT_ID, REGION, FEATURESTORE_ID, \"users\"\n",
" ),\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
" description=\"User gender\",\n",
" requests=[\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.INT64,\n",
" description=\"User age\",\n",
" disable_monitoring=False,\n",
" ),\n",
" feature_id=\"age\",\n",
" ),\n",
" feature_id=\"gender\",\n",
" ),\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING_ARRAY,\n",
" description=\"An array of genres that this user liked\",\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
" description=\"User gender\",\n",
" # Default is False. If True, Feature 'gender' monitoring analysis is disabled.\n",
" disable_monitoring=True,\n",
" ),\n",
" feature_id=\"gender\",\n",
" ),\n",
" feature_id=\"liked_genres\",\n",
" ),\n",
" ],\n",
").result()"
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING_ARRAY,\n",
" description=\"An array of genres that this user liked\",\n",
" ),\n",
" feature_id=\"liked_genres\",\n",
" ),\n",
" ],\n",
" ).result()\n",
"except Exception as e:\n",
" print(e)"
]
},
{
@@ -745,33 +878,37 @@
"outputs": [],
"source": [
"# Create features for movies type.\n",
"# 'title' Feature enables monitoring.\n",
"admin_client.batch_create_features(\n",
" parent=admin_client.entity_type_path(PROJECT_ID, REGION, FEATURESTORE_ID, \"movies\"),\n",
" requests=[\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
" description=\"The title of the movie\",\n",
" ),\n",
" feature_id=\"title\",\n",
"try:\n",
" admin_client.batch_create_features(\n",
" parent=admin_client.entity_type_path(\n",
" PROJECT_ID, REGION, FEATURESTORE_ID, \"movies\"\n",
" ),\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
" description=\"The genres of the movie\",\n",
" requests=[\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
" description=\"The title of the movie\",\n",
" ),\n",
" feature_id=\"title\",\n",
" ),\n",
" feature_id=\"genres\",\n",
" ),\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.DOUBLE,\n",
" description=\"The average rating for the movie, range is [1.0-5.0]\",\n",
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.STRING,\n",
" description=\"The genres of the movie\",\n",
" ),\n",
" feature_id=\"genres\",\n",
" ),\n",
" feature_id=\"average_rating\",\n",
" ),\n",
" ],\n",
").result()"
" featurestore_service_pb2.CreateFeatureRequest(\n",
" feature=feature_pb2.Feature(\n",
" value_type=feature_pb2.Feature.ValueType.DOUBLE,\n",
" description=\"The average rating for the movie, range is [1.0-5.0]\",\n",
" ),\n",
" feature_id=\"average_rating\",\n",
" ),\n",
" ],\n",
" ).result()\n",
"except Exception as e:\n",
" print(e)"
]
},
{
@@ -782,8 +919,8 @@
"source": [
"## Search created features\n",
"\n",
"While the [ListFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.ListFeatures) method allows you to easily view all features of a single\n",
"entity type, the [SearchFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#google.cloud.aiplatform.v1beta1.FeaturestoreService.SearchFeatures) method searches across all featurestores\n",
"While the [ListFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.ListFeatures) method allows you to easily view all features of a single\n",
"entity type, the [SearchFeatures](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#google.cloud.aiplatform.v1.FeaturestoreService.SearchFeatures) method searches across all featurestores\n",
"and entity types in a given location (such as `us-central1`). This can help you discover features that were created by someone else.\n",
"\n",
"You can query based on feature properties including feature ID, entity type ID,\n",
@@ -985,6 +1122,8 @@
" ],\n",
" feature_time_field=\"update_time\",\n",
" worker_count=1,\n",
" # Default is False. If True, the import feature analysis won't happen for this specific operation.\n",
" disable_ingestion_analysis=False,\n",
")"
]
},
@@ -1095,7 +1234,7 @@
},
"source": [
"The\n",
"[Online Serving APIs](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1beta1#featurestoreonlineservingservice)\n",
"[Online Serving APIs](https://cloud.google.com/vertex-ai/docs/reference/rpc/google.cloud.aiplatform.v1#featurestoreonlineservingservice)\n",
"lets you serve feature values for small batches of entities. It's designed for latency-sensitive service, such as online model prediction. For example, for a movie service, you might want to quickly shows movies that the current user would most likely watch by using online predictions."
]
},
@@ -1393,9 +1532,7 @@
],
"metadata": {
"colab": {
"collapsed_sections": [
"ze4-nDLfK4pw"
],
"collapsed_sections": [],
"name": "gapic-feature-store.ipynb",
"toc_visible": true
},
Binary file not shown.

After

Width:  |  Height:  |  Size: 83 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 141 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 230 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 140 KiB

Binary file not shown.

After

Width:  |  Height:  |  Size: 140 KiB

File diff suppressed because it is too large Load Diff
File diff suppressed because it is too large Load Diff
@@ -459,7 +459,7 @@
},
"outputs": [],
"source": [
"! gsutil cp gs://cloud-samples-data/ai-platform-unified/matching_engine/glove-100-angular.hdf5 ."
"! gsutil cp gs://cloud-samples-data/vertex-ai/matching_engine/glove-100-angular.hdf5 ."
]
},
{
+2 -2
View File
@@ -12,7 +12,7 @@ The purpose of this set of notebooks and markdown files is to demonstrate Google
2. [Experimentation](stage2)
3. [Formalization](stage3)
4. [Evaluation](stage4)
5. Deployment
6. Serving
5. [Deployment](stage5)
6. [Serving](stage6)
7. Monitoring
8. Continuous Training
+76 -4
View File
@@ -22,18 +22,90 @@ The first stage in MLOps is the collection and preparation for the purpose of de
- Data is preprocessed for training and evaluation using Dataflow.
- Data augmentation is performed on-the-fly and is coupled with model feeding.
<img src='stage1.jpg'>
<img src='stage1v2.png'>
## Notebooks
### Get Started
[Get Started with BQ datasets](get_started_bq_datasets.ipynb)
[Get started with Vertex AI datasets](get_started_vertex_datasets.ipynb)
[Get Started with Vertex datasets](get_started_vertex_datasets.ipynb)
```
The steps performed include:
- Create a Vertex AI `Dataset` resource for:
- image data
- text data
- video data
- tabular data
- forecasting data
- Search `Dataset` resources using a filter.
- Read a sample of a `BigQuery` dataset into a dataframe.
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
- Detect anomalies in new data using TensorFlow Data Validation.
- Generate a TFRecord feature specification using TensorFlow Transform from the data schema.
- Export a dataset and convert to TFRecords.
```
[Get Started with Dataflow](get_started_dataflow.ipynb)
[Get started with Dataflow](get_started_dataflow.ipynb)
```
The steps performed include:
- Offline preprocessing of data:
- Serially - w/o dataflow
- Parallel - with dataflow
- Upstream preprocessing of data:
- tabular data
- image data
```
[Create an unlabelled Vertex AI AutoML text entity extraction dataset from pdfs using Vision API](get_started_with_visionapi_and_vertex_datasets.ipynb)
```
The steps performed include:
1. Using `Vision API` to perform Optical Character Recognition (OCR) to extract text from PDF files.
2. Processing the results and saving them to text files.
3. Generating a `Vertex AI Dataset` import file.
4. Creating a new unlabelled text entity extraction `Vertex AI Dataset` resource in `Vertex AI`.
```
[Get started with BigQuery datasets](get_started_bq_datasets.ipynb)
```
The steps performed include:
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- compatible for `AutoML` training.
- Extract a copy of the dataset from `BigQuery` to a CSV file in Cloud Storage -- compatible for `AutoML` or custom training.
- Select rows from a `BigQuery` dataset into a `pandas` dataframe -- compatible for custom training.
- Select rows from a `BigQuery` dataset into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
- Select rows from extracted CSV files into a `tf.data.Dataset` -- compatible for custom training `TensorFlow` models.
- Create a `BigQuery` dataset from CSV files.
- Extract data from `BigQuery` table into a `DMatrix` -- compatible for custom training `XGBoost` models.
```
[Get started with Vertex AI data labeling](get_started_with_data_labeling.ipynb)
```
The steps performed include:
- Create a Specialist Pool for data labelers.
- Create a data labeling job.
- Submit the data labeling job.
- List data labeling jobs.
- Cancel a data labeling job.
```
### E2E Stage Example
[Stage 1: Data Management](mlops_data_management.ipynb)
```
The steps performed include:
- Explore and visualize the data.
- Create a Vertex AI `Dataset` resource from `BigQuery` table -- for AutoML training.
- Extract a copy of the dataset to a CSV file in Cloud Storage.
- Create a Vertex AI `Dataset` resource from CSV files -- alternative for AutoML training.
- Read a sample of the `BigQuery` dataset into a dataframe.
- Generate statistics and data schema using TensorFlow Data Validation from the samples in the dataframe.
- Generate a TFRecord feature specification using TensorFlow Data Validation from the data schema.
- Preprocess a portion of the BigQuery data using `Dataflow` -- for custom training.
```
@@ -8,7 +8,7 @@
},
"outputs": [],
"source": [
"# Copyright 2021 Google LLC\n",
"# Copyright 2022 Google LLC\n",
"#\n",
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
"# you may not use this file except in compliance with the License.\n",
@@ -34,13 +34,18 @@
"<table align=\"left\">\n",
" <td>\n",
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"GitHub logo\">\n",
" View on GitHub\n",
" </a>\n",
" <td>\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/main/notebooks/community/ml_ops/stage1/get_started_bq_datasets.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -59,17 +64,6 @@
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 1 : data management: get started with BigQuery datasets."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dataset:gsod,lrg"
},
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -104,7 +98,7 @@
"source": [
"### Recommendations\n",
"\n",
"When doing E2E MLOps on Google Cloud, the following best practices with structured (tabular) data in BigQuery:\n",
"When doing E2E MLOps on Google Cloud, following are the best practices when dealing with structured (tabular) data in BigQuery:\n",
"\n",
"- For AutoML training:\n",
" - Create a managed dataset with Vertex AI `TabularDataset`.\n",
@@ -124,7 +118,7 @@
" - Within the generator (upstream)\n",
" - Within the model (downstream)\n",
" - XGBoost model training:\n",
" - Use BigQuery ML builtin XGBoost training.\n",
" - Use BigQuery ML built-in XGBoost training.\n",
" - Alternatively, create a DMatrix generator from CSV files extracted from BigQuery table.\n",
" - Pytorch model training:\n",
" - Extract the BigQuery to a pandas dataframe.\n",
@@ -132,12 +126,39 @@
" - Create a DataLoader generator from the pandas dataframe.\n",
"\n",
"\n",
"- Alternately:\n",
"- Alternatively:\n",
" - Extract the BigQuery table to CSV files.\n",
" - Preprocess the CSV files.\n",
" - Create a tf.data.Dataset generator from the CSV files."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dataset:gsod,lrg"
},
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). In this version of the dataset you consider the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9e483012a752"
},
"source": [
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Cloud Storage\n",
"- BigQuery\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing) and [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -146,7 +167,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages to execute this notebook."
]
},
{
@@ -157,40 +178,26 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "install_xgboost"
},
"source": [
"Install the latest GA version of *XGBoost* library as well."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "install_xgboost"
},
"outputs": [],
"source": [
"! pip3 install -U xgboost $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\") and not os.getenv(\"VIRTUAL_ENV\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"# Install the packages\n",
"! pip3 install --upgrade pyarrow $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
"! pip3 install -U xgboost $USER_FLAG -q\n",
"! pip3 install -U tensorflow $USER_FLAG -q\n",
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q"
]
},
{
@@ -222,6 +229,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "84cd83853240"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -298,7 +331,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -325,6 +361,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77c385f0db59"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "535223fa4b84"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -335,12 +432,7 @@
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"When you submit a custom training job using the Vertex SDK, you upload a Python package\n",
"containing your training code to a Cloud Storage bucket. Vertex AI runs\n",
"the code from this package. In this tutorial, Vertex AI also saves the\n",
"trained model that results from your job in the same bucket. You can then\n",
"create an `Endpoint` resource based on this output in order to serve\n",
"online predictions.\n",
"When you create a dataset resource using the Vertex SDK, you can provide a Cloud Storage bucket that contains the data. Vertex AI creates the dataset resource from the data. In this tutorial, Vertex AI also creates a dataset resource from your data in the Cloud Storage bucket.\n",
"\n",
"Set the name of your Cloud Storage bucket below. Bucket names must be globally unique across all Google Cloud projects, including those outside of your organization."
]
@@ -353,7 +445,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -364,8 +457,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -385,7 +479,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -405,7 +499,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -414,9 +508,6 @@
"id": "setup_vars"
},
"source": [
"### Set up variables\n",
"\n",
"Next, set up some variables used throughout the tutorial.\n",
"### Import libraries and define constants"
]
},
@@ -428,75 +519,12 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_bq"
},
"source": [
"#### Import BigQuery\n",
"\n",
"Import the BigQuery package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_bq"
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aiplatform\n",
"import pandas as pd\n",
"import xgboost as xgb\n",
"from google.cloud import bigquery"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_xgboost"
},
"source": [
"#### Import XGBoost\n",
"\n",
"Import the XGBoost package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_xgboost"
},
"outputs": [],
"source": [
"import xgboost as xgb"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "import_pandas"
},
"source": [
"#### Import pandas\n",
"\n",
"Import the pandas package into your Python environment."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "import_pandas"
},
"outputs": [],
"source": [
"import pandas as pd"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -516,7 +544,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, location=REGION)"
"aiplatform.init(project=PROJECT_ID, location=REGION)"
]
},
{
@@ -538,7 +566,7 @@
},
"outputs": [],
"source": [
"bqclient = bigquery.Client()"
"bqclient = bigquery.Client(project=PROJECT_ID)"
]
},
{
@@ -549,7 +577,7 @@
"source": [
"#### Location of BigQuery training data.\n",
"\n",
"Now set the variable `IMPORT_FILE` to the location of the data table in BigQuery."
"Now, set the variable `IMPORT_FILE` to the location of the data table in BigQuery and `BQ_TABLE` with the table id."
]
},
{
@@ -591,10 +619,10 @@
},
"outputs": [],
"source": [
"dataset = aip.TabularDataset.create(\n",
"dataset = aiplatform.TabularDataset.create(\n",
" display_name=\"NOAA historical weather data\" + \"_\" + TIMESTAMP,\n",
" bq_source=[IMPORT_FILE],\n",
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
" labels={\"user_metadata\": BUCKET_URI[5:]},\n",
")\n",
"\n",
"label_column = \"mean_temp\"\n",
@@ -610,7 +638,7 @@
"source": [
"### Copy the dataset to Cloud Storage\n",
"\n",
"Next, you make a copy of the BigQuery dataset, as a CSV file, to Cloud Storage using the BigQuery extract command.\n",
"Next, you make a copy of the BigQuery table as a CSV file, to Cloud Storage using the BigQuery extract command.\n",
"\n",
"Learn more about [BigQuery command line interface](https://cloud.google.com/bigquery/docs/reference/bq-cli-reference)."
]
@@ -626,9 +654,9 @@
"comps = BQ_TABLE.split(\".\")\n",
"BQ_PROJECT_DATASET_TABLE = comps[0] + \":\" + comps[1] + \".\" + comps[2]\n",
"\n",
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_NAME/mydata*.csv\n",
"! bq --location=us extract --destination_format CSV $BQ_PROJECT_DATASET_TABLE $BUCKET_URI/mydata*.csv\n",
"\n",
"IMPORT_FILES = ! gsutil ls $BUCKET_NAME/mydata*.csv\n",
"IMPORT_FILES = ! gsutil ls $BUCKET_URI/mydata*.csv\n",
"\n",
"print(IMPORT_FILES)\n",
"\n",
@@ -664,15 +692,12 @@
},
"outputs": [],
"source": [
"if \"IMPORT_FILES\" in globals():\n",
" gcs_source = IMPORT_FILES\n",
"else:\n",
" gcs_source = [IMPORT_FILE]\n",
"gcs_source = IMPORT_FILES\n",
"\n",
"dataset = aip.TabularDataset.create(\n",
"dataset = aiplatform.TabularDataset.create(\n",
" display_name=\"NOAA historical weather data\" + \"_\" + TIMESTAMP,\n",
" gcs_source=gcs_source,\n",
" labels={\"user_metadata\": BUCKET_NAME[5:]},\n",
" labels={\"user_metadata\": BUCKET_URI[5:]},\n",
")\n",
"\n",
"\n",
@@ -694,6 +719,30 @@
"Learn more about [Creating BigQuery views](https://cloud.google.com/bigquery/docs/views)."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "7dc142433e50"
},
"outputs": [],
"source": [
"# Set dataset name and view name in BigQuery\n",
"BQ_MY_DATASET = \"[your-dataset-name]\"\n",
"BQ_MY_TABLE = \"[your-view-name]\"\n",
"\n",
"# Otherwise, use the default names\n",
"if (\n",
" BQ_MY_DATASET == \"\"\n",
" or BQ_MY_DATASET is None\n",
" or BQ_MY_DATASET == \"[your-dataset-name]\"\n",
"):\n",
" BQ_MY_DATASET = \"mlops_dataset_\" + TIMESTAMP\n",
"\n",
"if BQ_MY_TABLE == \"\" or BQ_MY_TABLE is None or BQ_MY_TABLE == \"[your-view-name]\":\n",
" BQ_MY_TABLE = \"mlops_view_\" + TIMESTAMP"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -702,8 +751,7 @@
},
"outputs": [],
"source": [
"BQ_MY_DATASET = 'mydataset'\n",
"BQ_MY_TABLE = 'myview'\n",
"# Create the resources\n",
"! bq --location=US mk -d \\\n",
"$PROJECT_ID:$BQ_MY_DATASET\n",
"\n",
@@ -744,8 +792,8 @@
},
"outputs": [],
"source": [
"# Download a table.\n",
"table = bigquery.TableReference.from_string(\"bigquery-public-data.samples.gsod\")\n",
"# Download the table.\n",
"table = bigquery.TableReference.from_string(BQ_TABLE)\n",
"\n",
"rows = bqclient.list_rows(\n",
" table,\n",
@@ -1031,22 +1079,6 @@
"TABLE_ID = \"gsod\"\n",
"\n",
"\n",
"def create_bigquery_dataset(dataset_id):\n",
" dataset = bigquery.Dataset(\n",
" bigquery.dataset.DatasetReference(PROJECT_ID, dataset_id)\n",
" )\n",
" dataset.location = \"us\"\n",
"\n",
" try:\n",
" dataset = bqclient.create_dataset(dataset) # API request\n",
" return True\n",
" except Exception as err:\n",
" print(err)\n",
" if err.code != 409: # http_client.CONFLICT\n",
" raise\n",
" return False\n",
"\n",
"\n",
"def load_data_into_bigquery(url, dataset_id, table_id):\n",
" create_bigquery_dataset(dataset_id)\n",
" dataset = bqclient.dataset(dataset_id)\n",
@@ -1079,13 +1111,11 @@
"source": [
"### Read BigQuery table into XGboost DMatrix\n",
"\n",
"Currently, there is no direct data feeding connector between BigQuery and the open source XGBoost.\n",
"Currently, there is no direct data feeding connector between BigQuery and the open source XGBoost. The BigQuery ML service has a built-in XGBoost training module.\n",
"\n",
"The BigQuery ML service has XGBoost training builtin.\n",
"Alernatively, you extract the data either as a pandas dataframe or as CSV files. The extracted data is then given as an input to a `DMatrix` object when training the model.\n",
"\n",
"Alernatively, you extract the data either as a pandas dataframe or as CSV files. The extracted data is then inputted to a `DMatrix` object when training the model.\n",
"\n",
"Learn more about [Getting started with builtin XGBoost](https://cloud.google.com/ai-platform/training/docs/algorithms/xgboost-start)"
"Learn more about [Getting started with built-in XGBoost](https://cloud.google.com/ai-platform/training/docs/algorithms/xgboost-start)."
]
},
{
@@ -1096,7 +1126,7 @@
"source": [
"### Read pandas table into XGboost DMatrix\n",
"\n",
"Next, you load the pandas dataframe into a `DMatrix` object. XGBoost does not support non-numeric inputs. Any column that is categorical will need to be one-hot encoded prior to loading the dataframe."
"Next, you load the pandas dataframe into a `DMatrix` object. XGBoost does not support non-numeric inputs. Any column that is categorical need to be one-hot encoded prior to loading the dataframe."
]
},
{
@@ -1109,7 +1139,7 @@
"source": [
"dataframe[\"station_number\"] = pd.to_numeric(dataframe[\"station_number\"])\n",
"labels = dataframe[\"mean_temp\"]\n",
"data = dataframe.drop(4)\n",
"data = dataframe.drop([\"mean_temp\"], axis=1)\n",
"\n",
"dtrain = xgb.DMatrix(data, label=labels)"
]
@@ -1122,7 +1152,7 @@
"source": [
"### Read CSV files into XGboost DMatrix\n",
"\n",
"Currently, there is no Cloud Storage support in XGBoost. If you use CSV files for input, you will need to download them locally."
"Currently, there is no Cloud Storage support in XGBoost. If you use CSV files for input, you need to download them locally."
]
},
{
@@ -1144,87 +1174,42 @@
"id": "cleanup:mbsdk"
},
"source": [
"# Cleaning up\n",
"# Clean up\n",
"\n",
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"- Vertex AI Dataset resource\n",
"- Cloud Storage Bucket\n",
"- BigQuery Dataset\n",
"\n",
"Set `delete_storage` to _True_ to delete the storage resources used in this notebook."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "cleanup:mbsdk"
"id": "47ad926d84e8"
},
"outputs": [],
"source": [
"delete_all = True\n",
"import os\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Delete the dataset using the Vertex dataset object\n",
"dataset.delete()\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"# Delete the temporary BigQuery dataset\n",
"! bq rm -r -f $PROJECT_ID:$DATASET_ID\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"delete_storage = False\n",
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
" # Delete the created GCS bucket\n",
" ! gsutil rm -r $BUCKET_URI\n",
" # Delete the created BigQuery datasets\n",
" ! bq rm -r -f $PROJECT_ID:$BQ_MY_DATASET"
]
}
],
@@ -39,8 +39,14 @@
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/ai/platform/notebooks/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
" Open in Google Cloud Notebooks\n",
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\\\" alt=\"Colab logo\"> Run in Colab\n",
" </a>\n",
" </td>\n",
" <td>\n",
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/ml_ops/stage1/get_started_dataflow.ipynb\">\n",
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
" Open in Vertex AI Workbench\n",
" </a>\n",
" </td>\n",
"</table>\n",
@@ -59,17 +65,6 @@
"This tutorial demonstrates how to use Vertex AI for E2E MLOps on Google Cloud in production. This tutorial covers stage 1 : data management: get started with Dataflow."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dataset:gsod,lrg"
},
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -131,6 +126,34 @@
"Alternately for AutoML tabular model training, you can reconfigure the otherwise default preprocessing."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "dataset:gsod,lrg"
},
"source": [
"### Dataset\n",
"\n",
"The dataset used for this tutorial is the GSOD dataset from [BigQuery public datasets](https://cloud.google.com/bigquery/public-data). The version of the dataset you use only the fields year, month and day to predict the value of mean daily temperature (mean_temp)."
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "9e483012a752"
},
"source": [
"### Costs\n",
"This tutorial uses billable components of Google Cloud:\n",
"\n",
"- Vertex AI\n",
"- Cloud Storage\n",
"- BigQuery\n",
"- Dataflow\n",
"\n",
"Learn about [Vertex AI pricing](https://cloud.google.com/vertex-ai/pricing), [Cloud Storage pricing](https://cloud.google.com/storage/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing), and [Dataflow pricing](https://cloud.google.com/dataflow/pricing) and use the [Pricing Calculator](https://cloud.google.com/products/calculator/) to generate a cost estimate based on your projected usage."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -139,7 +162,7 @@
"source": [
"## Installations\n",
"\n",
"Install *one time* the packages for executing the MLOps notebooks."
"Install the following packages to execute this notebook."
]
},
{
@@ -150,20 +173,26 @@
},
"outputs": [],
"source": [
"ONCE_ONLY = False\n",
"if ONCE_ONLY:\n",
" ! pip3 install -U tensorflow==2.5 $USER_FLAG\n",
" ! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-transform==1.2 $USER_FLAG\n",
" ! pip3 install -U tensorflow-io==0.18 $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-aiplatform[tensorboard] $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-pipeline-components $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-bigquery $USER_FLAG\n",
" ! pip3 install --upgrade google-cloud-logging $USER_FLAG\n",
" ! pip3 install --upgrade apache-beam[gcp] $USER_FLAG\n",
" ! pip3 install --upgrade pyarrow $USER_FLAG\n",
" ! pip3 install --upgrade cloudml-hypertune $USER_FLAG\n",
" ! pip3 install --upgrade kfp $USER_FLAG"
"import os\n",
"\n",
"# The Vertex AI Workbench Notebook product has specific requirements\n",
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\") and not os.getenv(\"VIRTUAL_ENV\")\n",
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
" \"/opt/deeplearning/metadata/env_version\"\n",
")\n",
"\n",
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
"USER_FLAG = \"\"\n",
"if IS_WORKBENCH_NOTEBOOK:\n",
" USER_FLAG = \"--user\"\n",
"\n",
"! pip3 install -U tensorflow==2.5 $USER_FLAG -q\n",
"! pip3 install -U tensorflow-data-validation==1.2 $USER_FLAG -q\n",
"! pip3 install -U tensorflow-transform==1.2 $USER_FLAG -q\n",
"! pip3 install -U tensorflow-io==0.18 $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-aiplatform $USER_FLAG -q\n",
"! pip3 install --upgrade google-cloud-bigquery $USER_FLAG -q\n",
"! pip3 install --upgrade apache-beam[gcp] $USER_FLAG -q"
]
},
{
@@ -195,6 +224,32 @@
" app.kernel.do_shutdown(True)"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "84cd83853240"
},
"source": [
"## Before you begin\n",
"\n",
"### Set up your Google Cloud project\n",
"\n",
"**The following steps are required, regardless of your notebook environment.**\n",
"\n",
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
"\n",
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
"\n",
"1. [Enable the Vertex AI, BigQuery, Compute Engine and Cloud Storage APIs](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com,bigquery,compute_component,storage_component).\n",
"\n",
"1. If you are running this notebook locally, you need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
"\n",
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
"Cloud SDK uses the right project for all the commands in this notebook.\n",
"\n",
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -271,7 +326,10 @@
},
"outputs": [],
"source": [
"REGION = \"us-central1\" # @param {type: \"string\"}"
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
"\n",
"if REGION == \"[your-region]\":\n",
" REGION = \"us-central1\""
]
},
{
@@ -298,6 +356,67 @@
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "77c385f0db59"
},
"source": [
"### Authenticate your Google Cloud account\n",
"\n",
"**If you are using Vertex AI Workbench Notebooks**, your environment is already authenticated. Skip this step.\n",
"\n",
"**If you are using Colab**, run the cell below and follow the instructions when prompted to authenticate your account via oAuth.\n",
"\n",
"**Otherwise**, follow these steps:\n",
"\n",
"In the Cloud Console, go to the [Create service account key](https://console.cloud.google.com/apis/credentials/serviceaccountkey) page.\n",
"\n",
"1. **Click Create service account**.\n",
"\n",
"2. In the **Service account name** field, enter a name, and click **Create**.\n",
"\n",
"3. In the **Grant this service account access to project** section, click the Role drop-down list. Type \"Vertex AI\" into the filter box, and select **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
"\n",
"4. Click Create. A JSON file that contains your key downloads to your local environment.\n",
"\n",
"5. Enter the path to your service account key as the GOOGLE_APPLICATION_CREDENTIALS variable in the cell below and run the cell."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "535223fa4b84"
},
"outputs": [],
"source": [
"# If you are running this notebook in Colab, run this cell and follow the\n",
"# instructions to authenticate your GCP account. This provides access to your\n",
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
"# requests.\n",
"\n",
"import os\n",
"import sys\n",
"\n",
"# If on Vertex AI Workbench, then don't execute this code\n",
"IS_COLAB = False\n",
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
" \"DL_ANACONDA_HOME\"\n",
"):\n",
" if \"google.colab\" in sys.modules:\n",
" IS_COLAB = True\n",
" from google.colab import auth as google_auth\n",
"\n",
" google_auth.authenticate_user()\n",
"\n",
" # If you are running this notebook locally, replace the string below with the\n",
" # path to your service account key and run this cell to authenticate your GCP\n",
" # account.\n",
" elif not os.getenv(\"IS_TESTING\"):\n",
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
]
},
{
"cell_type": "markdown",
"metadata": {
@@ -326,7 +445,8 @@
},
"outputs": [],
"source": [
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}"
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
]
},
{
@@ -337,8 +457,9 @@
},
"outputs": [],
"source": [
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
]
},
{
@@ -358,7 +479,7 @@
},
"outputs": [],
"source": [
"! gsutil mb -l $REGION $BUCKET_NAME"
"! gsutil mb -l $REGION $BUCKET_URI"
]
},
{
@@ -378,7 +499,7 @@
},
"outputs": [],
"source": [
"! gsutil ls -al $BUCKET_NAME"
"! gsutil ls -al $BUCKET_URI"
]
},
{
@@ -401,7 +522,7 @@
},
"outputs": [],
"source": [
"import google.cloud.aiplatform as aip"
"import google.cloud.aiplatform as aiplatform"
]
},
{
@@ -555,7 +676,7 @@
},
"outputs": [],
"source": [
"aip.init(project=PROJECT_ID, location=REGION)"
"aiplatform.init(project=PROJECT_ID, location=REGION)"
]
},
{
@@ -676,6 +797,31 @@
"dataframe[\"station_number\"] = pd.to_numeric(dataframe[\"station_number\"])"
]
},
{
"cell_type": "markdown",
"metadata": {
"id": "bqml_create_dataset"
},
"source": [
"### Create BQ dataset resource\n",
"\n",
"First, you create an empty dataset resource in your project."
]
},
{
"cell_type": "code",
"execution_count": null,
"metadata": {
"id": "bqml_create_dataset"
},
"outputs": [],
"source": [
"BQ_MY_DATASET = 'samples'\n",
"BQ_MY_TABLE = 'gsod'\n",
"! bq --location=US mk -d \\\n",
"$PROJECT_ID:$BQ_MY_DATASET"
]
},
{
"cell_type": "code",
"execution_count": null,
@@ -979,7 +1125,7 @@
},
"outputs": [],
"source": [
"SCHEMA_LOCATION = BUCKET_NAME + \"/schema.txt\"\n",
"SCHEMA_LOCATION = BUCKET_URI + \"/schema.txt\"\n",
"\n",
"# When running Apache Beam directly (file is directly accessed)\n",
"tfdv.write_schema_text(output_path=SCHEMA_LOCATION, schema=schema)\n",
@@ -1124,7 +1270,7 @@
" )\n",
"\n",
"\n",
"EXPORTED_DATA_PREFIX = os.path.join(BUCKET_NAME, \"exported_data\")\n",
"EXPORTED_DATA_PREFIX = os.path.join(BUCKET_URI, \"exported_data\")\n",
"\n",
"QUERY_STRING = \"SELECT {},{} FROM {} LIMIT 500\".format(\n",
" \"CAST(station_number as STRING) AS station_number,year,month,day\",\n",
@@ -1137,7 +1283,7 @@
" \"runner\": RUNNER,\n",
" \"raw_data_query\": QUERY_STRING,\n",
" \"exported_data_prefix\": EXPORTED_DATA_PREFIX,\n",
" \"temp_location\": os.path.join(BUCKET_NAME, \"temp\"),\n",
" \"temp_location\": os.path.join(BUCKET_URI, \"temp\"),\n",
" \"project\": PROJECT_ID,\n",
" \"region\": REGION,\n",
" \"setup_file\": \"./setup.py\",\n",
@@ -1162,17 +1308,7 @@
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
"\n",
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
"\n",
"- Dataset\n",
"- Pipeline\n",
"- Model\n",
"- Endpoint\n",
"- AutoML Training Job\n",
"- Batch Job\n",
"- Custom Job\n",
"- Hyperparameter Tuning Job\n",
"- Cloud Storage Bucket"
"Otherwise, you can delete the individual resources you created in this tutorial."
]
},
{
@@ -1183,61 +1319,11 @@
},
"outputs": [],
"source": [
"delete_all = True\n",
"delete_storage = True\n",
"\n",
"if delete_all:\n",
" # Delete the dataset using the Vertex dataset object\n",
" try:\n",
" if \"dataset\" in globals():\n",
" dataset.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the model using the Vertex model object\n",
" try:\n",
" if \"model\" in globals():\n",
" model.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the endpoint using the Vertex endpoint object\n",
" try:\n",
" if \"endpoint\" in globals():\n",
" endpoint.undeploy_all()\n",
" endpoint.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the AutoML or Pipeline training job\n",
" try:\n",
" if \"dag\" in globals():\n",
" dag.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the custom training job\n",
" try:\n",
" if \"job\" in globals():\n",
" job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the batch prediction job using the Vertex batch prediction object\n",
" try:\n",
" if \"batch_predict_job\" in globals():\n",
" batch_predict_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" # Delete the hyperparameter tuning job using the Vertex hyperparameter tuning object\n",
" try:\n",
" if \"hpt_job\" in globals():\n",
" hpt_job.delete()\n",
" except Exception as e:\n",
" print(e)\n",
"\n",
" if \"BUCKET_NAME\" in globals():\n",
" ! gsutil rm -r $BUCKET_NAME"
"if delete_storage or os.getenv(\"IS_TESTING\"):\n",
" if \"BUCKET_URI\" in globals():\n",
" ! gsutil rm -r $BUCKET_URI"
]
}
],

Some files were not shown because too many files have changed in this diff Show More