Compare commits
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
9631188501 | ||
|
|
ec9cff0c21 | ||
|
|
a7b9a67873 | ||
|
|
2e040227d6 |
@@ -13,28 +13,34 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
import argparse
|
||||
import concurrent
|
||||
import dataclasses
|
||||
import datetime
|
||||
import functools
|
||||
import git
|
||||
import operator
|
||||
import os
|
||||
import pathlib
|
||||
import nbformat
|
||||
import re
|
||||
import subprocess
|
||||
from typing import List, Optional
|
||||
|
||||
import execute_notebook_helper
|
||||
import execute_notebook_remote
|
||||
import nbformat
|
||||
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
|
||||
from ratemate import RateLimit
|
||||
from tabulate import tabulate
|
||||
from utils import NotebookProcessors, util
|
||||
import operator
|
||||
|
||||
# A buffer so that workers finish before the orchestrating job
|
||||
WORKER_TIMEOUT_BUFFER_IN_SECONDS: int = 60 * 60
|
||||
import execute_notebook_remote
|
||||
from utils import util, NotebookProcessors
|
||||
from google.cloud.devtools.cloudbuild_v1.types import BuildOperationMetadata
|
||||
|
||||
|
||||
def str2bool(v):
|
||||
if isinstance(v, bool):
|
||||
return v
|
||||
if v.lower() in ("yes", "true", "t", "y", "1"):
|
||||
return True
|
||||
elif v.lower() in ("no", "false", "f", "n", "0"):
|
||||
return False
|
||||
else:
|
||||
raise argparse.ArgumentTypeError("Boolean value expected.")
|
||||
|
||||
|
||||
def format_timedelta(delta: datetime.timedelta) -> str:
|
||||
@@ -68,20 +74,11 @@ class NotebookExecutionResult:
|
||||
build_id: str
|
||||
error_message: Optional[str]
|
||||
|
||||
@property
|
||||
def output_uri_web(self) -> Optional[str]:
|
||||
if self.output_uri.startswith("gs://"):
|
||||
return f"https://storage.googleapis.com/{self.output_uri[5:]}"
|
||||
else:
|
||||
return None
|
||||
|
||||
|
||||
def _process_notebook(
|
||||
notebook_path: str,
|
||||
variable_project_id: str,
|
||||
variable_region: str,
|
||||
variable_service_account: str,
|
||||
variable_vpc_network: Optional[str],
|
||||
):
|
||||
# Read notebook
|
||||
with open(notebook_path) as f:
|
||||
@@ -93,8 +90,6 @@ def _process_notebook(
|
||||
replacement_map={
|
||||
"PROJECT_ID": variable_project_id,
|
||||
"REGION": variable_region,
|
||||
"SERVICE_ACCOUNT": variable_service_account,
|
||||
"VPC_NETWORK": variable_vpc_network,
|
||||
},
|
||||
)
|
||||
|
||||
@@ -120,33 +115,17 @@ def _create_tag(filepath: str) -> str:
|
||||
return tag
|
||||
|
||||
|
||||
rate_limit = RateLimit(max_count=50, per=60, greedy=True)
|
||||
|
||||
|
||||
def process_and_execute_notebook(
|
||||
def execute_notebook(
|
||||
container_uri: str,
|
||||
staging_bucket: str,
|
||||
artifacts_bucket: str,
|
||||
variable_project_id: str,
|
||||
variable_region: str,
|
||||
variable_service_account: str,
|
||||
variable_vpc_network: Optional[str],
|
||||
private_pool_id: Optional[str],
|
||||
deadline: datetime.datetime,
|
||||
notebook: str,
|
||||
should_get_tail_logs: bool = False,
|
||||
) -> NotebookExecutionResult:
|
||||
rate_limit.wait() # wait before creating the task
|
||||
|
||||
print(f"Running notebook: {notebook}")
|
||||
|
||||
# Handle empty strings
|
||||
if not variable_vpc_network:
|
||||
variable_vpc_network = None
|
||||
|
||||
if not private_pool_id:
|
||||
private_pool_id = None
|
||||
|
||||
# Create paths
|
||||
notebook_output_uri = "/".join([artifacts_bucket, pathlib.Path(notebook).name])
|
||||
|
||||
@@ -172,27 +151,17 @@ def process_and_execute_notebook(
|
||||
notebook_path=notebook,
|
||||
variable_project_id=variable_project_id,
|
||||
variable_region=variable_region,
|
||||
variable_service_account=variable_service_account,
|
||||
variable_vpc_network=variable_vpc_network,
|
||||
)
|
||||
|
||||
# Upload the pre-processed code to a GCS bucket
|
||||
code_archive_uri = util.archive_code_and_upload(staging_bucket=staging_bucket)
|
||||
|
||||
# Calculate timeout in seconds
|
||||
timeout_in_seconds = max(
|
||||
int((deadline - datetime.datetime.now()).total_seconds()), 1
|
||||
)
|
||||
|
||||
operation = execute_notebook_remote.execute_notebook_remote(
|
||||
code_archive_uri=code_archive_uri,
|
||||
notebook_uri=notebook,
|
||||
notebook_output_uri=notebook_output_uri,
|
||||
container_uri=container_uri,
|
||||
tag=tag,
|
||||
private_pool_id=private_pool_id,
|
||||
private_pool_region=variable_region,
|
||||
timeout_in_seconds=timeout_in_seconds,
|
||||
)
|
||||
|
||||
operation_metadata = BuildOperationMetadata(mapping=operation.metadata)
|
||||
@@ -233,77 +202,15 @@ def process_and_execute_notebook(
|
||||
return result
|
||||
|
||||
|
||||
def get_changed_notebooks(
|
||||
def run_changed_notebooks(
|
||||
test_paths_file: str,
|
||||
base_branch: Optional[str] = None,
|
||||
) -> List[str]:
|
||||
"""
|
||||
Get the notebooks that exist under the folders defined in the test_paths_file.
|
||||
It only returns notebooks that have differences from the Git base_branch.
|
||||
"""
|
||||
|
||||
test_paths = []
|
||||
with open(test_paths_file) as file:
|
||||
lines = [line.strip() for line in file.readlines()]
|
||||
lines = [line for line in lines if len(line) > 0]
|
||||
test_paths = [line for line in lines]
|
||||
|
||||
if len(test_paths) == 0:
|
||||
raise RuntimeError("No test folders found.")
|
||||
|
||||
print(f"Checking folders: {test_paths}")
|
||||
|
||||
# Find notebooks
|
||||
notebooks = []
|
||||
|
||||
# Instantiate GitPython objects
|
||||
repo = git.Repo(os.getcwd())
|
||||
index = repo.index
|
||||
|
||||
if base_branch:
|
||||
# Get the point at which this branch branches off from main
|
||||
branching_commits = repo.merge_base("HEAD", f"origin/{base_branch}")
|
||||
|
||||
if len(branching_commits) > 0:
|
||||
branching_commit = branching_commits[0]
|
||||
print(f"Looking for notebooks that changed from branch: {branching_commit}")
|
||||
|
||||
notebooks = [
|
||||
diff.b_path
|
||||
for diff in index.diff(branching_commit, paths=test_paths)
|
||||
if diff.b_path is not None
|
||||
]
|
||||
else:
|
||||
notebooks = []
|
||||
else:
|
||||
print(f"Looking for all notebooks.")
|
||||
notebooks_str = subprocess.check_output(["git", "ls-files"] + test_paths)
|
||||
notebooks = notebooks_str.decode("utf-8").split("\n")
|
||||
|
||||
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
|
||||
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
|
||||
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
|
||||
|
||||
if len(notebooks) > 0:
|
||||
print(f"Found {len(notebooks)} notebooks:")
|
||||
for notebook in notebooks:
|
||||
print(f"\t{notebook}")
|
||||
|
||||
return notebooks
|
||||
|
||||
|
||||
def process_and_execute_notebooks(
|
||||
notebooks: List[str],
|
||||
container_uri: str,
|
||||
staging_bucket: str,
|
||||
artifacts_bucket: str,
|
||||
should_parallelize: bool,
|
||||
timeout: int,
|
||||
variable_project_id: str,
|
||||
variable_region: str,
|
||||
variable_service_account: str,
|
||||
variable_vpc_network: Optional[str] = None,
|
||||
private_pool_id: Optional[str] = None,
|
||||
should_parallelize: bool,
|
||||
base_branch: Optional[str] = None,
|
||||
):
|
||||
"""
|
||||
Run the notebooks that exist under the folders defined in the test_paths_file.
|
||||
@@ -330,128 +237,171 @@ def process_and_execute_notebooks(
|
||||
Required. The value for REGION to inject into notebooks.
|
||||
should_parallelize (bool):
|
||||
Required. Should run notebooks in parallel using a thread pool as opposed to in sequence.
|
||||
timeout (str):
|
||||
Required. Timeout string according to https://cloud.google.com/build/docs/build-config-file-schema#timeout.
|
||||
"""
|
||||
|
||||
# Calculate deadline
|
||||
deadline = datetime.datetime.now() + datetime.timedelta(
|
||||
seconds=max(timeout - WORKER_TIMEOUT_BUFFER_IN_SECONDS, 0)
|
||||
)
|
||||
test_paths = []
|
||||
with open(test_paths_file) as file:
|
||||
lines = [line.strip() for line in file.readlines()]
|
||||
lines = [line for line in lines if len(line) > 0]
|
||||
test_paths = [line for line in lines]
|
||||
|
||||
if len(notebooks) > 1:
|
||||
notebook_execution_results: List[NotebookExecutionResult] = []
|
||||
if len(test_paths) == 0:
|
||||
raise RuntimeError("No test folders found.")
|
||||
|
||||
print(f"Checking folders: {test_paths}")
|
||||
|
||||
# Find notebooks
|
||||
notebooks = []
|
||||
if base_branch:
|
||||
print(f"Looking for notebooks that changed from branch: {base_branch}")
|
||||
notebooks = subprocess.check_output(
|
||||
["git", "diff", "--name-only", f"origin/{base_branch}..."] + test_paths
|
||||
)
|
||||
else:
|
||||
print(f"Looking for all notebooks.")
|
||||
notebooks = subprocess.check_output(["git", "ls-files"] + test_paths)
|
||||
|
||||
notebooks = notebooks.decode("utf-8").split("\n")
|
||||
notebooks = [notebook for notebook in notebooks if notebook.endswith(".ipynb")]
|
||||
notebooks = [notebook for notebook in notebooks if len(notebook) > 0]
|
||||
notebooks = [notebook for notebook in notebooks if pathlib.Path(notebook).exists()]
|
||||
|
||||
notebook_execution_results: List[NotebookExecutionResult] = []
|
||||
|
||||
if len(notebooks) > 0:
|
||||
print(f"Found {len(notebooks)} modified notebooks: {notebooks}")
|
||||
|
||||
if should_parallelize and len(notebooks) > 1:
|
||||
print(
|
||||
"Running notebooks in parallel, so no logs will be displayed. Please wait..."
|
||||
)
|
||||
with concurrent.futures.ThreadPoolExecutor(max_workers=100) as executor:
|
||||
print(f"Max workers: {executor._max_workers}")
|
||||
|
||||
with concurrent.futures.ThreadPoolExecutor(max_workers=None) as executor:
|
||||
notebook_execution_results = list(
|
||||
executor.map(
|
||||
functools.partial(
|
||||
process_and_execute_notebook,
|
||||
execute_notebook,
|
||||
container_uri,
|
||||
staging_bucket,
|
||||
artifacts_bucket,
|
||||
variable_project_id,
|
||||
variable_region,
|
||||
variable_service_account,
|
||||
variable_vpc_network,
|
||||
private_pool_id,
|
||||
deadline,
|
||||
),
|
||||
notebooks,
|
||||
)
|
||||
)
|
||||
else:
|
||||
notebook_execution_results = [
|
||||
process_and_execute_notebook(
|
||||
execute_notebook(
|
||||
container_uri=container_uri,
|
||||
staging_bucket=staging_bucket,
|
||||
artifacts_bucket=artifacts_bucket,
|
||||
variable_project_id=variable_project_id,
|
||||
variable_region=variable_region,
|
||||
variable_service_account=variable_service_account,
|
||||
variable_vpc_network=variable_vpc_network,
|
||||
private_pool_id=private_pool_id,
|
||||
deadline=deadline,
|
||||
notebook=notebook,
|
||||
)
|
||||
for notebook in notebooks
|
||||
]
|
||||
|
||||
print("\n=== RESULTS ===\n")
|
||||
|
||||
results_sorted = sorted(
|
||||
notebook_execution_results,
|
||||
key=lambda result: result.is_pass,
|
||||
reverse=True,
|
||||
)
|
||||
|
||||
# Print results
|
||||
print(
|
||||
tabulate(
|
||||
[
|
||||
[
|
||||
result.name,
|
||||
"PASSED" if result.is_pass else "FAILED",
|
||||
format_timedelta(result.duration),
|
||||
result.log_url,
|
||||
result.output_uri,
|
||||
result.output_uri_web,
|
||||
]
|
||||
for result in results_sorted
|
||||
],
|
||||
headers=[
|
||||
"build_tag",
|
||||
"status",
|
||||
"duration",
|
||||
"log_url",
|
||||
"output_uri",
|
||||
"output_uri_web",
|
||||
],
|
||||
)
|
||||
)
|
||||
|
||||
print("\n=== END RESULTS===\n")
|
||||
|
||||
total_notebook_duration = functools.reduce(
|
||||
operator.add,
|
||||
[datetime.timedelta(seconds=0)]
|
||||
+ [result.duration for result in results_sorted],
|
||||
)
|
||||
|
||||
print(
|
||||
f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}"
|
||||
)
|
||||
|
||||
# Raise error if any notebooks failed
|
||||
if not all([result.is_pass for result in results_sorted]):
|
||||
raise RuntimeError("Notebook failures detected. See logs for details")
|
||||
|
||||
elif len(notebooks) == 1:
|
||||
notebook = notebooks[0]
|
||||
|
||||
# Pre-process notebook by substituting variable names
|
||||
_process_notebook(
|
||||
notebook_path=notebook,
|
||||
variable_project_id=variable_project_id,
|
||||
variable_region=variable_region,
|
||||
variable_service_account=variable_service_account,
|
||||
variable_vpc_network=variable_vpc_network,
|
||||
)
|
||||
|
||||
execute_notebook_helper.execute_notebook(
|
||||
notebook_source=notebook,
|
||||
output_file_or_uri="/".join(
|
||||
[artifacts_bucket, pathlib.Path(notebook).name]
|
||||
),
|
||||
should_log_output=True,
|
||||
)
|
||||
else:
|
||||
print("No notebooks modified in this pull request.")
|
||||
|
||||
print("\n=== RESULTS ===\n")
|
||||
|
||||
results_sorted = sorted(
|
||||
notebook_execution_results,
|
||||
key=lambda result: result.is_pass,
|
||||
reverse=True,
|
||||
)
|
||||
|
||||
# Print results
|
||||
print(
|
||||
tabulate(
|
||||
[
|
||||
[
|
||||
result.name,
|
||||
"PASSED" if result.is_pass else "FAILED",
|
||||
format_timedelta(result.duration),
|
||||
result.log_url,
|
||||
]
|
||||
for result in results_sorted
|
||||
],
|
||||
headers=["build_tag", "status", "duration", "log_url"],
|
||||
)
|
||||
)
|
||||
|
||||
print("\n=== END RESULTS===\n")
|
||||
|
||||
total_notebook_duration = functools.reduce(
|
||||
operator.add,
|
||||
[datetime.timedelta(seconds=0)]
|
||||
+ [result.duration for result in results_sorted],
|
||||
)
|
||||
|
||||
print(f"Cumulative notebook duration: {format_timedelta(total_notebook_duration)}")
|
||||
|
||||
# Raise error if any notebooks failed
|
||||
if not all([result.is_pass for result in results_sorted]):
|
||||
raise RuntimeError("Notebook failures detected. See logs for details")
|
||||
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run changed notebooks.")
|
||||
parser.add_argument(
|
||||
"--test_paths_file",
|
||||
type=pathlib.Path,
|
||||
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--base_branch",
|
||||
help="The base git branch to diff against to find changed files.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--container_uri",
|
||||
type=str,
|
||||
help="The container uri to run each notebook in.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_project_id",
|
||||
type=str,
|
||||
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_region",
|
||||
type=str,
|
||||
help="The GCP region. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--staging_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for staging temporary files.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--artifacts_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for storing executed notebooks.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--should_parallelize",
|
||||
type=str2bool,
|
||||
nargs="?",
|
||||
const=True,
|
||||
default=True,
|
||||
help="Should run notebooks in parallel.",
|
||||
)
|
||||
|
||||
args = parser.parse_args()
|
||||
run_changed_notebooks(
|
||||
test_paths_file=args.test_paths_file,
|
||||
container_uri=args.container_uri,
|
||||
staging_bucket=args.staging_bucket,
|
||||
artifacts_bucket=args.artifacts_bucket,
|
||||
variable_project_id=args.variable_project_id,
|
||||
variable_region=args.variable_region,
|
||||
should_parallelize=args.should_parallelize,
|
||||
base_branch=args.base_branch,
|
||||
)
|
||||
@@ -13,29 +13,23 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Methods to run a notebook locally"""
|
||||
|
||||
import errno
|
||||
import os
|
||||
import shutil
|
||||
import sys
|
||||
|
||||
import os
|
||||
import errno
|
||||
import papermill as pm
|
||||
from google.cloud.aiplatform import utils
|
||||
import shutil
|
||||
|
||||
from utils import util
|
||||
from google.cloud.aiplatform import utils
|
||||
|
||||
# This script is used to execute a notebook and write out the output notebook.
|
||||
|
||||
# This is used to force papermill to use this kernel to run the notebook instead of any defined inside the notebook itself
|
||||
DEFAULT_KERNEL_NAME = "python3"
|
||||
|
||||
|
||||
def execute_notebook(
|
||||
notebook_source: str,
|
||||
output_file_or_uri: str,
|
||||
should_log_output: bool,
|
||||
):
|
||||
"""Execute a single notebook using Papermill"""
|
||||
file_name = os.path.basename(os.path.normpath(notebook_source))
|
||||
|
||||
# Download notebook if it's a GCS URI
|
||||
@@ -53,17 +47,6 @@ def execute_notebook(
|
||||
|
||||
execution_exception = None
|
||||
|
||||
print("\n=== DOWNLOAD EXECUTED NOTEBOOK ===\n")
|
||||
print(f"Please debug the executed notebook by downloading the executed notebook:")
|
||||
|
||||
print("Option 1. Using gsutil. Run the following command in your terminal.")
|
||||
print(f'\tgsutil cp "{output_file_or_uri}" .')
|
||||
|
||||
print("Option 2. Using this link.")
|
||||
print(f"\thttps://storage.googleapis.com/{output_file_or_uri[5:]}")
|
||||
|
||||
print("\n======\n")
|
||||
|
||||
# Execute notebook
|
||||
try:
|
||||
# Execute notebook
|
||||
@@ -72,7 +55,6 @@ def execute_notebook(
|
||||
output_path=notebook_source,
|
||||
progress_bar=should_log_output,
|
||||
request_save_on_cell_execute=should_log_output,
|
||||
kernel_name=DEFAULT_KERNEL_NAME,
|
||||
log_output=should_log_output,
|
||||
stdout_file=sys.stdout if should_log_output else None,
|
||||
stderr_file=sys.stderr if should_log_output else None,
|
||||
@@ -86,6 +68,10 @@ def execute_notebook(
|
||||
util.upload_file(notebook_source, remote_file_path=output_file_or_uri)
|
||||
|
||||
print("\n=== EXECUTION FINISHED ===\n")
|
||||
print(
|
||||
f"Please debug the executed notebook by downloading: {output_file_or_uri}"
|
||||
)
|
||||
print("\n======\n")
|
||||
else:
|
||||
# Create directories if they don't exist
|
||||
if not os.path.exists(os.path.dirname(output_file_or_uri)):
|
||||
@@ -1,2 +1 @@
|
||||
ratemate
|
||||
google-cloud-aiplatform
|
||||
@@ -1,14 +1,11 @@
|
||||
from typing import List
|
||||
from ratemate import RateLimit
|
||||
from resource_cleanup_manager import (
|
||||
DatasetResourceCleanupManager,
|
||||
ModelResourceCleanupManager,
|
||||
EndpointResourceCleanupManager,
|
||||
ResourceCleanupManager,
|
||||
DatasetResourceCleanupManager,
|
||||
EndpointResourceCleanupManager,
|
||||
ModelResourceCleanupManager,
|
||||
)
|
||||
|
||||
rate_limit = RateLimit(max_count=25, per=60, greedy=False)
|
||||
|
||||
|
||||
def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: bool):
|
||||
for manager in managers:
|
||||
@@ -18,18 +15,14 @@ def run_cleanup_managers(managers: List[ResourceCleanupManager], is_dry_run: boo
|
||||
resources = manager.list()
|
||||
print(f"Found {len(resources)} {type_name}'s")
|
||||
for resource in resources:
|
||||
try:
|
||||
if not manager.is_deletable(resource):
|
||||
continue
|
||||
if not manager.is_deletable(resource):
|
||||
continue
|
||||
|
||||
if is_dry_run:
|
||||
resource_name = manager.resource_name(resource)
|
||||
print(f"Will delete '{type_name}': {resource_name}")
|
||||
else:
|
||||
rate_limit.wait() # wait before deleting
|
||||
manager.delete(resource)
|
||||
except Exception as exception:
|
||||
print(exception)
|
||||
if is_dry_run:
|
||||
resource_name = manager.resource_name(resource)
|
||||
print(f"Will delete '{type_name}': {resource_name}")
|
||||
else:
|
||||
manager.delete(resource)
|
||||
|
||||
print("")
|
||||
|
||||
@@ -43,7 +36,7 @@ if is_dry_run:
|
||||
managers = [
|
||||
DatasetResourceCleanupManager(),
|
||||
EndpointResourceCleanupManager(),
|
||||
ModelResourceCleanupManager(), # ModelResourceCleanupManager must follow EndpointResourceCleanupManager due to deployed models blocking model deletion.
|
||||
ModelResourceCleanupManager(),
|
||||
]
|
||||
|
||||
run_cleanup_managers(managers=managers, is_dry_run=is_dry_run)
|
||||
|
||||
@@ -1,9 +1,8 @@
|
||||
import abc
|
||||
from typing import Any, Type
|
||||
|
||||
from google.cloud import aiplatform
|
||||
from google.cloud.aiplatform import base
|
||||
from typing import Any
|
||||
from proto.datetime_helpers import DatetimeWithNanoseconds
|
||||
from google.cloud.aiplatform import base
|
||||
|
||||
# If a resource was updated within this number of seconds, do not delete.
|
||||
RESOURCE_UPDATE_BUFFER_IN_SECONDS = 60 * 60 * 8
|
||||
@@ -41,7 +40,7 @@ class ResourceCleanupManager(abc.ABC):
|
||||
# Check that it wasn't created too recently, to prevent race conditions
|
||||
if time_difference <= RESOURCE_UPDATE_BUFFER_IN_SECONDS:
|
||||
print(
|
||||
f"Skipping '{resource}' due to update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
|
||||
f"Skipping '{resource}' due update_time being '{time_difference}', which is less than '{RESOURCE_UPDATE_BUFFER_IN_SECONDS}'."
|
||||
)
|
||||
return False
|
||||
|
||||
@@ -51,7 +50,7 @@ class ResourceCleanupManager(abc.ABC):
|
||||
class VertexAIResourceCleanupManager(ResourceCleanupManager):
|
||||
@property
|
||||
@abc.abstractmethod
|
||||
def vertex_ai_resource(self) -> Type[base.VertexAiResourceNounWithFutureManager]:
|
||||
def vertex_ai_resource(self) -> base.VertexAiResourceNounWithFutureManager:
|
||||
pass
|
||||
|
||||
@property
|
||||
@@ -61,9 +60,7 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
|
||||
def list(self) -> Any:
|
||||
return self.vertex_ai_resource.list()
|
||||
|
||||
def resource_name(
|
||||
self, resource: Type[base.VertexAiResourceNounWithFutureManager]
|
||||
) -> str:
|
||||
def resource_name(self, resource: Any) -> str:
|
||||
return resource.display_name
|
||||
|
||||
def delete(self, resource):
|
||||
@@ -77,33 +74,12 @@ class VertexAIResourceCleanupManager(ResourceCleanupManager):
|
||||
|
||||
class DatasetResourceCleanupManager(VertexAIResourceCleanupManager):
|
||||
vertex_ai_resource = aiplatform.datasets._Dataset
|
||||
dataset_types = [
|
||||
aiplatform.ImageDataset,
|
||||
aiplatform.TabularDataset,
|
||||
aiplatform.TextDataset,
|
||||
aiplatform.TimeSeriesDataset,
|
||||
aiplatform.VideoDataset,
|
||||
]
|
||||
|
||||
def list(self) -> Any:
|
||||
return [
|
||||
dataset
|
||||
for dataset_type in self.dataset_types
|
||||
for dataset in dataset_type.list()
|
||||
]
|
||||
|
||||
|
||||
class EndpointResourceCleanupManager(VertexAIResourceCleanupManager):
|
||||
vertex_ai_resource = aiplatform.Endpoint
|
||||
|
||||
def delete(self, resource):
|
||||
# TODO: Remove this once https://github.com/googleapis/python-aiplatform/issues/1441 is fixed
|
||||
resource._sync_gca_resource()
|
||||
for deployed_model_id in [
|
||||
models.id for models in resource._gca_resource.deployed_models
|
||||
]:
|
||||
resource._undeploy(deployed_model_id=deployed_model_id)
|
||||
|
||||
resource.delete(force=True)
|
||||
|
||||
|
||||
|
||||
@@ -1,130 +0,0 @@
|
||||
#!/usr/bin/env python
|
||||
# Copyright 2021 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""A CLI to process changed notebooks and execute them on Google Cloud Build"""
|
||||
|
||||
import argparse
|
||||
import pathlib
|
||||
|
||||
import execute_changed_notebooks_helper
|
||||
|
||||
|
||||
def str2bool(v):
|
||||
if isinstance(v, bool):
|
||||
return v
|
||||
if v.lower() in ("yes", "true", "t", "y", "1"):
|
||||
return True
|
||||
elif v.lower() in ("no", "false", "f", "n", "0"):
|
||||
return False
|
||||
else:
|
||||
raise argparse.ArgumentTypeError("Boolean value expected.")
|
||||
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run changed notebooks.")
|
||||
parser.add_argument(
|
||||
"--test_paths_file",
|
||||
type=pathlib.Path,
|
||||
help="The path to the file that has newline-limited folders of notebooks that should be tested.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--base_branch",
|
||||
help="The base git branch to diff against to find changed files.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--container_uri",
|
||||
type=str,
|
||||
help="The container uri to run each notebook in.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_project_id",
|
||||
type=str,
|
||||
help="The GCP project id. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_region",
|
||||
type=str,
|
||||
help="The GCP region. This is used to inject a variable value into the notebook before running.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_service_account",
|
||||
type=str,
|
||||
help="A service account. This is used to inject a variable value into the notebook before running. This is not the account that will run the notebook.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--variable_vpc_network",
|
||||
type=str,
|
||||
help="The full VPC network name. See https://cloud.google.com/compute/docs/networks-and-firewalls#networks. Format is projects/{project}/global/networks/{network}, where {project} is a project number, as in '12345', and {network} is network name. See <https://cloud.google.com/compute/docs/reference/rest/v1/networks/insert> for details. This is used to inject a variable value into the notebook before running.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--staging_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for staging temporary files.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--artifacts_bucket",
|
||||
type=str,
|
||||
help="The GCP directory for storing executed notebooks.",
|
||||
required=True,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--timeout",
|
||||
type=int,
|
||||
help="Timeout in seconds",
|
||||
default=86400,
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--private_pool_id",
|
||||
type=str,
|
||||
help="The private pool id.",
|
||||
required=False,
|
||||
)
|
||||
parser.add_argument(
|
||||
"--should_parallelize",
|
||||
type=str2bool,
|
||||
nargs="?",
|
||||
const=True,
|
||||
default=True,
|
||||
help="Should run notebooks in parallel.",
|
||||
)
|
||||
|
||||
args = parser.parse_args()
|
||||
|
||||
notebooks = execute_changed_notebooks_helper.get_changed_notebooks(
|
||||
test_paths_file=args.test_paths_file,
|
||||
base_branch=args.base_branch,
|
||||
)
|
||||
|
||||
execute_changed_notebooks_helper.process_and_execute_notebooks(
|
||||
notebooks=notebooks,
|
||||
container_uri=args.container_uri,
|
||||
staging_bucket=args.staging_bucket,
|
||||
artifacts_bucket=args.artifacts_bucket,
|
||||
should_parallelize=args.should_parallelize,
|
||||
timeout=args.timeout,
|
||||
variable_project_id=args.variable_project_id,
|
||||
variable_region=args.variable_region,
|
||||
variable_service_account=args.variable_service_account,
|
||||
variable_vpc_network=args.variable_vpc_network,
|
||||
private_pool_id=args.private_pool_id,
|
||||
)
|
||||
@@ -13,13 +13,10 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""A CLI to download (optional) and run a single notebook locally"""
|
||||
|
||||
import argparse
|
||||
import ExecuteNotebook
|
||||
|
||||
import execute_notebook_helper
|
||||
|
||||
parser = argparse.ArgumentParser(description="Run a single notebook locally.")
|
||||
parser = argparse.ArgumentParser(description="Run changed notebooks.")
|
||||
parser.add_argument(
|
||||
"--notebook_source",
|
||||
type=str,
|
||||
@@ -34,7 +31,7 @@ parser.add_argument(
|
||||
)
|
||||
|
||||
args = parser.parse_args()
|
||||
execute_notebook_helper.execute_notebook(
|
||||
ExecuteNotebook.execute_notebook(
|
||||
notebook_source=args.notebook_source,
|
||||
output_file_or_uri=args.output_file_or_uri,
|
||||
should_log_output=True,
|
||||
|
||||
@@ -1,34 +1,18 @@
|
||||
#!/usr/bin/env python
|
||||
# Copyright 2021 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Methods to run a notebook on Google Cloud Build"""
|
||||
|
||||
from re import sub
|
||||
from typing import Optional
|
||||
|
||||
import google.auth
|
||||
import yaml
|
||||
from google.api_core import client_options, operation
|
||||
from google.cloud.aiplatform import utils
|
||||
from google.cloud.devtools import cloudbuild_v1
|
||||
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
|
||||
from google.protobuf import duration_pb2
|
||||
from yaml.loader import FullLoader
|
||||
|
||||
import google.auth
|
||||
from google.cloud.devtools import cloudbuild_v1
|
||||
from google.cloud.devtools.cloudbuild_v1.types import Source, StorageSource
|
||||
|
||||
from typing import Optional
|
||||
import yaml
|
||||
|
||||
from google.cloud.aiplatform import utils
|
||||
from google.api_core import operation
|
||||
|
||||
CLOUD_BUILD_FILEPATH = ".cloud-build/notebook-execution-test-cloudbuild-single.yaml"
|
||||
SERVICE_BASE_PATH = "cloudbuild.googleapis.com"
|
||||
TIMEOUT_IN_SECONDS = 86400
|
||||
|
||||
|
||||
def execute_notebook_remote(
|
||||
@@ -36,14 +20,20 @@ def execute_notebook_remote(
|
||||
notebook_uri: str,
|
||||
notebook_output_uri: str,
|
||||
container_uri: str,
|
||||
private_pool_id: Optional[str],
|
||||
private_pool_region: Optional[str],
|
||||
tag: Optional[str],
|
||||
timeout_in_seconds: Optional[int] = None,
|
||||
) -> operation.Operation:
|
||||
"""Create and execute a single notebook on Google Cloud Build"""
|
||||
# Load build steps from YAML
|
||||
"""Create and execute a simple Google Cloud Build configuration,
|
||||
print the in-progress status and print the completed status."""
|
||||
|
||||
# Authorize the client with Google defaults
|
||||
credentials, project_id = google.auth.default()
|
||||
client = cloudbuild_v1.services.cloud_build.CloudBuildClient()
|
||||
|
||||
build = cloudbuild_v1.Build()
|
||||
|
||||
# The following build steps will output "hello world"
|
||||
# For more information on build configuration, see
|
||||
# https://cloud.google.com/build/docs/configuring-builds/create-basic-configuration
|
||||
cloudbuild_config = yaml.load(open(CLOUD_BUILD_FILEPATH), Loader=FullLoader)
|
||||
|
||||
substitutions = {
|
||||
@@ -52,24 +42,6 @@ def execute_notebook_remote(
|
||||
"_NOTEBOOK_OUTPUT_GCS_URI": notebook_output_uri,
|
||||
}
|
||||
|
||||
build = cloudbuild_v1.Build()
|
||||
|
||||
options: Optional[client_options.ClientOptions] = None
|
||||
if private_pool_id and private_pool_region:
|
||||
# substitutions["_PRIVATE_POOL_NAME"] = private_pool_id
|
||||
build.options = cloudbuild_config.get("options")
|
||||
build.options.pool = {"name": private_pool_id}
|
||||
|
||||
# Switch to the regional endpoint of the pool
|
||||
options = client_options.ClientOptions(
|
||||
api_endpoint=f"{private_pool_region}-{SERVICE_BASE_PATH}"
|
||||
)
|
||||
|
||||
# Authorize the client with Google defaults
|
||||
credentials, project_id = google.auth.default()
|
||||
|
||||
client = cloudbuild_v1.services.cloud_build.CloudBuildClient(client_options=options)
|
||||
|
||||
(
|
||||
source_archived_file_gcs_bucket,
|
||||
source_archived_file_gcs_object,
|
||||
@@ -84,8 +56,8 @@ def execute_notebook_remote(
|
||||
|
||||
build.steps = cloudbuild_config["steps"]
|
||||
build.substitutions = substitutions
|
||||
build.timeout = duration_pb2.Duration(seconds=timeout_in_seconds)
|
||||
build.queue_ttl = duration_pb2.Duration(seconds=timeout_in_seconds)
|
||||
build.timeout = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
|
||||
build.queue_ttl = duration_pb2.Duration(seconds=TIMEOUT_IN_SECONDS)
|
||||
|
||||
if tag:
|
||||
build.tags = [tag]
|
||||
|
||||
@@ -4,35 +4,25 @@ steps:
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- 'gcloud config list --quiet'
|
||||
- 'gcloud config list'
|
||||
# Check the Python version
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- python3 .cloud-build/CheckPythonVersion.py -q
|
||||
# Create a virtual environment
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- python3 -m venv workspace/env
|
||||
- 'python3 .cloud-build/CheckPythonVersion.py'
|
||||
# Install Python dependencies
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- . workspace/env/bin/activate &&
|
||||
python3 -m pip -q install -U pip &&
|
||||
python3 -m pip -q install -U -r .cloud-build/requirements.txt
|
||||
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
|
||||
# Install Python dependencies and run testing script
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- |
|
||||
. workspace/env/bin/activate &&
|
||||
python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"
|
||||
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/execute_notebook_cli.py --notebook_source "${_NOTEBOOK_GCS_URI}" --output_file_or_uri "${_NOTEBOOK_OUTPUT_GCS_URI}"'
|
||||
env:
|
||||
- 'IS_TESTING=1'
|
||||
timeout: 86400s
|
||||
|
||||
@@ -4,42 +4,35 @@ steps:
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- gcloud config list --quiet
|
||||
- 'gcloud config list'
|
||||
# # Clone the Git repo
|
||||
# - name: ${_PYTHON_IMAGE}
|
||||
# entrypoint: git
|
||||
# args: ['clone', "${_GIT_REPO}", "--branch", "${_GIT_BRANCH_NAME}", "."]
|
||||
# Check the Python version
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- python3 .cloud-build/CheckPythonVersion.py -q
|
||||
# Fetch full repo for diff purposes
|
||||
- name: gcr.io/cloud-builders/git
|
||||
args: [fetch, --unshallow, --quiet]
|
||||
# Create a virtual environment
|
||||
- 'python3 .cloud-build/CheckPythonVersion.py'
|
||||
# Fetch base branch if required
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- python3 -m venv workspace/env
|
||||
- 'if [ -n "${_BASE_BRANCH}" ]; then git fetch origin "${_BASE_BRANCH}":refs/remotes/origin/"${_BASE_BRANCH}"; else echo "Skipping fetch."; fi'
|
||||
# Install Python dependencies
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- . workspace/env/bin/activate &&
|
||||
python3 -m pip -q install -U pip &&
|
||||
python3 -m pip -q install -U -r .cloud-build/requirements.txt
|
||||
- 'python3 -m pip install -U pip && python3 -m pip install -U --user -r .cloud-build/requirements.txt'
|
||||
# Install Python dependencies and run testing script
|
||||
# TODO: Only pass in private_pool_id if it is set
|
||||
- name: ${_PYTHON_IMAGE}
|
||||
entrypoint: /bin/sh
|
||||
args:
|
||||
- -c
|
||||
- |
|
||||
. workspace/env/bin/activate &&
|
||||
python3 .cloud-build/execute_changed_notebooks_cli.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION} --variable_service_account ${_GCP_SERVICE_ACCOUNT} --variable_vpc_network "${_GPC_VPC_NETWORK_NAME}" `if [ ! -z "${_PRIVATE_POOL_NAME}" ]; then echo "--private_pool_id ${_PRIVATE_POOL_NAME}"; fi`
|
||||
- 'python3 -m pip install -U pip && python3 -m pip freeze && python3 .cloud-build/ExecuteChangedNotebooks.py --test_paths_file "${_TEST_PATHS_FILE}" --base_branch "${_FORCED_BASE_BRANCH}" --container_uri ${_PYTHON_IMAGE} --staging_bucket ${_GCS_STAGING_BUCKET} --artifacts_bucket ${_GCS_STAGING_BUCKET}/executed_notebooks/PR_${_PR_NUMBER}/BUILD_${BUILD_ID} --variable_project_id ${PROJECT_ID} --variable_region ${_GCP_REGION}'
|
||||
env:
|
||||
- 'IS_TESTING=1'
|
||||
timeout: 86400s
|
||||
options:
|
||||
pool:
|
||||
name: ${_PRIVATE_POOL_NAME}
|
||||
|
||||
@@ -1,13 +1,12 @@
|
||||
ipython
|
||||
numpy
|
||||
jupyter
|
||||
nbconvert
|
||||
papermill
|
||||
pandas
|
||||
matplotlib
|
||||
ipython==8.0.0
|
||||
jupyter==1.0.0
|
||||
nbconvert==6.4.0
|
||||
papermill==2.3.3
|
||||
numpy==1.22.0
|
||||
pandas==1.3.5
|
||||
matplotlib==3.5.1
|
||||
tabulate
|
||||
google-cloud-aiplatform
|
||||
google-cloud-storage
|
||||
google-cloud-build
|
||||
ratemate
|
||||
GitPython
|
||||
gcloud
|
||||
|
||||
@@ -1,5 +0,0 @@
|
||||
notebooks/official/vizier/gapic-vizier-multi-objective-optimization.ipynb
|
||||
notebooks/official/pipelines/lightweight_functions_component_io_kfp.ipynb
|
||||
notebooks/official/ml_metadata/sdk-metric-parameter-tracking-for-locally-trained-models.ipynb
|
||||
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
|
||||
notebooks/official/matching_engine/sdk_matching_engine_for_indexing.ipynb
|
||||
@@ -1 +0,0 @@
|
||||
notebooks/official/pipelines/metrics_viz_run_compare_kfp.ipynb
|
||||
@@ -13,10 +13,8 @@
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
from typing import Dict
|
||||
|
||||
from nbconvert.preprocessors import Preprocessor
|
||||
|
||||
from typing import Dict
|
||||
from . import UpdateNotebookVariables as update_notebook_variables
|
||||
|
||||
|
||||
@@ -62,4 +60,4 @@ class UpdateVariablesPreprocessor(Preprocessor):
|
||||
|
||||
executable_cells.append(cell)
|
||||
notebook.cells = executable_cells
|
||||
return notebook, resources
|
||||
return notebook, resources
|
||||
@@ -35,8 +35,8 @@ Variables in conditionals can also be replaced:
|
||||
|
||||
def get_updated_value(content: str, variable_name: str, variable_value: str) -> str:
|
||||
return re.sub(
|
||||
rf"({variable_name}.*? = .*?[\",\'])\[.+?\]([\",\'].*?)",
|
||||
rf"\g<1>{variable_value}\g<2>",
|
||||
rf"({variable_name}.*?=.*?[\",\'])\[.+?\]([\",\'].*?)",
|
||||
rf"\1{variable_value}\2",
|
||||
content,
|
||||
flags=re.M,
|
||||
)
|
||||
@@ -78,27 +78,4 @@ def test_region():
|
||||
variable_name="REGION",
|
||||
variable_value="us-central1",
|
||||
)
|
||||
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
|
||||
|
||||
|
||||
def test_region_equal_equals_ignore():
|
||||
# Tests that == is ignored
|
||||
new_content = get_updated_value(
|
||||
content='REGION == "[your-region]" # @param {type:"string"}',
|
||||
variable_name="REGION",
|
||||
variable_value="us-central1",
|
||||
)
|
||||
assert new_content == 'REGION == "[your-region]" # @param {type:"string"}'
|
||||
|
||||
|
||||
def test_service_account():
|
||||
# Tests that == is ignored
|
||||
new_content = get_updated_value(
|
||||
content='SERVICE_ACCOUNT = "[your-service-account]" # @param {type:"string"}',
|
||||
variable_name="SERVICE_ACCOUNT",
|
||||
variable_value="12345-compute@developer.gserviceaccount.com",
|
||||
)
|
||||
assert (
|
||||
new_content
|
||||
== 'SERVICE_ACCOUNT = "12345-compute@developer.gserviceaccount.com" # @param {type:"string"}'
|
||||
)
|
||||
assert new_content == 'REGION = "us-central1" # @param {type:"string"}'
|
||||
@@ -1,17 +1,17 @@
|
||||
from datetime import datetime
|
||||
from typing import Optional
|
||||
from google.cloud import storage
|
||||
from google.cloud.aiplatform import utils
|
||||
from google.auth import credentials as auth_credentials
|
||||
import os
|
||||
|
||||
import subprocess
|
||||
import tarfile
|
||||
import uuid
|
||||
from datetime import datetime
|
||||
from typing import Optional
|
||||
|
||||
from google.auth import credentials as auth_credentials
|
||||
from google.cloud import storage
|
||||
from google.cloud.aiplatform import utils
|
||||
|
||||
|
||||
def download_file(bucket_name: str, blob_name: str, destination_file: str) -> str:
|
||||
"""Copies a remote GCS file to a local path"""
|
||||
"""Copies a remote GCS file to a local path."""
|
||||
remote_file_path = "".join(["gs://", "/".join([bucket_name, blob_name])])
|
||||
|
||||
subprocess.check_output(
|
||||
@@ -25,7 +25,7 @@ def upload_file(
|
||||
local_file_path: str,
|
||||
remote_file_path: str,
|
||||
) -> str:
|
||||
"""Copies a local file to a GCS path"""
|
||||
"""Copies a local file to a GCS path."""
|
||||
subprocess.check_output(
|
||||
["gsutil", "cp", local_file_path, remote_file_path], encoding="UTF-8"
|
||||
)
|
||||
@@ -57,4 +57,4 @@ def archive_code_and_upload(staging_bucket: str):
|
||||
|
||||
print(f"Uploaded source code archive to {source_archived_file_gcs}")
|
||||
|
||||
return source_archived_file_gcs
|
||||
return source_archived_file_gcs
|
||||
@@ -1,28 +1,18 @@
|
||||
**REQUIRED:** Add a summary of your PR here, typically including why the change is needed and what was changed. Include any design alternatives for discussion purposes.
|
||||
|
||||
<br>
|
||||
--- YOUR PR SUMMARY GOES HERE ---
|
||||
<br><br><br>
|
||||
|
||||
**REQUIRED:** Fill out the below checklists or remove if irrelevant
|
||||
1. If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
|
||||
If you are opening a PR for `Official Notebooks` under the [notebooks/official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder, follow this mandatory checklist:
|
||||
- [ ] Use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
|
||||
- [ ] Follow the style and grammar rules outlined in the above notebook template.
|
||||
- [ ] Verify the notebook runs successfully in Colab since the automated tests cannot guarantee this even when it passes.
|
||||
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
|
||||
- [ ] Passes all the required automated checks. You can locally test for formatting and linting with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
|
||||
- [ ] You have consulted with a tech writer to see if tech writer review is necessary. If so, the notebook has been reviewed by a tech writer, and they have approved it.
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/CODEOWNERS) file under the `Official Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under `# Official Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] The Jupyter notebook cleans up any artifacts it has created (datasets, ML models, endpoints, etc) so as not to eat up unnecessary resources.
|
||||
|
||||
<br>
|
||||
|
||||
2. If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/community/CODEOWNERS) file under the `Community Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
|
||||
If you are opening a PR for `Community Notebooks` under the [notebooks/community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder:
|
||||
- [ ] This notebook has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Notebooks` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
|
||||
|
||||
<br>
|
||||
|
||||
3. If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
|
||||
If you are opening a PR for `Community Content` under the [community-content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/community-content) folder:
|
||||
- [ ] Make sure your main `Content Directory Name` is descriptive, informative, and includes some of the key products and attributes of your content, so that it is differentiable from other content
|
||||
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/community-content/CODEOWNERS) file under the `Community Content` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/CONTRIBUTING.md#code-quality-checks).
|
||||
- [ ] The main content directory has been added to the [CODEOWNERS](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/CODEOWNERS) file under the `# Community Content` section, pointing to the author or the author's team.
|
||||
- [ ] Passes all the required formatting and linting checks. You can locally test with these [instructions](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/docs/contributing.md#code-quality-checks).
|
||||
|
||||
@@ -7,11 +7,9 @@ jobs:
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Set up Python
|
||||
uses: actions/setup-python@v4
|
||||
with:
|
||||
python-version: '3.x'
|
||||
uses: actions/setup-python@v2
|
||||
- name: Fetch pull request branch
|
||||
uses: actions/checkout@v3
|
||||
uses: actions/checkout@v2
|
||||
with:
|
||||
fetch-depth: 0
|
||||
- name: Fetch base main branch
|
||||
|
||||
@@ -2,9 +2,8 @@ git+https://github.com/tensorflow/docs
|
||||
ipython
|
||||
jupyter
|
||||
nbconvert
|
||||
black==22.6.0
|
||||
pyupgrade==2.34.0
|
||||
black==21.10b0
|
||||
pyupgrade==2.29.1
|
||||
isort==5.10.1
|
||||
flake8==4.0.1
|
||||
nbqa==1.4.0
|
||||
|
||||
nbqa==1.2.2
|
||||
|
||||
@@ -68,7 +68,7 @@ if [ ${#notebooks[@]} -gt 0 ]; then
|
||||
|
||||
if [ "$is_test" = true ]; then
|
||||
echo "Running nbfmt..."
|
||||
python3 -m tensorflow_docs.tools.nbfmt --test "$notebook"
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs --test "$notebook"
|
||||
NBFMT_RTN=$?
|
||||
# echo "Running black..."
|
||||
# python3 -m nbqa black "$notebook" --check
|
||||
@@ -84,19 +84,19 @@ if [ ${#notebooks[@]} -gt 0 ]; then
|
||||
FLAKE8_RTN=$?
|
||||
else
|
||||
echo "Running black..."
|
||||
python3 -m nbqa black "$notebook"
|
||||
python3 -m nbqa black "$notebook" --nbqa-mutate
|
||||
BLACK_RTN=$?
|
||||
echo "Running pyupgrade..."
|
||||
python3 -m nbqa pyupgrade "$notebook"
|
||||
python3 -m nbqa pyupgrade "$notebook" --nbqa-mutate
|
||||
PYUPGRADE_RTN=$?
|
||||
echo "Running isort..."
|
||||
python3 -m nbqa isort "$notebook"
|
||||
python3 -m nbqa isort "$notebook" --nbqa-mutate
|
||||
ISORT_RTN=$?
|
||||
echo "Running nbfmt..."
|
||||
python3 -m tensorflow_docs.tools.nbfmt "$notebook"
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
|
||||
NBFMT_RTN=$?
|
||||
echo "Running flake8..."
|
||||
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
|
||||
python3 -m nbqa flake8 "$notebook" --show-source --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291 --nbqa-mutate
|
||||
FLAKE8_RTN=$?
|
||||
fi
|
||||
|
||||
|
||||
@@ -48,8 +48,8 @@ then you will need to manually address them before submitting your PR.
|
||||
nbqa black "$notebook"
|
||||
nbqa pyupgrade "$notebook"
|
||||
nbqa isort "$notebook"
|
||||
nbqa flake8 "$notebook" --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
|
||||
python3 -m tensorflow_docs.tools.nbfmt --remove_outputs "$notebook"
|
||||
nbqa flake8 "$notebook" --extend-ignore=W391,E501,F821,E402,F404,W503,E203,E722,W293,W291
|
||||
```
|
||||
|
||||
## Code Reviews
|
||||
|
||||
@@ -6,19 +6,7 @@ Welcome to the Google Cloud [Vertex AI](https://cloud.google.com/vertex-ai/docs/
|
||||
|
||||
## Overview
|
||||
|
||||
The repository contains [notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [community content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
|
||||
|
||||
## Repository structure
|
||||
|
||||
```bash
|
||||
├── community-content - Sample code and tutorials contributed by the community
|
||||
├── notebooks
|
||||
│ ├── community - Notebooks contributed by the community
|
||||
│ ├── official - Notebooks demonstrating use of each Vertex AI service
|
||||
│ │ ├── automl
|
||||
│ │ ├── custom
|
||||
│ │ ├── ...
|
||||
```
|
||||
The repository contains [Notebooks](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/notebooks) and [Community Content](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/master/community-content) that demonstrate how to develop and manage ML workflows using Google Cloud Vertex AI.
|
||||
|
||||
## Contributing
|
||||
|
||||
@@ -31,7 +19,3 @@ Please use the [issues page](https://github.com/GoogleCloudPlatform/vertex-ai-sa
|
||||
## Disclaimer
|
||||
|
||||
This is not an officially supported Google product. The code in this repository is for demonstrative purposes only.
|
||||
|
||||
## Feedback
|
||||
|
||||
Please feel free to fill out our [survey](https://bit.ly/vertex-ai-samples-survey) to give us feedback on the repo and its content.
|
||||
|
||||
@@ -1,8 +1,4 @@
|
||||
* @vertex-ai-samples-contributors @GoogleCloudPlatform/cloudml-samples-owners
|
||||
/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk @yinghsienwu
|
||||
/pytorch_pre_built_images_deployment @googleapis/vertex-prediction-team
|
||||
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam
|
||||
/pytorch_text_classification_using_vertex_sdk_and_gcloud @RajeshThallam @ultrons
|
||||
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
|
||||
/pluto_on_workbench @wkharold
|
||||
/cpr-examples @samthrasher
|
||||
/sklearn_text_classification_from_script_using_vertex_sdk @maxhardt
|
||||
@@ -1,824 +0,0 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "pc5-mbsX9PZC"
|
||||
},
|
||||
"source": [
|
||||
"# AlphaFold On Vertex AI Workbench\n",
|
||||
"\n",
|
||||
"[Vertex AI Workbench](https://cloud.google.com/vertex-ai/docs/workbench) offers an end-to-end notebook-based production environment that can be preconfigured with the runtime dependencies necessary to run AlphaFold on Vertex AI. With [User-Managed Notebooks](https://cloud.google.com/vertex-ai/docs/workbench/user-managed/introduction), you can configure a GPU accelerator to run AlphaFold using Tensorflow, without having to install and manage drivers or JupyterLab instances. This notebook allows you to easily predict the structure of a protein using a slightly simplified version of [AlphaFold v2.1.0](https://doi.org/10.1038/s41586-021-03819-2). \n",
|
||||
"\n",
|
||||
"##  [Launch this Notebook in Vertex AI Workbench](https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/raw/main/community-content/alphafold_on_workbench/AlphaFold.ipynb)\n",
|
||||
"\n",
|
||||
"**Differences to AlphaFold v2.1.0**\n",
|
||||
"\n",
|
||||
"In comparison to AlphaFold v2.1.0, this notebook notebook uses **no templates (homologous structures)** and a selected portion of the [BFD database](https://bfd.mmseqs.com/). We have validated these changes on several thousand recent PDB structures. While accuracy will be near-identical to the full AlphaFold system on many targets, a small fraction have a large drop in accuracy due to the smaller MSA and lack of templates. For best reliability, we recommend instead using the [full open source AlphaFold](https://github.com/deepmind/alphafold/), or the [AlphaFold Protein Structure Database](https://alphafold.ebi.ac.uk/).\n",
|
||||
"\n",
|
||||
"**This notebook has an small drop in average accuracy for multimers compared to local AlphaFold installation, for full multimer accuracy it is highly recommended to run [AlphaFold locally](https://github.com/deepmind/alphafold#running-alphafold).** Moreover, the AlphaFold-Multimer requires searching for MSA for every unique sequence in the complex, hence it is substantially slower. If your notebook times-out due to slow multimer MSA search, we recommend running AlphaFold locally.\n",
|
||||
"\n",
|
||||
"Please note that this notebook is provided as an early-access prototype and is not a finished product. It is provided for theoretical modelling only and caution should be exercised in its use. \n",
|
||||
"\n",
|
||||
"**Citing this work**\n",
|
||||
"\n",
|
||||
"Any publication that discloses findings arising from using this notebook should [cite](https://github.com/deepmind/alphafold/#citing-this-work) the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2).\n",
|
||||
"\n",
|
||||
"**Licenses**\n",
|
||||
"\n",
|
||||
"This Colab uses the [AlphaFold model parameters](https://github.com/deepmind/alphafold/#model-parameters-license) which are subject to the Creative Commons Attribution 4.0 International ([CC BY 4.0](https://creativecommons.org/licenses/by/4.0/legalcode)) license. The Colab itself is provided under the [Apache 2.0 license](https://www.apache.org/licenses/LICENSE-2.0). See the full license statement below.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"**More information**\n",
|
||||
"\n",
|
||||
"You can find more information about how AlphaFold works in the following papers:\n",
|
||||
"\n",
|
||||
"* [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2)\n",
|
||||
"* [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1)\n",
|
||||
"* [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1)\n",
|
||||
"\n",
|
||||
"FAQ on how to interpret AlphaFold predictions are [here](https://alphafold.ebi.ac.uk/faq)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "b7a02613eb1a"
|
||||
},
|
||||
"source": [
|
||||
"## Download AlphaFold Data"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "woIxeCPygt7K"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import os\n",
|
||||
"import subprocess\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"import alphafold.common\n",
|
||||
"import tqdm.notebook\n",
|
||||
"from IPython.utils import io\n",
|
||||
"\n",
|
||||
"TQDM_BAR_FORMAT = (\n",
|
||||
" \"{l_bar}{bar}| {n_fmt}/{total_fmt} [elapsed: {elapsed} remaining: {remaining}]\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"SOURCE_URL = (\n",
|
||||
" \"https://storage.googleapis.com/alphafold/alphafold_params_colab_2022-01-19.tar\"\n",
|
||||
")\n",
|
||||
"PARAMS_DIR = \"alphafold/data/params\"\n",
|
||||
"PARAMS_PATH = os.path.join(PARAMS_DIR, os.path.basename(SOURCE_URL))\n",
|
||||
"ALPHAFOLD_COMMON_DIR = os.path.dirname(alphafold.common.__file__)\n",
|
||||
"\n",
|
||||
"try:\n",
|
||||
" with tqdm.notebook.tqdm(total=100, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
|
||||
" with io.capture_output() as captured:\n",
|
||||
"\n",
|
||||
" # Download and store stereo_chemical_props.txt\n",
|
||||
" !mkdir -p ~/content/alphafold/alphafold/common\n",
|
||||
" !mkdir -p /opt/conda/lib/python3.7/site-packages/alphafold/common/\n",
|
||||
" !wget -q -P ~/content/alphafold/alphafold/common https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt\n",
|
||||
" pbar.update(18)\n",
|
||||
" !cp -f ~/content/alphafold/alphafold/common/stereo_chemical_props.txt \"{ALPHAFOLD_COMMON_DIR}\"\n",
|
||||
"\n",
|
||||
" # Download alphafold_params_colab_2021-10-27.tar\n",
|
||||
" !mkdir --parents \"{PARAMS_DIR}\"\n",
|
||||
" !wget -O \"{PARAMS_PATH}\" \"{SOURCE_URL}\"\n",
|
||||
" pbar.update(27)\n",
|
||||
"\n",
|
||||
" # Un-tar alphafold_params_colab_2021-10-27.tar\n",
|
||||
" !tar --extract --verbose --file=\"{PARAMS_PATH}\" --directory=\"{PARAMS_DIR}\" --preserve-permissions\n",
|
||||
" # !rm \"{PARAMS_PATH}\"\n",
|
||||
" pbar.update(55)\n",
|
||||
"\n",
|
||||
"except subprocess.CalledProcessError:\n",
|
||||
" print(captured)\n",
|
||||
" raise"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "d8926b7d5529"
|
||||
},
|
||||
"source": [
|
||||
"## Configure GPU Acceleration"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "VzJ5iMjTtoZw"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Confirm accelerator configuration\n",
|
||||
"import jax\n",
|
||||
"\n",
|
||||
"if jax.local_devices()[0].platform == \"tpu\":\n",
|
||||
" raise RuntimeError(\n",
|
||||
" \"TPU runtime not supported. Please configure GPU acceleration on the VM.\"\n",
|
||||
" )\n",
|
||||
"elif jax.local_devices()[0].platform == \"cpu\":\n",
|
||||
" print(\n",
|
||||
" \"CPU-only runtime is not recommended, because prediction execution will be slow. For better performance, consider GPU acceleration on the VM.\"\n",
|
||||
" )\n",
|
||||
"else:\n",
|
||||
" print(f\"Running with {jax.local_devices()[0].device_kind} GPU\")\n",
|
||||
"\n",
|
||||
"# Make sure all necessary environment variables are set.\n",
|
||||
"import os\n",
|
||||
"\n",
|
||||
"os.environ[\"TF_FORCE_UNIFIED_MEMORY\"] = \"1\"\n",
|
||||
"os.environ[\"XLA_PYTHON_CLIENT_MEM_FRACTION\"] = \"2.0\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "W4JpOs6oA-QS"
|
||||
},
|
||||
"source": [
|
||||
"## Making a prediction\n",
|
||||
"\n",
|
||||
"Please paste the sequence of your protein in the text box below, then run the remaining cells via _Run_ > _Run Selected Cell and All Below_. You can also run the cells individually by pressing the _Play_ button on the left.\n",
|
||||
"\n",
|
||||
"Note that the search against databases and the actual prediction can take some time, from minutes to hours, depending on the length of the protein and what type of GPU you allocate (see FAQ below).\n",
|
||||
"\n",
|
||||
"To start, enter the amino acid sequence(s) to fold ⬇️\n",
|
||||
"\n",
|
||||
"If you enter only a single sequence, the monomer model will be used. If you enter multiple sequences, the multimer model will be used."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "b310d44229d0"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Input sequences (type: str)\n",
|
||||
"sequence_1 = \"MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH\"\n",
|
||||
"sequence_2 = \"\"\n",
|
||||
"sequence_3 = \"\"\n",
|
||||
"sequence_4 = \"\"\n",
|
||||
"sequence_5 = \"\"\n",
|
||||
"sequence_6 = \"\"\n",
|
||||
"sequence_7 = \"\"\n",
|
||||
"sequence_8 = \"\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "rowN0bVYLe9n"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from alphafold.notebooks import notebook_utils\n",
|
||||
"\n",
|
||||
"input_sequences = (\n",
|
||||
" sequence_1,\n",
|
||||
" sequence_2,\n",
|
||||
" sequence_3,\n",
|
||||
" sequence_4,\n",
|
||||
" sequence_5,\n",
|
||||
" sequence_6,\n",
|
||||
" sequence_7,\n",
|
||||
" sequence_8,\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# If folding a complex target and all the input sequences are\n",
|
||||
"# prokaryotic then set `is_prokaryotic` to `True`. Set to `False`\n",
|
||||
"# otherwise or if the origin is unknown.\n",
|
||||
"\n",
|
||||
"is_prokaryote = False # @param {type:\"boolean\"}\n",
|
||||
"\n",
|
||||
"MIN_SINGLE_SEQUENCE_LENGTH = 16\n",
|
||||
"MAX_SINGLE_SEQUENCE_LENGTH = 2500\n",
|
||||
"MAX_MULTIMER_LENGTH = 2500\n",
|
||||
"\n",
|
||||
"# Validate the input.\n",
|
||||
"sequences, model_type_to_use = notebook_utils.validate_input(\n",
|
||||
" input_sequences=input_sequences,\n",
|
||||
" min_length=MIN_SINGLE_SEQUENCE_LENGTH,\n",
|
||||
" max_length=MAX_SINGLE_SEQUENCE_LENGTH,\n",
|
||||
" max_multimer_length=MAX_MULTIMER_LENGTH,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "db551d4877ea"
|
||||
},
|
||||
"source": [
|
||||
"## Search against genetic databases\n",
|
||||
"\n",
|
||||
"Once this cell has been executed, you will see statistics about the multiple sequence alignment (MSA) that will be used by AlphaFold. In particular, you’ll see how well each residue is covered by similar sequences in the MSA."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "2tTeTTsLKPjB"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import collections\n",
|
||||
"import copy\n",
|
||||
"import random\n",
|
||||
"from concurrent import futures\n",
|
||||
"from urllib import request\n",
|
||||
"\n",
|
||||
"import matplotlib.pyplot as plt\n",
|
||||
"import numpy as np\n",
|
||||
"import py3Dmol\n",
|
||||
"from alphafold.common import protein\n",
|
||||
"from alphafold.data import (feature_processing, msa_pairing, pipeline,\n",
|
||||
" pipeline_multimer)\n",
|
||||
"from alphafold.data.tools import jackhmmer\n",
|
||||
"from alphafold.model import config, data, model\n",
|
||||
"from alphafold.relax import relax, utils\n",
|
||||
"from IPython import display\n",
|
||||
"from ipywidgets import GridspecLayout, Output\n",
|
||||
"\n",
|
||||
"# Color bands for visualizing plddt\n",
|
||||
"PLDDT_BANDS = [\n",
|
||||
" (0, 50, \"#FF7D45\"),\n",
|
||||
" (50, 70, \"#FFDB13\"),\n",
|
||||
" (70, 90, \"#65CBF3\"),\n",
|
||||
" (90, 100, \"#0053D6\"),\n",
|
||||
"]\n",
|
||||
"\n",
|
||||
"# --- Find the closest source ---\n",
|
||||
"test_url_pattern = (\n",
|
||||
" \"https://storage.googleapis.com/alphafold-colab{:s}/latest/uniref90_2021_03.fasta.1\"\n",
|
||||
")\n",
|
||||
"ex = futures.ThreadPoolExecutor(3)\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def fetch(source):\n",
|
||||
" request.urlretrieve(test_url_pattern.format(source))\n",
|
||||
" return source\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"fs = [ex.submit(fetch, source) for source in [\"\", \"-europe\", \"-asia\"]]\n",
|
||||
"source = None\n",
|
||||
"for f in futures.as_completed(fs):\n",
|
||||
" source = f.result()\n",
|
||||
" ex.shutdown()\n",
|
||||
" break\n",
|
||||
"\n",
|
||||
"JACKHMMER_BINARY_PATH = \"/usr/bin/jackhmmer\"\n",
|
||||
"DB_ROOT_PATH = f\"https://storage.googleapis.com/alphafold-colab{source}/latest/\"\n",
|
||||
"# The z_value is the number of sequences in a database.\n",
|
||||
"MSA_DATABASES = [\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"uniref90\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}uniref90_2021_03.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 59,\n",
|
||||
" \"z_value\": 135_301_051,\n",
|
||||
" },\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"smallbfd\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}bfd-first_non_consensus_sequences.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 17,\n",
|
||||
" \"z_value\": 65_984_053,\n",
|
||||
" },\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"mgnify\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}mgy_clusters_2019_05.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 71,\n",
|
||||
" \"z_value\": 304_820_129,\n",
|
||||
" },\n",
|
||||
"]\n",
|
||||
"\n",
|
||||
"# Search UniProt and construct the all_seq features only for heteromers, not homomers.\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MULTIMER and len(set(sequences)) > 1:\n",
|
||||
" MSA_DATABASES.extend(\n",
|
||||
" [\n",
|
||||
" # Swiss-Prot and TrEMBL are concatenated together as UniProt.\n",
|
||||
" {\n",
|
||||
" \"db_name\": \"uniprot\",\n",
|
||||
" \"db_path\": f\"{DB_ROOT_PATH}uniprot_2021_03.fasta\",\n",
|
||||
" \"num_streamed_chunks\": 98,\n",
|
||||
" \"z_value\": 219_174_961 + 565_254,\n",
|
||||
" },\n",
|
||||
" ]\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
"TOTAL_JACKHMMER_CHUNKS = sum(cfg[\"num_streamed_chunks\"] for cfg in MSA_DATABASES)\n",
|
||||
"\n",
|
||||
"MAX_HITS = {\n",
|
||||
" \"uniref90\": 10_000,\n",
|
||||
" \"smallbfd\": 5_000,\n",
|
||||
" \"mgnify\": 501,\n",
|
||||
" \"uniprot\": 50_000,\n",
|
||||
"}\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def get_msa(fasta_path):\n",
|
||||
" \"\"\"Searches for MSA for the given sequence using chunked Jackhmmer search.\"\"\"\n",
|
||||
"\n",
|
||||
" # Run the search against chunks of genetic databases.\n",
|
||||
" raw_msa_results = collections.defaultdict(list)\n",
|
||||
" with tqdm.notebook.tqdm(\n",
|
||||
" total=TOTAL_JACKHMMER_CHUNKS, bar_format=TQDM_BAR_FORMAT\n",
|
||||
" ) as pbar:\n",
|
||||
"\n",
|
||||
" def jackhmmer_chunk_callback(i):\n",
|
||||
" pbar.update(n=1)\n",
|
||||
"\n",
|
||||
" for db_config in MSA_DATABASES:\n",
|
||||
" db_name = db_config[\"db_name\"]\n",
|
||||
" pbar.set_description(f\"Searching {db_name}\")\n",
|
||||
" jackhmmer_runner = jackhmmer.Jackhmmer(\n",
|
||||
" binary_path=JACKHMMER_BINARY_PATH,\n",
|
||||
" database_path=db_config[\"db_path\"],\n",
|
||||
" get_tblout=True,\n",
|
||||
" num_streamed_chunks=db_config[\"num_streamed_chunks\"],\n",
|
||||
" streaming_callback=jackhmmer_chunk_callback,\n",
|
||||
" z_value=db_config[\"z_value\"],\n",
|
||||
" )\n",
|
||||
" # Group the results by database name.\n",
|
||||
" raw_msa_results[db_name].extend(jackhmmer_runner.query(fasta_path))\n",
|
||||
"\n",
|
||||
" return raw_msa_results\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"features_for_chain = {}\n",
|
||||
"raw_msa_results_for_sequence = {}\n",
|
||||
"for sequence_index, sequence in enumerate(sequences, start=1):\n",
|
||||
" print(f\"\\nGetting MSA for sequence {sequence_index}\")\n",
|
||||
"\n",
|
||||
" fasta_path = f\"target_{sequence_index}.fasta\"\n",
|
||||
" with open(fasta_path, \"wt\") as f:\n",
|
||||
" f.write(f\">query\\n{sequence}\")\n",
|
||||
"\n",
|
||||
" # Don't do redundant work for multiple copies of the same chain in the multimer.\n",
|
||||
" if sequence not in raw_msa_results_for_sequence:\n",
|
||||
" raw_msa_results = get_msa(fasta_path=fasta_path)\n",
|
||||
" raw_msa_results_for_sequence[sequence] = raw_msa_results\n",
|
||||
" else:\n",
|
||||
" raw_msa_results = copy.deepcopy(raw_msa_results_for_sequence[sequence])\n",
|
||||
"\n",
|
||||
" # Extract the MSAs from the Stockholm files.\n",
|
||||
" # NB: deduplication happens later in pipeline.make_msa_features.\n",
|
||||
" single_chain_msas = []\n",
|
||||
" uniprot_msa = None\n",
|
||||
" for db_name, db_results in raw_msa_results.items():\n",
|
||||
" merged_msa = notebook_utils.merge_chunked_msa(\n",
|
||||
" results=db_results, max_hits=MAX_HITS.get(db_name)\n",
|
||||
" )\n",
|
||||
" if merged_msa.sequences and db_name != \"uniprot\":\n",
|
||||
" single_chain_msas.append(merged_msa)\n",
|
||||
" msa_size = len(set(merged_msa.sequences))\n",
|
||||
" print(\n",
|
||||
" f\"{msa_size} unique sequences found in {db_name} for sequence {sequence_index}\"\n",
|
||||
" )\n",
|
||||
" elif merged_msa.sequences and db_name == \"uniprot\":\n",
|
||||
" uniprot_msa = merged_msa\n",
|
||||
"\n",
|
||||
" notebook_utils.show_msa_info(\n",
|
||||
" single_chain_msas=single_chain_msas, sequence_index=sequence_index\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Turn the raw data into model features.\n",
|
||||
" feature_dict = {}\n",
|
||||
" feature_dict.update(\n",
|
||||
" pipeline.make_sequence_features(\n",
|
||||
" sequence=sequence, description=\"query\", num_res=len(sequence)\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
" feature_dict.update(pipeline.make_msa_features(msas=single_chain_msas))\n",
|
||||
" # We don't use templates in AlphaFold notebook, add only empty placeholder features.\n",
|
||||
" feature_dict.update(\n",
|
||||
" notebook_utils.empty_placeholder_template_features(\n",
|
||||
" num_templates=0, num_res=len(sequence)\n",
|
||||
" )\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Construct the all_seq features only for heteromers, not homomers.\n",
|
||||
" if (\n",
|
||||
" model_type_to_use == notebook_utils.ModelType.MULTIMER\n",
|
||||
" and len(set(sequences)) > 1\n",
|
||||
" ):\n",
|
||||
" valid_feats = msa_pairing.MSA_FEATURES + (\n",
|
||||
" \"msa_uniprot_accession_identifiers\",\n",
|
||||
" \"msa_species_identifiers\",\n",
|
||||
" )\n",
|
||||
" all_seq_features = {\n",
|
||||
" f\"{k}_all_seq\": v\n",
|
||||
" for k, v in pipeline.make_msa_features([uniprot_msa]).items()\n",
|
||||
" if k in valid_feats\n",
|
||||
" }\n",
|
||||
" feature_dict.update(all_seq_features)\n",
|
||||
"\n",
|
||||
" features_for_chain[protein.PDB_CHAIN_IDS[sequence_index - 1]] = feature_dict\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Do further feature post-processing depending on the model type.\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" np_example = features_for_chain[protein.PDB_CHAIN_IDS[0]]\n",
|
||||
"\n",
|
||||
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" all_chain_features = {}\n",
|
||||
" for chain_id, chain_features in features_for_chain.items():\n",
|
||||
" all_chain_features[chain_id] = pipeline_multimer.convert_monomer_features(\n",
|
||||
" chain_features, chain_id\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" all_chain_features = pipeline_multimer.add_assembly_features(all_chain_features)\n",
|
||||
"\n",
|
||||
" np_example = feature_processing.pair_and_merge(\n",
|
||||
" all_chain_features=all_chain_features, is_prokaryote=is_prokaryote\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Pad MSA to avoid zero-sized extra_msa.\n",
|
||||
" np_example = pipeline_multimer.pad_msa(np_example, min_num_seq=512)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9640643486bd"
|
||||
},
|
||||
"source": [
|
||||
"## Run AlphaFold\n",
|
||||
"\n",
|
||||
"Once this cell has been executed, a zip-archive \"prediction.zip\" with the obtained prediction will be saved on the VM, and available for download to your computer in the sidebar. In case you are having issues with the relaxation stage, you can disable it below. Warning: This means that the prediction might have distracting small stereochemical violations."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"collapsed": true,
|
||||
"jupyter": {
|
||||
"source_hidden": true
|
||||
},
|
||||
"cellView": "form",
|
||||
"id": "XUo6foMQxwS2"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"run_relax = True\n",
|
||||
"\n",
|
||||
"# --- Run the model ---\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" model_names = config.MODEL_PRESETS[\"monomer\"] + (\"model_2_ptm\",)\n",
|
||||
"elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" model_names = config.MODEL_PRESETS[\"multimer\"]\n",
|
||||
"\n",
|
||||
"output_dir = \"prediction\"\n",
|
||||
"os.makedirs(output_dir, exist_ok=True)\n",
|
||||
"\n",
|
||||
"plddts = {}\n",
|
||||
"ranking_confidences = {}\n",
|
||||
"pae_outputs = {}\n",
|
||||
"unrelaxed_proteins = {}\n",
|
||||
"\n",
|
||||
"with tqdm.notebook.tqdm(total=len(model_names) + 1, bar_format=TQDM_BAR_FORMAT) as pbar:\n",
|
||||
" for model_name in model_names:\n",
|
||||
" pbar.set_description(f\"Running {model_name}\")\n",
|
||||
"\n",
|
||||
" cfg = config.model_config(model_name)\n",
|
||||
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" cfg.data.eval.num_ensemble = 1\n",
|
||||
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" cfg.model.num_ensemble_eval = 1\n",
|
||||
" params = data.get_model_haiku_params(model_name, \"./alphafold/data\")\n",
|
||||
" model_runner = model.RunModel(cfg, params)\n",
|
||||
" processed_feature_dict = model_runner.process_features(\n",
|
||||
" np_example, random_seed=0\n",
|
||||
" )\n",
|
||||
" prediction = model_runner.predict(\n",
|
||||
" processed_feature_dict, random_seed=random.randrange(sys.maxsize)\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" mean_plddt = prediction[\"plddt\"].mean()\n",
|
||||
"\n",
|
||||
" if model_type_to_use == notebook_utils.ModelType.MONOMER:\n",
|
||||
" if \"predicted_aligned_error\" in prediction:\n",
|
||||
" pae_outputs[model_name] = (\n",
|
||||
" prediction[\"predicted_aligned_error\"],\n",
|
||||
" prediction[\"max_predicted_aligned_error\"],\n",
|
||||
" )\n",
|
||||
" else:\n",
|
||||
" # Monomer models are sorted by mean pLDDT. Do not put monomer pTM models here as they\n",
|
||||
" # should never get selected.\n",
|
||||
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
|
||||
" plddts[model_name] = prediction[\"plddt\"]\n",
|
||||
" elif model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" # Multimer models are sorted by pTM+ipTM.\n",
|
||||
" ranking_confidences[model_name] = prediction[\"ranking_confidence\"]\n",
|
||||
" plddts[model_name] = prediction[\"plddt\"]\n",
|
||||
" pae_outputs[model_name] = (\n",
|
||||
" prediction[\"predicted_aligned_error\"],\n",
|
||||
" prediction[\"max_predicted_aligned_error\"],\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Set the b-factors to the per-residue plddt.\n",
|
||||
" final_atom_mask = prediction[\"structure_module\"][\"final_atom_mask\"]\n",
|
||||
" b_factors = prediction[\"plddt\"][:, None] * final_atom_mask\n",
|
||||
" unrelaxed_protein = protein.from_prediction(\n",
|
||||
" processed_feature_dict,\n",
|
||||
" prediction,\n",
|
||||
" b_factors=b_factors,\n",
|
||||
" remove_leading_feature_dimension=(\n",
|
||||
" model_type_to_use == notebook_utils.ModelType.MONOMER\n",
|
||||
" ),\n",
|
||||
" )\n",
|
||||
" unrelaxed_proteins[model_name] = unrelaxed_protein\n",
|
||||
"\n",
|
||||
" # Delete unused outputs to save memory.\n",
|
||||
" del model_runner\n",
|
||||
" del params\n",
|
||||
" del prediction\n",
|
||||
" pbar.update(n=1)\n",
|
||||
"\n",
|
||||
" # --- AMBER relax the best model ---\n",
|
||||
"\n",
|
||||
" # Find the best model according to the mean pLDDT.\n",
|
||||
" best_model_name = max(\n",
|
||||
" ranking_confidences.keys(), key=lambda x: ranking_confidences[x]\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" if run_relax:\n",
|
||||
" pbar.set_description(\"AMBER relaxation\")\n",
|
||||
" amber_relaxer = relax.AmberRelaxation(\n",
|
||||
" max_iterations=0,\n",
|
||||
" tolerance=2.39,\n",
|
||||
" stiffness=10.0,\n",
|
||||
" exclude_residues=[],\n",
|
||||
" max_outer_iterations=3,\n",
|
||||
" )\n",
|
||||
" relaxed_pdb, _, _ = amber_relaxer.process(\n",
|
||||
" prot=unrelaxed_proteins[best_model_name]\n",
|
||||
" )\n",
|
||||
" else:\n",
|
||||
" print(\"Warning: Running without the relaxation stage.\")\n",
|
||||
" relaxed_pdb = protein.to_pdb(unrelaxed_proteins[best_model_name])\n",
|
||||
" pbar.update(n=1) # Finished AMBER relax.\n",
|
||||
"\n",
|
||||
"# Construct multiclass b-factors to indicate confidence bands\n",
|
||||
"# 0=very low, 1=low, 2=confident, 3=very high\n",
|
||||
"banded_b_factors = []\n",
|
||||
"for plddt in plddts[best_model_name]:\n",
|
||||
" for idx, (min_val, max_val, _) in enumerate(PLDDT_BANDS):\n",
|
||||
" if plddt >= min_val and plddt <= max_val:\n",
|
||||
" banded_b_factors.append(idx)\n",
|
||||
" break\n",
|
||||
"banded_b_factors = np.array(banded_b_factors)[:, None] * final_atom_mask\n",
|
||||
"to_visualize_pdb = utils.overwrite_b_factors(relaxed_pdb, banded_b_factors)\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Write out the prediction\n",
|
||||
"pred_output_path = os.path.join(output_dir, \"selected_prediction.pdb\")\n",
|
||||
"with open(pred_output_path, \"w\") as f:\n",
|
||||
" f.write(relaxed_pdb)\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# --- Visualise the prediction & confidence ---\n",
|
||||
"show_sidechains = True\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"def plot_plddt_legend():\n",
|
||||
" \"\"\"Plots the legend for pLDDT.\"\"\"\n",
|
||||
" thresh = [\n",
|
||||
" \"Very low (pLDDT < 50)\",\n",
|
||||
" \"Low (70 > pLDDT > 50)\",\n",
|
||||
" \"Confident (90 > pLDDT > 70)\",\n",
|
||||
" \"Very high (pLDDT > 90)\",\n",
|
||||
" ]\n",
|
||||
"\n",
|
||||
" colors = [x[2] for x in PLDDT_BANDS]\n",
|
||||
"\n",
|
||||
" plt.figure(figsize=(2, 2))\n",
|
||||
" for c in colors:\n",
|
||||
" plt.bar(0, 0, color=c)\n",
|
||||
" plt.legend(thresh, frameon=False, loc=\"center\", fontsize=20)\n",
|
||||
" plt.xticks([])\n",
|
||||
" plt.yticks([])\n",
|
||||
" ax = plt.gca()\n",
|
||||
" ax.spines[\"right\"].set_visible(False)\n",
|
||||
" ax.spines[\"top\"].set_visible(False)\n",
|
||||
" ax.spines[\"left\"].set_visible(False)\n",
|
||||
" ax.spines[\"bottom\"].set_visible(False)\n",
|
||||
" plt.title(\"Model Confidence\", fontsize=20, pad=20)\n",
|
||||
" return plt\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Show the structure coloured by chain if the multimer model has been used.\n",
|
||||
"if model_type_to_use == notebook_utils.ModelType.MULTIMER:\n",
|
||||
" multichain_view = py3Dmol.view(width=800, height=600)\n",
|
||||
" multichain_view.addModelsAsFrames(to_visualize_pdb)\n",
|
||||
" multichain_style = {\"cartoon\": {\"colorscheme\": \"chain\"}}\n",
|
||||
" multichain_view.setStyle({\"model\": -1}, multichain_style)\n",
|
||||
" multichain_view.zoomTo()\n",
|
||||
" multichain_view.show()\n",
|
||||
"\n",
|
||||
"# Color the structure by per-residue pLDDT\n",
|
||||
"color_map = {i: bands[2] for i, bands in enumerate(PLDDT_BANDS)}\n",
|
||||
"view = py3Dmol.view(width=800, height=600)\n",
|
||||
"view.addModelsAsFrames(to_visualize_pdb)\n",
|
||||
"style = {\"cartoon\": {\"colorscheme\": {\"prop\": \"b\", \"map\": color_map}}}\n",
|
||||
"if show_sidechains:\n",
|
||||
" style[\"stick\"] = {}\n",
|
||||
"view.setStyle({\"model\": -1}, style)\n",
|
||||
"view.zoomTo()\n",
|
||||
"\n",
|
||||
"grid = GridspecLayout(1, 2)\n",
|
||||
"out = Output()\n",
|
||||
"with out:\n",
|
||||
" view.show()\n",
|
||||
"grid[0, 0] = out\n",
|
||||
"\n",
|
||||
"out = Output()\n",
|
||||
"with out:\n",
|
||||
" plot_plddt_legend().show()\n",
|
||||
"grid[0, 1] = out\n",
|
||||
"\n",
|
||||
"display.display(grid)\n",
|
||||
"\n",
|
||||
"# Display pLDDT and predicted aligned error (if output by the model).\n",
|
||||
"if pae_outputs:\n",
|
||||
" num_plots = 2\n",
|
||||
"else:\n",
|
||||
" num_plots = 1\n",
|
||||
"\n",
|
||||
"plt.figure(figsize=[8 * num_plots, 6])\n",
|
||||
"plt.subplot(1, num_plots, 1)\n",
|
||||
"plt.plot(plddts[best_model_name])\n",
|
||||
"plt.title(\"Predicted LDDT\")\n",
|
||||
"plt.xlabel(\"Residue\")\n",
|
||||
"plt.ylabel(\"pLDDT\")\n",
|
||||
"\n",
|
||||
"if num_plots == 2:\n",
|
||||
" plt.subplot(1, 2, 2)\n",
|
||||
" pae, max_pae = list(pae_outputs.values())[0]\n",
|
||||
" plt.imshow(pae, vmin=0.0, vmax=max_pae, cmap=\"Greens_r\")\n",
|
||||
" plt.colorbar(fraction=0.046, pad=0.04)\n",
|
||||
"\n",
|
||||
" # Display lines at chain boundaries.\n",
|
||||
" best_unrelaxed_prot = unrelaxed_proteins[best_model_name]\n",
|
||||
" total_num_res = best_unrelaxed_prot.residue_index.shape[-1]\n",
|
||||
" chain_ids = best_unrelaxed_prot.chain_index\n",
|
||||
" for chain_boundary in np.nonzero(chain_ids[:-1] - chain_ids[1:]):\n",
|
||||
" if chain_boundary.size:\n",
|
||||
" plt.plot([0, total_num_res], [chain_boundary, chain_boundary], color=\"red\")\n",
|
||||
" plt.plot([chain_boundary, chain_boundary], [0, total_num_res], color=\"red\")\n",
|
||||
"\n",
|
||||
" plt.title(\"Predicted Aligned Error\")\n",
|
||||
" plt.xlabel(\"Scored residue\")\n",
|
||||
" plt.ylabel(\"Aligned residue\")\n",
|
||||
"\n",
|
||||
"# Save the predicted aligned error (if it exists).\n",
|
||||
"pae_output_path = os.path.join(output_dir, \"predicted_aligned_error.json\")\n",
|
||||
"if pae_outputs:\n",
|
||||
" # Save predicted aligned error in the same format as the AF EMBL DB.\n",
|
||||
" pae_data = notebook_utils.get_pae_json(pae=pae, max_pae=max_pae.item())\n",
|
||||
" with open(pae_output_path, \"w\") as f:\n",
|
||||
" f.write(pae_data)\n",
|
||||
"\n",
|
||||
"!zip -q -r {output_dir}.zip {output_dir}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "lUQAn5LYC5n4"
|
||||
},
|
||||
"source": [
|
||||
"### Interpreting the prediction\n",
|
||||
"\n",
|
||||
"In general predicted LDDT (pLDDT) is best used for intra-domain confidence, whereas Predicted Aligned Error (PAE) is best used for determining between domain or between chain confidence.\n",
|
||||
"\n",
|
||||
"Please see the [AlphaFold methods paper](https://www.nature.com/articles/s41586-021-03819-2), the [AlphaFold predictions of the human proteome paper](https://www.nature.com/articles/s41586-021-03828-1), and the [AlphaFold-Multimer paper](https://www.biorxiv.org/content/10.1101/2021.10.04.463034v1) as well as [our FAQ](https://alphafold.ebi.ac.uk/faq) on how to interpret AlphaFold predictions."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "jeb2z8DIA4om"
|
||||
},
|
||||
"source": [
|
||||
"## FAQ & Troubleshooting\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"* How do I get a predicted protein structure for my protein?\n",
|
||||
" * Connect the notebook to the Jupyter kernel \"Python 3 (ipykernel)\".\n",
|
||||
" * Paste the amino acid sequence of your protein (without any headers) into the variable sequence_1 in \"Making a Prediction\".\n",
|
||||
" * Run all cells in the notebook, either by running them individually or via \"Kernel\"/\"Restart Kernel and Run All Cells...\"\n",
|
||||
" * The predicted protein structure will be downloaded once all cells have been executed. Note: This can take minutes to hours - see below.\n",
|
||||
"* How long will this take?\n",
|
||||
" * The search against genetic databases can take minutes to hours.\n",
|
||||
" * Running AlphaFold and generating the prediction can take minutes to hours, depending on the length of your protein and on which GPU-type your VM has access to.\n",
|
||||
"* My notebook no longer seems to be doing anything, what should I do?\n",
|
||||
" * Some steps may take minutes to hours to complete.\n",
|
||||
" * If nothing happens or if you receive an error message, try restarting your notebook runtime via \"Kernel\"/\"Restart Kernel and Run All Cells...\".\n",
|
||||
" * If this doesn’t help, try resetting restarting your VM inside the GCloud Console (\"Compute Engine\"/\"VM Instances\").\n",
|
||||
"* How does this compare to the open-source version of AlphaFold?\n",
|
||||
" * This notebook version of AlphaFold searches a selected portion of the BFD dataset and currently doesn’t use templates, so its accuracy is reduced in comparison to the full version of AlphaFold that is described in the [AlphaFold paper](https://doi.org/10.1038/s41586-021-03819-2) and [Github repo](https://github.com/deepmind/alphafold/) (the full version is available via the inference script).\n",
|
||||
"* I received a warning “Notebook requires high RAM”, what do I do?\n",
|
||||
" * In the \"Compute Engine\"/\"VM Instances\" Console menu, you can reconfigure the host VM settings. See [Changing the machine type of a VM instance](https://cloud.google.com/compute/docs/instances/changing-machine-type-of-stopped-instance) for instructions.\n",
|
||||
"* Does this tool install anything on my computer?\n",
|
||||
" * No, everything happens in the VM instance within your Google Cloud project.\n",
|
||||
"* How should I share feedback and bug reports?\n",
|
||||
" * Please share any feedback and bug reports as an [issue](https://github.com/GoogleCloudPlatform/vertex-ai-samples/issues) on Github.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## Related work\n",
|
||||
"\n",
|
||||
"Take a look at these Colab notebooks provided by the community (please note that these notebooks may vary from our validated AlphaFold system and we cannot guarantee their accuracy):\n",
|
||||
"\n",
|
||||
"* The [ColabFold AlphaFold2 notebook](https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb) by Sergey Ovchinnikov, Milot Mirdita and Martin Steinegger, which uses an API hosted at the Södinglab based on the MMseqs2 server ([Mirdita et al. 2019, Bioinformatics](https://academic.oup.com/bioinformatics/article/35/16/2856/5280135)) for the multiple sequence alignment creation.\n"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "YfPhvYgKC81B"
|
||||
},
|
||||
"source": [
|
||||
"# License and Disclaimer\n",
|
||||
"\n",
|
||||
"This is not an officially-supported Google product.\n",
|
||||
"\n",
|
||||
"This notebook and other information provided is for theoretical modelling only, caution should be exercised in its use. It is provided ‘as-is’ without any warranty of any kind, whether expressed or implied. Information is not intended to be a substitute for professional medical advice, diagnosis, or treatment, and does not constitute medical or other professional advice.\n",
|
||||
"\n",
|
||||
"Copyright 2021 DeepMind Technologies Limited.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## AlphaFold Code License\n",
|
||||
"\n",
|
||||
"Licensed under the Apache License, Version 2.0 (the \"License\"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.\n",
|
||||
"\n",
|
||||
"Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an \"AS IS\" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.\n",
|
||||
"\n",
|
||||
"## Model Parameters License\n",
|
||||
"\n",
|
||||
"The AlphaFold parameters are made available under the terms of the Creative Commons Attribution 4.0 International (CC BY 4.0) license. You can find details at: https://creativecommons.org/licenses/by/4.0/legalcode\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## Third-party software\n",
|
||||
"\n",
|
||||
"Use of the third-party software, libraries or code referred to in the [Acknowledgements section](https://github.com/deepmind/alphafold/#acknowledgements) in the AlphaFold README may be governed by separate terms and conditions or license provisions. Your use of the third-party software, libraries or code is subject to any such terms and you should check that you can comply with any applicable restrictions or terms and conditions before use.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"## Mirrored Databases\n",
|
||||
"\n",
|
||||
"The following databases have been mirrored by DeepMind, and are available with reference to the following:\n",
|
||||
"* UniProt: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
|
||||
"* UniRef90: v2021\\_03 (unmodified), by The UniProt Consortium, available under a [Creative Commons Attribution-NoDerivatives 4.0 International License](http://creativecommons.org/licenses/by-nd/4.0/).\n",
|
||||
"* MGnify: v2019\\_05 (unmodified), by Mitchell AL et al., available free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use under [CC0 1.0 Universal (CC0 1.0) Public Domain Dedication](https://creativecommons.org/publicdomain/zero/1.0/).\n",
|
||||
"* BFD: (modified), by Steinegger M. and Söding J., modified by DeepMind, available under a [Creative Commons Attribution-ShareAlike 4.0 International License](https://creativecommons.org/licenses/by/4.0/). See the Methods section of the [AlphaFold proteome paper](https://www.nature.com/articles/s41586-021-03828-1) for details."
|
||||
]
|
||||
}
|
||||
],
|
||||
"metadata": {
|
||||
"accelerator": "GPU",
|
||||
"colab": {
|
||||
"collapsed_sections": [],
|
||||
"name": "AlphaFold.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
"kernelspec": {
|
||||
"display_name": "Python 3",
|
||||
"name": "python3"
|
||||
}
|
||||
},
|
||||
"nbformat": 4,
|
||||
"nbformat_minor": 0
|
||||
}
|
||||
@@ -1,82 +0,0 @@
|
||||
# Copyright 2022 Google LLC
|
||||
#
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
#
|
||||
# http://www.apache.org/licenses/LICENSE-2.0
|
||||
#
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
ARG CUDA_MAJOR=11
|
||||
ARG CUDA_MINOR=0
|
||||
|
||||
FROM gcr.io/deeplearning-platform-release/base-cu110
|
||||
|
||||
ARG CUDA_MAJOR
|
||||
ARG CUDA_MINOR
|
||||
|
||||
SHELL ["/bin/bash", "-c"]
|
||||
|
||||
RUN apt-get update && DEBIAN_FRONTEND=noninteractive apt-get install -y \
|
||||
build-essential \
|
||||
cmake \
|
||||
cuda-command-line-tools-${CUDA_MAJOR}-${CUDA_MINOR} \
|
||||
git \
|
||||
hmmer \
|
||||
kalign \
|
||||
tzdata \
|
||||
wget \
|
||||
&& rm -rf /var/lib/apt/lists/*
|
||||
|
||||
# Compile HHsuite from source.
|
||||
RUN git clone --branch v3.3.0 https://github.com/soedinglab/hh-suite.git /tmp/hh-suite \
|
||||
&& mkdir /tmp/hh-suite/build \
|
||||
&& pushd /tmp/hh-suite/build \
|
||||
&& cmake -DCMAKE_INSTALL_PREFIX=/opt/hhsuite .. \
|
||||
&& make -j 4 && make install \
|
||||
&& ln -s /opt/hhsuite/bin/* /usr/bin \
|
||||
&& popd \
|
||||
&& rm -rf /tmp/hh-suite
|
||||
|
||||
ENV PATH="/opt/conda/bin:$PATH"
|
||||
RUN conda update -qy conda \
|
||||
&& conda install -y -c conda-forge \
|
||||
openmm=7.5.1 \
|
||||
cudatoolkit==${CUDA_VERSION} \
|
||||
pdbfixer \
|
||||
pip \
|
||||
python=3.7
|
||||
|
||||
COPY . /app/alphafold
|
||||
|
||||
# Install pip packages.
|
||||
RUN pip3 install --upgrade pip \
|
||||
&& pip3 install -r /app/alphafold/requirements.txt \
|
||||
&& pip3 install py3Dmol tqdm \
|
||||
&& pip3 install --upgrade jax==0.2.14 jaxlib==0.1.69+cuda${CUDA_MAJOR}${CUDA_MINOR} -f \
|
||||
https://storage.googleapis.com/jax-releases/jax_releases.html
|
||||
|
||||
# Install alphafold.
|
||||
WORKDIR /app/alphafold
|
||||
RUN python setup.py install
|
||||
|
||||
# Apply OpenMM patch.
|
||||
WORKDIR /opt/conda/lib/python3.7/site-packages
|
||||
RUN patch -p0 < /app/alphafold/docker/openmm.patch
|
||||
|
||||
# Creating a tmp location for jackhmmr; not mounting through to host though.
|
||||
RUN sudo mkdir -m 777 --parents /tmp/ramdisk
|
||||
|
||||
# We need to run `ldconfig` first to ensure GPUs are visible, due to some quirk
|
||||
# with Debian. See https://github.com/NVIDIA/nvidia-docker/issues/1399 for
|
||||
# details.
|
||||
# ENTRYPOINT does not support easily running multiple commands, so instead we
|
||||
# write a shell script to wrap them up.
|
||||
WORKDIR /home/jupyter
|
||||
RUN echo '#!/bin/bash\nldconfig\n\'
|
||||
|
||||
@@ -1,20 +0,0 @@
|
||||
#!/usr/bin/env bash
|
||||
set -e
|
||||
|
||||
# Prod (Publicly viewable)
|
||||
PROJECT=cloud-devrel-public-resources
|
||||
REPOSITORY=alphafold
|
||||
LOCAL_IMAGE=alphafold-on-gcp
|
||||
REMOTE_IMAGE=${LOCAL_IMAGE?}
|
||||
TAG=latest
|
||||
REGISTRY="us-west1-docker.pkg.dev/${PROJECT?}/${REPOSITORY?}/${REMOTE_IMAGE?}:${TAG?}"
|
||||
|
||||
git clone https://github.com/deepmind/alphafold.git
|
||||
|
||||
cp Dockerfile alphafold/docker/Dockerfile
|
||||
cp AlphaFold.ipynb alphafold/notebooks/AlphaFold.ipynb
|
||||
|
||||
cd alphafold && sudo docker build --tag ${LOCAL_IMAGE?}:${TAG?} -f docker/Dockerfile .
|
||||
|
||||
sudo docker tag ${LOCAL_IMAGE?}:${TAG?} ${REGISTRY?}
|
||||
sudo docker push ${REGISTRY?}
|
||||
|
Before Width: | Height: | Size: 3.1 KiB |
@@ -1,5 +0,0 @@
|
||||
testdata/*
|
||||
build.py
|
||||
test.py
|
||||
state_dict.pth
|
||||
config.json
|
||||
@@ -1,5 +0,0 @@
|
||||
cpr_model_server.py
|
||||
entrypoint.py
|
||||
state_dict.pth
|
||||
config.json
|
||||
**/__pycache__
|
||||
@@ -1,93 +0,0 @@
|
||||
# CPR Example: PyTorch Image Models (timm)
|
||||
|
||||
## About CPR
|
||||
|
||||
CPR ([custom prediction routines](https://github.com/googleapis/python-aiplatform/blob/custom-prediction-routine/google/cloud/aiplatform/prediction/README.md)) is a framework designed by Google Cloud developers to make it easier to combine machine learning models with custom preprocessing and postprocessing logic in a real-time serving application.
|
||||
|
||||
## Using this example
|
||||
|
||||
This code is a self-contained example of a custom model server project built using CPR.
|
||||
|
||||
As is, you can use it to serve the ViT-Small image classification model from Ross Wightman's [`timm`](https://github.com/rwightman/pytorch-image-models) library of image model implementations in PyTorch. Both CPU and GPU are supported.
|
||||
|
||||
You can also consider using the code here as a template for your own CPR project if you want to use a different model from `timm`, a different PyTorch model, or an entirely different framework.
|
||||
|
||||
### Requirements
|
||||
|
||||
In order to use this example, you'll need Docker and Python 3 installed on your system.
|
||||
|
||||
To get started, first create a virtual environment in an empty directory:
|
||||
```sh
|
||||
mkdir cpr-example
|
||||
python3 -m venv cpr-example
|
||||
cd cpr-example && source bin/activate
|
||||
```
|
||||
|
||||
Then, clone the [vertex-ai-samples repo](https://github.com/GoogleCloudPlatform/vertex-ai-samples) in that directory:
|
||||
```sh
|
||||
git clone https://github.com/GoogleCloudPlatform/vertex-ai-samples.git
|
||||
cd vertex-ai-samples/community-content/cpr-examples/timm_serving
|
||||
```
|
||||
|
||||
Finally, install the Python modules required to build and run the model server:
|
||||
```sh
|
||||
pip install -r requirements.txt
|
||||
```
|
||||
|
||||
### Predictor
|
||||
|
||||
The `TimmPredictor` class in `timm_serving/predictor.py` implements most of the important logic for the server.
|
||||
|
||||
- `load(artifacts_dir)`: The predictor's `load` method is called when the server starts up in order to set up the predictor, usually by loading model weights and any artifacts needed for preprocessing and postprocessing. In this example, we initialize the saved model from the `state_dict.pth` file located inside the `artifacts_dir` folder and create the preprocessing transform from the model config.
|
||||
|
||||
- `preprocess`, `predict`, `postprocess`: These methods are applied in sequence to the deserialized JSON data from each request.
|
||||
- `preprocess` decodes images from base64 and apply cropping, scaling and normalizing transforms.
|
||||
- `predict` runs the ViT-Small model on the preprocessed images and returns class scores.
|
||||
- `postprocess` finds the top five classes and packs the class names, probabilities, and indices in a serializable result.
|
||||
|
||||
### Building the container
|
||||
|
||||
To build the model server locally, run the build command:
|
||||
```sh
|
||||
python build.py build
|
||||
```
|
||||
|
||||
You can edit configuration values such as the model server's base image, the name and tag assigned to the image, and the path where model weights are stored locally.
|
||||
|
||||
When you run the build command, model weights are downloaded and the model server container is built.
|
||||
|
||||
### Running local tests
|
||||
|
||||
`test.py` contains a suite of unit tests for the predictor as well as end-to-end tests for the model server.
|
||||
|
||||
To run the tests:
|
||||
```sh
|
||||
python test.py
|
||||
```
|
||||
|
||||
All of the test images are public domain.
|
||||
- [Cat](https://commons.wikimedia.org/wiki/File:Stray_cat_on_wall.jpg)
|
||||
- [Airplane](https://commons.wikimedia.org/wiki/File:Airplanes_jets.jpg)
|
||||
- The infamous [mandrill](https://commons.wikimedia.org/wiki/File:Wikipedia-sipi-image-db-mandrill-4.2.03.png)
|
||||
|
||||
### Deploying to Vertex AI
|
||||
|
||||
Before uploading or deploying the container, you'll need to modify `config.py` to set appropriate values for:
|
||||
- `project_id`: Your GCP project id.
|
||||
- `region`: Region where the model will be uploaded and deployed.
|
||||
- `repository`: [Artifact Registry repository](https://cloud.google.com/artifact-registry/docs/repositories/create-repos) in your project where the container image will be uploaded.
|
||||
- `artifacts_gcs_dir`: Folder in a [Google Cloud Storage bucket](https://cloud.google.com/storage/docs/creating-buckets) where the model weights will be uploaded.
|
||||
|
||||
Once this is done, first upload the model:
|
||||
```sh
|
||||
python build.py upload
|
||||
```
|
||||
|
||||
Then deploy it:
|
||||
```sh
|
||||
python build.py deploy
|
||||
```
|
||||
|
||||
If you run the deploy command again, it will create a new endpoint. If you want to undeploy the model, you can do so using the Vertex AI dashboard on the Google Cloud console, or use `gcloud ai endpoints undeploy` from the command line.
|
||||
|
||||
After deploying successfully, you can run `python build.py probe` to send a sample request to the deployed model.
|
||||
@@ -1,117 +0,0 @@
|
||||
# Copyright 2022 Google LLC
|
||||
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
|
||||
# https://www.apache.org/licenses/LICENSE-2.0
|
||||
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Build the model server container."""
|
||||
import json
|
||||
import logging
|
||||
import os
|
||||
import pathlib
|
||||
from typing import Sequence
|
||||
|
||||
from absl import app
|
||||
from absl import logging
|
||||
from config import CPRConfig
|
||||
from google.cloud import aiplatform
|
||||
from google.cloud.aiplatform import prediction as cpr
|
||||
import smart_open
|
||||
import timm
|
||||
from timm_serving import predictor
|
||||
import torch
|
||||
|
||||
|
||||
def build_container(config: CPRConfig, tag: str) -> cpr.LocalModel:
|
||||
"""Build the model server container.
|
||||
|
||||
Args:
|
||||
tag: Output image tag.
|
||||
|
||||
Returns:
|
||||
LocalModel exposing the built model server.
|
||||
"""
|
||||
return cpr.LocalModel.build_cpr_model(
|
||||
src_dir=os.path.join(os.getcwd()),
|
||||
output_image_uri=tag,
|
||||
base_image=config.base_image,
|
||||
predictor=predictor.TimmPredictor,
|
||||
requirements_path=os.path.join(os.getcwd(), "requirements.txt"),
|
||||
)
|
||||
|
||||
|
||||
def save_model_artifact(destination: str) -> None:
|
||||
"""Save a copy of the model state dict."""
|
||||
model = timm.create_model(predictor.TimmPredictor.TIMM_MODEL_NAME, pretrained=True)
|
||||
dest_file = os.path.join(destination, predictor.TimmPredictor.WEIGHTS_FILE)
|
||||
with smart_open.open(dest_file, "wb") as f:
|
||||
torch.save(model, f)
|
||||
logging.info("Saved model to %s", dest_file)
|
||||
logging.info("%s parameters", sum(p.numel() for p in model.parameters()))
|
||||
|
||||
|
||||
def upload_model(config: CPRConfig) -> aiplatform.Model:
|
||||
"""Tag and upload the model server."""
|
||||
ar_tag = (
|
||||
f"{config.region}-docker.pkg.dev/{config.project_id}"
|
||||
f"/{config.repository}/{config.image}"
|
||||
)
|
||||
local_model = build_container(config, tag=ar_tag)
|
||||
aiplatform.init(project=config.project_id, location=config.region)
|
||||
local_model.push_image()
|
||||
aip_model = aiplatform.Model.upload(
|
||||
local_model=local_model,
|
||||
display_name=predictor.TimmPredictor.TIMM_MODEL_NAME,
|
||||
artifact_uri=config.artifact_gcs_dir,
|
||||
)
|
||||
config.model_name = aip_model.resource_name
|
||||
config.save()
|
||||
return aip_model
|
||||
|
||||
|
||||
def deploy_model(config: CPRConfig) -> aiplatform.Endpoint:
|
||||
"""Deploy the model server to a Vertex Prediction endpoint."""
|
||||
aiplatform.init(project=config.project_id, location=config.region)
|
||||
aip_model = aiplatform.Model(model_name=config.model_name)
|
||||
endpoint = aip_model.deploy(machine_type=config.machine_type)
|
||||
config.endpoint_name = endpoint.resource_name
|
||||
config.save()
|
||||
return endpoint
|
||||
|
||||
|
||||
def probe_prediction(config: CPRConfig, request_path: str) -> None:
|
||||
"""Send a sample prediction request to the Vertex Prediction endpoint."""
|
||||
aiplatform.init(project=config.project_id, location=config.region)
|
||||
aip_endpoint = aiplatform.Endpoint(endpoint_name=config.endpoint_name)
|
||||
with open(request_path) as f:
|
||||
logging.info(aip_endpoint.predict(**json.load(f)))
|
||||
|
||||
|
||||
def main(argv: Sequence[str]):
|
||||
config = CPRConfig()
|
||||
if pathlib.Path(config.config_file).exists():
|
||||
config.load()
|
||||
|
||||
actions = set(argv[1:])
|
||||
if "build" in actions:
|
||||
build_container(config, config.image)
|
||||
save_model_artifact(config.artifact_local_dir)
|
||||
if "upload" in actions:
|
||||
save_model_artifact(config.artifact_gcs_dir)
|
||||
upload_model(config)
|
||||
if "deploy" in actions:
|
||||
deploy_model(config)
|
||||
if "probe" in actions:
|
||||
probe_prediction(config, request_path="sample_request.json")
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
app.run(main)
|
||||
@@ -1,76 +0,0 @@
|
||||
# Copyright 2022 Google LLC
|
||||
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
|
||||
# https://www.apache.org/licenses/LICENSE-2.0
|
||||
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
import dataclasses
|
||||
import json
|
||||
|
||||
|
||||
@dataclasses.dataclass
|
||||
class CPRConfig(object):
|
||||
"""Configure the build process by editing the default values here.
|
||||
|
||||
config_file: File path used to save values in this config. (Some
|
||||
values, such as the model name, are generated at build time and
|
||||
depended on by future steps, so saving it allows this script to
|
||||
deploy the model without re-uploading it, for example.)
|
||||
|
||||
base_image: Base Docker image on top of which the model server will
|
||||
be built. By default, a Debian-based Python 3 image without GPU
|
||||
support will be used.
|
||||
|
||||
image: Name and tag assigned to the built model server image.
|
||||
|
||||
artifact_local_dir: Local directory where a copy of the pretrained model weights
|
||||
will be saved.
|
||||
|
||||
region: Google Cloud Region where the model will be uploaded during the
|
||||
build process.
|
||||
|
||||
project_id: Google Cloud project ID.
|
||||
|
||||
repository: Name of the Artifact Registry repository where the container
|
||||
will be uploaded.
|
||||
|
||||
artifact_gcs_dir: Location on GCS where a copy of the pretrained model
|
||||
weights will be uploaded.
|
||||
|
||||
model_name: Full resource path of the uploaded model. This is a write-only
|
||||
field, the value is generated by Vertex AI when the model is uploaded.
|
||||
|
||||
endpoint_name: Full resource path of the created endpoint. This is a
|
||||
write-only field, the value is generated by Vertex AI when the model is
|
||||
deployed to an endpoint.
|
||||
|
||||
machine_type: Machine type to use when deploying the model.
|
||||
"""
|
||||
|
||||
config_file: str = "config.json"
|
||||
base_image: str = "python:3.10-bullseye"
|
||||
image: str = "timm_predictor:latest"
|
||||
artifact_local_dir: str = ""
|
||||
region: str = "us-central1"
|
||||
project_id: str = "samthrasher-experimental"
|
||||
repository: str = "cpr-images"
|
||||
artifact_gcs_dir: str = "gs://samthrasher-cpr-example/timm-vit224/"
|
||||
model_name: str = ""
|
||||
endpoint_name: str = ""
|
||||
machine_type: str = "n1-standard-2"
|
||||
|
||||
def save(self):
|
||||
with open(self.config_file, "w") as f:
|
||||
json.dump(dataclasses.asdict(self), f, indent=2)
|
||||
|
||||
def load(self):
|
||||
with open(self.config_file) as f:
|
||||
self.__init__(**json.load(f))
|
||||
@@ -1,8 +0,0 @@
|
||||
absl-py==1.1.0
|
||||
fastapi==0.75.2
|
||||
uvicorn==0.18.2
|
||||
timm==0.5.4
|
||||
smart_open==6.0.0
|
||||
|
||||
google-cloud-storage>=1.26.0,<2.0.0dev
|
||||
google-cloud-aiplatform[prediction] @ git+https://github.com/googleapis/python-aiplatform.git@custom-prediction-routine
|
||||
@@ -1,249 +0,0 @@
|
||||
"""Test the timm_serving predictor."""
|
||||
import base64
|
||||
import json
|
||||
import logging
|
||||
import os
|
||||
import pickle
|
||||
from typing import List, Dict
|
||||
|
||||
from absl import flags
|
||||
from absl import logging
|
||||
from absl.testing import absltest
|
||||
from config import CPRConfig
|
||||
import fastapi
|
||||
from google.cloud import aiplatform
|
||||
from google.cloud.aiplatform import prediction as cpr
|
||||
import PIL
|
||||
from timm_serving import predictor
|
||||
import torch
|
||||
|
||||
VIT_SMALL_PARAMS = 22878952
|
||||
|
||||
|
||||
def b64_encode_file(path: str) -> str:
|
||||
"""Encode a file's contents as base64.
|
||||
|
||||
Args:
|
||||
path: Path to the file.
|
||||
|
||||
Returns:
|
||||
Base64-encoded contents of the file.
|
||||
"""
|
||||
with open(path, "rb") as f:
|
||||
return str(base64.b64encode(f.read()), encoding="utf-8")
|
||||
|
||||
|
||||
def make_instance_dict(
|
||||
image_paths: List[str], base64_encodings: List[str]
|
||||
) -> Dict[str, List[str]]:
|
||||
"""Generate a dictionary similar to a parsed prediction server request.
|
||||
|
||||
Args:
|
||||
image_paths: Paths to image files to include.
|
||||
base64_encodings: Pre-encoded base64 strings.
|
||||
|
||||
Returns:
|
||||
Dictionary of instances in the format accepted by the preprocessor.
|
||||
"""
|
||||
instances = [s for s in base64_encodings]
|
||||
for path in image_paths:
|
||||
instances.append(b64_encode_file(path))
|
||||
return {"instances": instances}
|
||||
|
||||
|
||||
def count_parameters(model: torch.nn.Module):
|
||||
"""Count the parameters in a Pytorch model.
|
||||
|
||||
Args:
|
||||
model: Pytorch model (nn.Module).
|
||||
|
||||
Returns:
|
||||
Number of parameters in the model.
|
||||
|
||||
"""
|
||||
return sum(p.numel() for p in model.parameters())
|
||||
|
||||
|
||||
class PredictorUnitTests(absltest.TestCase):
|
||||
"""Unit tests for timm_serving.predictor."""
|
||||
|
||||
def setUp(self):
|
||||
super().setUp()
|
||||
self.config = CPRConfig()
|
||||
self.config.load()
|
||||
self.predictor = predictor.TimmPredictor()
|
||||
|
||||
def test_load_from_saved_state_dict_ok(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
self.assertEqual(count_parameters(self.predictor._model), VIT_SMALL_PARAMS)
|
||||
|
||||
def test_load_bad_path(self):
|
||||
with self.assertRaises(FileNotFoundError):
|
||||
self.predictor.load("testdata/")
|
||||
with self.assertRaisesRegex(ValueError, "not a directory"):
|
||||
self.predictor.load("blah")
|
||||
|
||||
def test_load_bad_data(self):
|
||||
with self.assertRaises(pickle.UnpicklingError):
|
||||
self.predictor.load("testdata/bad_model_1")
|
||||
with self.assertRaisesRegex(RuntimeError, "Invalid magic number"):
|
||||
self.predictor.load("testdata/bad_model_2")
|
||||
|
||||
def test_preprocess_ok(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = make_instance_dict(
|
||||
base64_encodings=[],
|
||||
image_paths=[
|
||||
"testdata/airplane.jpg",
|
||||
"testdata/mandrill.tiff",
|
||||
"testdata/mandrill.tiff",
|
||||
"testdata/cat_alpha.png",
|
||||
],
|
||||
)
|
||||
result = self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(result.size(), torch.Size([4, 3, 224, 224]))
|
||||
self.assertEqual(result.dtype, torch.float32)
|
||||
|
||||
def test_preprocess_no_instances(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess({})
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, 'must contain "instances"')
|
||||
|
||||
def test_preprocess_wrong_shape_instances(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = {"instances": [[b64_encode_file("testdata/mandrill.tiff")]]}
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, "not 'list'")
|
||||
|
||||
def test_preprocess_bad_base64(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = make_instance_dict(base64_encodings=["!@#$"], image_paths=[])
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, "[Bb]ase64")
|
||||
|
||||
def test_preprocess_not_image_data(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
instance_dict = make_instance_dict(
|
||||
base64_encodings=[], image_paths=["testdata/bad.jpg"]
|
||||
)
|
||||
with self.assertRaises(fastapi.HTTPException) as ctx:
|
||||
self.predictor.preprocess(instance_dict)
|
||||
self.assertEqual(ctx.exception.status_code, 400)
|
||||
self.assertRegex(ctx.exception.detail, "image file")
|
||||
|
||||
def test_predict_ok(self):
|
||||
self.predictor.load(self.config.artifact_local_dir)
|
||||
inputs = torch.zeros(size=[2, 3, 224, 224], dtype=torch.float32)
|
||||
if torch.cuda.device_count() > 0:
|
||||
inputs = inputs.cuda()
|
||||
result = self.predictor.predict(inputs)
|
||||
self.assertEqual(result.size(), torch.Size([2, 1000]))
|
||||
self.assertEqual(result.dtype, torch.float32)
|
||||
|
||||
def test_postprocess_ok(self):
|
||||
class_probs = torch.zeros(size=[2, 1000])
|
||||
class_probs[0, 0] = 1
|
||||
class_probs[1, 123] = 1
|
||||
result = self.predictor.postprocess(class_probs)
|
||||
predictions = result["predictions"]
|
||||
self.assertLen(predictions[0]["class_names"], 5)
|
||||
self.assertLen(predictions[0]["indices"], 5)
|
||||
self.assertLen(predictions[0]["probabilities"], 5)
|
||||
self.assertLen(predictions[1]["class_names"], 5)
|
||||
self.assertLen(predictions[1]["indices"], 5)
|
||||
self.assertLen(predictions[1]["probabilities"], 5)
|
||||
self.assertContainsSubsequence(predictions[0]["class_names"][0], "tench")
|
||||
self.assertContainsSubsequence(
|
||||
predictions[1]["class_names"][0], "spiny lobster"
|
||||
)
|
||||
|
||||
|
||||
class ServerEndToEndTests(absltest.TestCase):
|
||||
"""End-to-end tests for the model server, using LocalEndpoint."""
|
||||
|
||||
def setUp(self):
|
||||
super().setUp()
|
||||
self.config = CPRConfig()
|
||||
self.config.load()
|
||||
self.local_model = cpr.LocalModel(
|
||||
serving_container_spec=aiplatform.gapic.ModelContainerSpec(
|
||||
image_uri=self.config.image
|
||||
)
|
||||
)
|
||||
|
||||
self.local_endpoint = self.local_model.deploy_to_local_endpoint(
|
||||
artifact_uri=self.config.artifact_local_dir or os.getcwd()
|
||||
)
|
||||
self.local_endpoint.serve()
|
||||
|
||||
def tearDown(self):
|
||||
self.local_endpoint.stop()
|
||||
super().tearDown()
|
||||
|
||||
def test_e2e_healthcheck_ok(self):
|
||||
health_check_response = self.local_endpoint.run_health_check()
|
||||
self.assertEqual(health_check_response.status_code, 200)
|
||||
self.assertEqual(health_check_response.content, b"{}")
|
||||
|
||||
def test_e2e_predict_ok(self):
|
||||
predict_request = json.dumps(
|
||||
make_instance_dict(
|
||||
base64_encodings=[],
|
||||
image_paths=[
|
||||
"testdata/mandrill.tiff",
|
||||
],
|
||||
)
|
||||
)
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 200)
|
||||
predictions = response.json()["predictions"]
|
||||
self.assertContainsSubsequence(predictions[0]["class_names"][0], "baboon")
|
||||
|
||||
def test_e2e_predict_bad_json_returns_400(self):
|
||||
predict_request = "blah"
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
def test_e2e_predict_no_instances_returns_400(self):
|
||||
predict_request = json.dumps({})
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
def test_e2e_predict_bad_base64_returns_400(self):
|
||||
predict_request = json.dumps(
|
||||
make_instance_dict(base64_encodings=["blah"], image_paths=[])
|
||||
)
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
def test_e2e_predict_bad_image_returns_400(self):
|
||||
predict_request = json.dumps(
|
||||
make_instance_dict(base64_encodings=[], image_paths=["testdata/bad.jpg"])
|
||||
)
|
||||
response = self.local_endpoint.predict(
|
||||
request=predict_request, headers={"Content-Type": "application/json"}
|
||||
)
|
||||
logging.info(response.content)
|
||||
self.assertEqual(response.status_code, 400)
|
||||
|
||||
|
||||
if __name__ == "__main__":
|
||||
absltest.main()
|
||||
|
Before Width: | Height: | Size: 30 KiB |
@@ -1 +0,0 @@
|
||||
some non-image data
|
||||
@@ -1 +0,0 @@
|
||||
some non-image data
|
||||
|
Before Width: | Height: | Size: 348 KiB |
@@ -1,178 +0,0 @@
|
||||
# Copyright 2022 Google LLC
|
||||
|
||||
# Licensed under the Apache License, Version 2.0 (the "License");
|
||||
# you may not use this file except in compliance with the License.
|
||||
# You may obtain a copy of the License at
|
||||
|
||||
# https://www.apache.org/licenses/LICENSE-2.0
|
||||
|
||||
# Unless required by applicable law or agreed to in writing, software
|
||||
# distributed under the License is distributed on an "AS IS" BASIS,
|
||||
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
|
||||
# See the License for the specific language governing permissions and
|
||||
# limitations under the License.
|
||||
|
||||
"""Adapts a pretrained TIMM image classification model to the CPR framework.
|
||||
|
||||
Documentation for the TIMM (Torch IMage Models) library is here:
|
||||
https://rwightman.github.io/pytorch-image-models/
|
||||
|
||||
Its source can also be found here:
|
||||
https://github.com/rwightman/pytorch-image-models
|
||||
"""
|
||||
|
||||
import base64
|
||||
import binascii
|
||||
import io
|
||||
import os
|
||||
from typing import Dict, List, Union
|
||||
|
||||
from fastapi import HTTPException
|
||||
from google.cloud.aiplatform import prediction as cpr
|
||||
from pathlib import Path
|
||||
import PIL
|
||||
import smart_open
|
||||
import timm
|
||||
import torch
|
||||
import torch.nn.functional as F
|
||||
|
||||
with open(Path(__file__).parent.absolute().joinpath("imagenet.txt")) as f:
|
||||
IMAGENET_CLASSES = f.read().splitlines()
|
||||
|
||||
|
||||
class TimmPredictor(cpr.predictor.Predictor):
|
||||
"""Predictor class for image models based on TIMM."""
|
||||
|
||||
TIMM_MODEL_NAME = os.getenv("TIMM_MODEL_NAME", default="vit_small_patch32_224")
|
||||
WEIGHTS_FILE = "state_dict.pth"
|
||||
NUM_TOP_CLASSES_TO_RETURN = 5
|
||||
|
||||
def __init__(self):
|
||||
self._cuda = torch.cuda.device_count() > 0
|
||||
|
||||
def load(self, artifacts_uri: str = ""):
|
||||
"""Initializes the model and preprocessing transforms.
|
||||
|
||||
Args:
|
||||
artifacts_uri: Directory where state dict is stored. Can be a
|
||||
GCS URI or local path.
|
||||
"""
|
||||
if artifacts_uri:
|
||||
artifact_path = os.path.join(artifacts_uri)
|
||||
if not (os.path.isdir(artifact_path) or artifact_path.startswith("gs://")):
|
||||
raise ValueError("Provided artifact_uri is not a directory.")
|
||||
else:
|
||||
artifact_path = os.getcwd()
|
||||
|
||||
artifact_path = os.path.join(artifact_path, self.WEIGHTS_FILE)
|
||||
with smart_open.open(artifact_path, "rb") as f:
|
||||
self._model = torch.load(f)
|
||||
|
||||
if self._cuda:
|
||||
self._model.cuda()
|
||||
|
||||
config = timm.data.resolve_data_config(model=self.TIMM_MODEL_NAME, args=[])
|
||||
self._transform = timm.data.create_transform(
|
||||
is_training=False, use_prefetcher=False, **config
|
||||
)
|
||||
|
||||
def preprocess(self, request_dict: Dict[str, List[str]]) -> torch.Tensor:
|
||||
"""Performs preprocessing.
|
||||
|
||||
By default, the server expects a request body consisting of a valid JSON
|
||||
object. This will be parsed by the handler before it's evaluated by the
|
||||
preprocess method.
|
||||
|
||||
Args:
|
||||
request_dict: Parsed request body. We expect that the input consists of
|
||||
a list of base64-encoded image files under the "instances" key. (Any
|
||||
image format that PIL.image.open can handle is okay.)
|
||||
|
||||
Returns:
|
||||
torch.Tensor containing the preprocessed images as a batch. If GPU is
|
||||
available, the result tensor will be stored on GPU.
|
||||
"""
|
||||
|
||||
if "instances" not in request_dict:
|
||||
raise HTTPException(
|
||||
status_code=400,
|
||||
detail='Request must contain "instances" as a top-level key.',
|
||||
)
|
||||
|
||||
tensors = []
|
||||
|
||||
for (i, image) in enumerate(request_dict["instances"]):
|
||||
# We use Base64 encoding to handle image data.
|
||||
# This is probably the best we can do while still using JSON input.
|
||||
# Overriding the input format requires building a custom Handler.
|
||||
try:
|
||||
image_bytes = base64.b64decode(image, validate=True)
|
||||
except (binascii.Error, TypeError) as e:
|
||||
raise HTTPException(
|
||||
status_code=400,
|
||||
detail=f"Base64 decoding of the input image at index {i} failed:"
|
||||
f" {str(e)}",
|
||||
)
|
||||
|
||||
try:
|
||||
pil_image = PIL.Image.open(io.BytesIO(image_bytes)).convert("RGB")
|
||||
except PIL.UnidentifiedImageError:
|
||||
raise HTTPException(
|
||||
status_code=400,
|
||||
detail=f"The input image at index {i} could not be identified as an"
|
||||
" image file.",
|
||||
)
|
||||
|
||||
tensors.append(self._transform(pil_image))
|
||||
|
||||
with torch.inference_mode():
|
||||
result = torch.stack(tensors)
|
||||
if self._cuda:
|
||||
result = result.cuda()
|
||||
return result
|
||||
|
||||
def predict(self, instances: torch.Tensor) -> torch.Tensor:
|
||||
"""Performs prediction.
|
||||
|
||||
Args:
|
||||
instances: torch.Tensor with type torch.float32 and shape
|
||||
[?, 3, 224, 224], containing the pre-processed input images.
|
||||
|
||||
Returns:
|
||||
Vector of scores with type torch.float32 and shape [?, 1000],
|
||||
representing the model's estimate of the likelihood that the
|
||||
input belongs to the Imagenet class with that index.
|
||||
"""
|
||||
with torch.inference_mode():
|
||||
class_scores = self._model(instances)
|
||||
return class_scores
|
||||
|
||||
def postprocess(
|
||||
self, class_scores: torch.Tensor
|
||||
) -> Dict[str, List[Dict[str, Union[str, int, float]]]]:
|
||||
"""Translate the model output into a classification result.
|
||||
|
||||
Args:
|
||||
class_scores: torch.Tensor with type torch.float32 and shape
|
||||
[?, 1000], containing the scores assigned to each class by
|
||||
the model.
|
||||
|
||||
Returns:
|
||||
Dictionary containing the list of classification results. Each
|
||||
classification result contains the probabilities, class names, and
|
||||
class indices of the classes with the top class scores as reported by
|
||||
the model.
|
||||
"""
|
||||
class_probs = F.softmax(class_scores, dim=1)
|
||||
top_k = class_probs.topk(self.NUM_TOP_CLASSES_TO_RETURN)
|
||||
top_k_values = top_k.values.numpy().tolist()
|
||||
top_k_indices = top_k.indices.numpy().tolist()
|
||||
predictions = [
|
||||
dict(
|
||||
probabilities=values,
|
||||
indices=indices,
|
||||
class_names=[IMAGENET_CLASSES[int(class_num)] for class_num in indices],
|
||||
)
|
||||
for (values, indices) in zip(top_k_values, top_k_indices)
|
||||
]
|
||||
return {"predictions": predictions}
|
||||
@@ -1,52 +0,0 @@
|
||||
# Overview
|
||||
*Pluto* is a programming environment for Julia, designed to be interactive and helpful. It provides a familiar notebook interface but it is not a Jupyter notebook. The biggest difference is that Pluto notebooks are reactive, changing a variable or function in one cell causes the cells that depend on that variable or function to be reevaluated. Pluto also provides useful interaction mechanisms that allow users to dynamically interact with the notebooks computation state.
|
||||
|
||||
The JuliaCon 2020 presentation: [Interactive notebooks ~ Pluto.jl]() provides a good introduction to Pluto. The source is at [fonsp/Pluto.jl]()
|
||||
|
||||
# Install Pluto
|
||||
|
||||
## Create a Vertex AI JupyterLab Instance
|
||||
|
||||
1. From the [GCP console](https://console.cloud.google.com) "hamburger menu"
|
||||
|
||||
select Vertex AI > Workbench
|
||||
2. Click NEW NOTEBOOK
|
||||
|
||||
* Choose Python 3 if you won't be using a GPU
|
||||
* Choose Python 3 (CUDA Toolkit xx.y) if you do want use a GPU
|
||||
3. Give the notebook an appropriate name
|
||||
4. Edit Notebook properties if you have special requirements otherwise accept the defaults and click CREATE
|
||||
5. When the notebook instance is ready click OPEN JUPYTERLAB
|
||||
|
||||
## Configure JupyterLab
|
||||
|
||||
1. Open a terminal by clicking the Terminal icon.
|
||||
1. Install the plutoserver
|
||||
pip3 install git+https://github.com/fonsp/pluto-on-jupyterlab.git
|
||||
1. In a browser go to [julialang.org/downloads](https://julialang.org/downloads/)
|
||||
1. In the Current stable release right click on the `Generic Linux on x86 / 64-bit (glibc)` link
|
||||
Select copy link address
|
||||
1. Back in the terminal switch to root via
|
||||
sudo -i
|
||||
1. Download the release to /opt and install julia in /usr/local/bin
|
||||
```bash
|
||||
cd /opt
|
||||
wget <paste the release link address>
|
||||
tar xf <name of the downloaded tar file>
|
||||
ln -s /opt/<julia-x.y.z>/bin/julia /usr/local/bin
|
||||
^d
|
||||
```
|
||||
1. Add the Pluto package to Julia
|
||||
```bash
|
||||
julia
|
||||
julia> ]add Pluto
|
||||
julia> bksp
|
||||
julia> using Pluto
|
||||
julia> ^d
|
||||
```
|
||||
1. From the JupyterLab menu bar select File > Shut Down
|
||||
|
||||
# Start Pluto
|
||||
1. Click OPEN JUPYTERLAB in the Workbench
|
||||
1. In the Notebook section of the Launcher click Pluto.jl
|
||||
1. The welcome to Pluto.jl screen should appear
|
||||
@@ -0,0 +1,474 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a6b56b1c7b76"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
"# You may obtain a copy of the License at\n",
|
||||
"#\n",
|
||||
"# https://www.apache.org/licenses/LICENSE-2.0\n",
|
||||
"#\n",
|
||||
"# Unless required by applicable law or agreed to in writing, software\n",
|
||||
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
|
||||
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
|
||||
"# See the License for the specific language governing permissions and\n",
|
||||
"# limitations under the License."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "c414a395a19b"
|
||||
},
|
||||
"source": [
|
||||
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on CPU using Vertex Training with Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "b98238e32cf7"
|
||||
},
|
||||
"source": [
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "03d216c7f7b1"
|
||||
},
|
||||
"source": [
|
||||
"## Setup"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c5ac73516218"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
|
||||
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
|
||||
"REGION = \"YOUR REGION\"\n",
|
||||
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0b5ae674177e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "19a9b3bdd553"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "57bf6f8b4361"
|
||||
},
|
||||
"source": [
|
||||
"## Local Training"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "e5d8a3443da0"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! ls trainer"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "07f79309472d"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! cat trainer/requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "e16cd8bb7483"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install -r trainer/requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0b8a210718c4"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! cat trainer/task.py"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c0c6e7dfb3c6"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"%run trainer/task.py --epochs 5 --no-cuda --local-mode"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "31dfdeede587"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! ls ./tmp"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "48d56ec621cc"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! rm -rf ./tmp"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "8f3ea1210749"
|
||||
},
|
||||
"source": [
|
||||
"## Vertex Training using Vertex SDK and Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "93002a20a2a6"
|
||||
},
|
||||
"source": [
|
||||
"### Build Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "4130ce43fd08"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"hostname = \"gcr.io\"\n",
|
||||
"image_name = content_name\n",
|
||||
"tag = \"latest\"\n",
|
||||
"\n",
|
||||
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "2f1fc5b05240"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! cd trainer && docker build -t $custom_container_image_uri -f Dockerfile ."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "b4f274f499ac"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! docker run --rm $custom_container_image_uri --epochs 5 --no-cuda --local-mode"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "ee1a0a06d0b4"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! docker push $custom_container_image_uri"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "cb763be12fc9"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gcloud container images list --repository $hostname/$PROJECT_ID"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "10c8cc6b3334"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "1a12348169fa"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install -r requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "42e981cefe41"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud import aiplatform\n",
|
||||
"\n",
|
||||
"aiplatform.init(\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" staging_bucket=BUCKET_NAME,\n",
|
||||
" location=REGION,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "73c92c9298e9"
|
||||
},
|
||||
"source": [
|
||||
"### Create a Vertex Tensorboard Instance"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "bde509558cd5"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = content_name + \"-cpu\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "6d7908c0083c"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"tensorboard = aiplatform.Tensorboard.create(\n",
|
||||
" display_name=content_name,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "a1f0a4f54037"
|
||||
},
|
||||
"source": [
|
||||
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
|
||||
"\n",
|
||||
"```\n",
|
||||
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
|
||||
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
|
||||
"```"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "a4cac84e04ac"
|
||||
},
|
||||
"source": [
|
||||
"### Run a Vertex SDK CustomContainerTrainingJob"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "f92e8fdd44ee"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"display_name = content_name\n",
|
||||
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
|
||||
"\n",
|
||||
"replica_count = 4\n",
|
||||
"machine_type = \"n1-standard-4\"\n",
|
||||
"\n",
|
||||
"args = [\n",
|
||||
" \"--backend\",\n",
|
||||
" \"gloo\",\n",
|
||||
" \"--no-cuda\",\n",
|
||||
" \"--batch-size\",\n",
|
||||
" \"128\",\n",
|
||||
" \"--epochs\",\n",
|
||||
" \"25\",\n",
|
||||
"]"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "ae4c57df7e07"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
|
||||
" display_name=display_name,\n",
|
||||
" container_uri=custom_container_image_uri,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "35cf3ecdf0df"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job.run(\n",
|
||||
" args=args,\n",
|
||||
" base_output_dir=gcs_output_uri_prefix,\n",
|
||||
" replica_count=replica_count,\n",
|
||||
" machine_type=machine_type,\n",
|
||||
" tensorboard=tensorboard.resource_name,\n",
|
||||
" service_account=SERVICE_ACCOUNT,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "49d10dded73b"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
|
||||
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "78398f52807b"
|
||||
},
|
||||
"source": [
|
||||
"### Training Output Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "fc74422de1d1"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls $gcs_output_uri_prefix"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5e99a6a05b10"
|
||||
},
|
||||
"source": [
|
||||
"## Clean Up Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "b0c1b3f7466b"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil rm -rf $gcs_output_uri_prefix"
|
||||
]
|
||||
}
|
||||
],
|
||||
"metadata": {
|
||||
"colab": {
|
||||
"name": "multi_node_ddp_gloo_vertex_training_with_custom_container.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
"kernelspec": {
|
||||
"display_name": "Python 3",
|
||||
"name": "python3"
|
||||
}
|
||||
},
|
||||
"nbformat": 4,
|
||||
"nbformat_minor": 0
|
||||
}
|
||||
@@ -0,0 +1,347 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a6b56b1c7b76"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
"# You may obtain a copy of the License at\n",
|
||||
"#\n",
|
||||
"# https://www.apache.org/licenses/LICENSE-2.0\n",
|
||||
"#\n",
|
||||
"# Unless required by applicable law or agreed to in writing, software\n",
|
||||
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
|
||||
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
|
||||
"# See the License for the specific language governing permissions and\n",
|
||||
"# limitations under the License."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "20a5ea0081d0"
|
||||
},
|
||||
"source": [
|
||||
"# PyTorch Image Classification Multi-Node Distributed Data Parallel Training on GPU using Vertex Training with Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "8752d4a255fb"
|
||||
},
|
||||
"source": [
|
||||
"<table align=\"left\">\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/master/community-content/pytorch_image_classification_distributed_data_parallel_training_with_vertex_sdk/multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
"</table>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "03d216c7f7b1"
|
||||
},
|
||||
"source": [
|
||||
"## Setup"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c5ac73516218"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"PROJECT_ID = \"YOUR PROJECT ID\"\n",
|
||||
"BUCKET_NAME = \"gs://YOUR BUCKET NAME\"\n",
|
||||
"REGION = \"YOUR REGION\"\n",
|
||||
"SERVICE_ACCOUNT = \"YOUR SERVICE ACCOUNT\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0b5ae674177e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "19a9b3bdd553"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = \"pt-img-cls-multi-node-ddp-cust-cont\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5307fe28b633"
|
||||
},
|
||||
"source": [
|
||||
"## Vertex Training using Vertex SDK and Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "46cb58c7fbf9"
|
||||
},
|
||||
"source": [
|
||||
"### Built Custom Container"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "97e66e9f9bab"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"hostname = \"gcr.io\"\n",
|
||||
"image_name = content_name\n",
|
||||
"tag = \"latest\"\n",
|
||||
"\n",
|
||||
"custom_container_image_uri = f\"{hostname}/{PROJECT_ID}/{image_name}:{tag}\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "ae9b29c4773f"
|
||||
},
|
||||
"source": [
|
||||
"### Initialize Vertex SDK"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "dc1e84d5dec2"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install -r requirements.txt"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "6964be27b98e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google.cloud import aiplatform\n",
|
||||
"\n",
|
||||
"aiplatform.init(\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" staging_bucket=BUCKET_NAME,\n",
|
||||
" location=REGION,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "594a91f438f2"
|
||||
},
|
||||
"source": [
|
||||
"### Create a Vertex Tensorboard Instance"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "93134273261e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"content_name = content_name + \"-gpu\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c2bd82dbcd9b"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"tensorboard = aiplatform.Tensorboard.create(\n",
|
||||
" display_name=content_name,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "ebc593c6472e"
|
||||
},
|
||||
"source": [
|
||||
"#### Option: Use a Previously Created Vertex Tensorboard Instance\n",
|
||||
"\n",
|
||||
"```\n",
|
||||
"tensorboard_name = \"Your Tensorboard Resource Name or Tensorboard ID\"\n",
|
||||
"tensorboard = aiplatform.Tensorboard(tensorboard_name=tensorboard_name)\n",
|
||||
"```"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "0769e8e34c2f"
|
||||
},
|
||||
"source": [
|
||||
"### Run a Vertex SDK CustomContainerTrainingJob"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "023f33ece826"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"display_name = content_name\n",
|
||||
"gcs_output_uri_prefix = f\"{BUCKET_NAME}/{display_name}\"\n",
|
||||
"\n",
|
||||
"replica_count = 1\n",
|
||||
"machine_type = \"n1-standard-4\"\n",
|
||||
"accelerator_count = 4\n",
|
||||
"accelerator_type = \"NVIDIA_TESLA_K80\"\n",
|
||||
"\n",
|
||||
"args = [\n",
|
||||
" \"--backend\",\n",
|
||||
" \"nccl\",\n",
|
||||
" \"--batch-size\",\n",
|
||||
" \"128\",\n",
|
||||
" \"--epochs\",\n",
|
||||
" \"25\",\n",
|
||||
"]"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "d4b599e726ef"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job = aiplatform.CustomContainerTrainingJob(\n",
|
||||
" display_name=display_name,\n",
|
||||
" container_uri=custom_container_image_uri,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "81321e3bdf7f"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"custom_container_training_job.run(\n",
|
||||
" args=args,\n",
|
||||
" base_output_dir=gcs_output_uri_prefix,\n",
|
||||
" replica_count=replica_count,\n",
|
||||
" machine_type=machine_type,\n",
|
||||
" accelerator_count=accelerator_count,\n",
|
||||
" accelerator_type=accelerator_type,\n",
|
||||
" tensorboard=tensorboard.resource_name,\n",
|
||||
" service_account=SERVICE_ACCOUNT,\n",
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "5100712c2c4c"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"print(f\"Custom Training Job Name: {custom_container_training_job.resource_name}\")\n",
|
||||
"print(f\"GCS Output URI Prefix: {gcs_output_uri_prefix}\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "f9b77676e5a6"
|
||||
},
|
||||
"source": [
|
||||
"### Training Output Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "0e171ce95ace"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls $gcs_output_uri_prefix"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "cf1b74a12b87"
|
||||
},
|
||||
"source": [
|
||||
"## Clean Up Artifact"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a0b15089c341"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil rm -rf $gcs_output_uri_prefix"
|
||||
]
|
||||
}
|
||||
],
|
||||
"metadata": {
|
||||
"colab": {
|
||||
"name": "multi_node_ddp_nccl_vertex_training_with_custom_container.ipynb",
|
||||
"toc_visible": true
|
||||
},
|
||||
"kernelspec": {
|
||||
"display_name": "Python 3",
|
||||
"name": "python3"
|
||||
}
|
||||
},
|
||||
"nbformat": 4,
|
||||
"nbformat_minor": 0
|
||||
}
|
||||
@@ -1,30 +0,0 @@
|
||||
# PyTorch Deployment on Google Cloud: Text Classification
|
||||
|
||||
**This is an Experimental release**, covered by the Pre-GA Offerings Terms of your Google Cloud Platform [Terms of Service](https://cloud.google.com/terms).
|
||||
|
||||
Experiments are focused on validating a prototype and are not guaranteed to be released. They are not intended for production use or covered by any SLA, support obligation, or deprecation policy and might be subject to backward-incompatible changes.
|
||||
|
||||
**Kindly drop us a note before you run any scale tests.**
|
||||
|
||||
**Do not hesitate to contact vertexai-prediction-preview-feedback@google.com if you have any questions or run into any issues.**
|
||||
|
||||
The projects need to be added to the allowlist in order to deploy PyTorch models using Vertex AI Prediction pre-built PyTorch images. If you are interested in the feature, please send an email to vertexai-prediction-preview-feedback@google.com to provide your project numbers OR project ids.
|
||||
|
||||
## Overview
|
||||
|
||||
In the PyTorch on Google Cloud series of blog posts, we aim to share how to deploy PyTorch models at scale on [Vertex AI](https://cloud.google.com/vertex-ai).
|
||||
|
||||
This tutorial on text classification shows how to deploy a PyTorch based text classification model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
|
||||
|
||||
## Notebooks
|
||||
|
||||
| <h4>Notebook</h4> | <h4>Description</h4> |
|
||||
| :-------- | :------- |
|
||||
| [pytorch-text-classification-vertex-ai-deploy.ipynb](./pytorch-text-classification-vertex-ai-deploy.ipynb) | Notebook to show deploying a PyTorch model on Vertex AI |
|
||||
|
||||
## Folders
|
||||
|
||||
|
||||
| <h4>Folder Name</h4> | <h4>Description</h4> |
|
||||
| :-------- | :------- |
|
||||
| [`predictor`](./predictor) | Folder with custom prediction handler to deploy a PyTorch model to Vertex Prediction. In the [notebook](./pytorch-text-classification-vertex-ai-deploy.ipynb), this folder is used for deploying a PyTorch model on Vertex AI using Vertex Prediction pre-built PyTorch images |
|
||||
@@ -1,91 +0,0 @@
|
||||
|
||||
import os
|
||||
import json
|
||||
import logging
|
||||
|
||||
import torch
|
||||
from transformers import AutoModelForSequenceClassification, AutoTokenizer
|
||||
from ts.torch_handler.base_handler import BaseHandler
|
||||
|
||||
logger = logging.getLogger(__name__)
|
||||
|
||||
|
||||
class TransformersClassifierHandler(BaseHandler):
|
||||
"""
|
||||
The handler takes an input string and returns the classification text
|
||||
based on the serialized transformers checkpoint.
|
||||
"""
|
||||
def __init__(self):
|
||||
super(TransformersClassifierHandler, self).__init__()
|
||||
self.initialized = False
|
||||
|
||||
def initialize(self, ctx):
|
||||
""" Loads the model.pt file and initialized the model object.
|
||||
Instantiates Tokenizer for preprocessor to use
|
||||
Loads labels to name mapping file for post-processing inference response
|
||||
"""
|
||||
self.manifest = ctx.manifest
|
||||
|
||||
properties = ctx.system_properties
|
||||
model_dir = properties.get("model_dir")
|
||||
self.device = torch.device("cuda:" + str(properties.get("gpu_id")) if torch.cuda.is_available() else "cpu")
|
||||
|
||||
# Read model serialize/pt file
|
||||
serialized_file = self.manifest["model"]["serializedFile"]
|
||||
model_pt_path = os.path.join(model_dir, serialized_file)
|
||||
if not os.path.isfile(model_pt_path):
|
||||
raise RuntimeError("Missing the model.pt or pytorch_model.bin file")
|
||||
|
||||
# Load model
|
||||
self.model = AutoModelForSequenceClassification.from_pretrained(model_dir)
|
||||
self.model.to(self.device)
|
||||
self.model.eval()
|
||||
logger.debug('Transformer model from path {0} loaded successfully'.format(model_dir))
|
||||
|
||||
# Ensure to use the same tokenizer used during training
|
||||
self.tokenizer = AutoTokenizer.from_pretrained('bert-base-cased')
|
||||
|
||||
# Read the mapping file, index to object name
|
||||
mapping_file_path = os.path.join(model_dir, "index_to_name.json")
|
||||
|
||||
if os.path.isfile(mapping_file_path):
|
||||
with open(mapping_file_path) as f:
|
||||
self.mapping = json.load(f)
|
||||
else:
|
||||
logger.warning('Missing the index_to_name.json file. Inference output will default.')
|
||||
self.mapping = {"0": "Negative", "1": "Positive"}
|
||||
|
||||
self.initialized = True
|
||||
|
||||
def preprocess(self, data):
|
||||
""" Preprocessing input request by tokenizing
|
||||
Extend with your own preprocessing steps as needed
|
||||
"""
|
||||
text = data[0].get("data")
|
||||
if text is None:
|
||||
text = data[0].get("body")
|
||||
sentences = text.decode('utf-8')
|
||||
logger.info("Received text: '%s'", sentences)
|
||||
|
||||
# Tokenize the texts
|
||||
tokenizer_args = ((sentences,))
|
||||
inputs = self.tokenizer(*tokenizer_args,
|
||||
padding='max_length',
|
||||
max_length=128,
|
||||
truncation=True,
|
||||
return_tensors = "pt")
|
||||
return inputs
|
||||
|
||||
def inference(self, inputs):
|
||||
""" Predict the class of a text using a trained transformer model.
|
||||
"""
|
||||
prediction = self.model(inputs['input_ids'].to(self.device))[0].argmax().item()
|
||||
|
||||
if self.mapping:
|
||||
prediction = self.mapping[str(prediction)]
|
||||
|
||||
logger.info("Model predicted: '%s'", prediction)
|
||||
return [prediction]
|
||||
|
||||
def postprocess(self, inference_output):
|
||||
return inference_output
|
||||
@@ -1,5 +0,0 @@
|
||||
|
||||
{
|
||||
"0": "Negative",
|
||||
"1": "Positive"
|
||||
}
|
||||
@@ -1,6 +1,6 @@
|
||||
# PyTorch on Google Cloud: Text Classification
|
||||
|
||||
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train, deploy and orchestrate PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
|
||||
In the PyTorch on Google Cloud series of blog posts, we aim to share how to build, train and deploy PyTorch models at scale and how to create reproducible machine learning pipelines on Google Cloud with [Vertex AI](https://cloud.google.com/vertex-ai).
|
||||
|
||||
This tutorial on text classification shows how to train a PyTorch based text classification model by fine tuning a pre-trained Huggingface Transformers model and deploy the model on [Vertex AI](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) using Vertex SDK and [`gcloud ai`](https://cloud.google.com/sdk/gcloud/reference/beta/ai).
|
||||
|
||||
@@ -9,7 +9,6 @@ This tutorial on text classification shows how to train a PyTorch based text cla
|
||||
| <h4>Notebook</h4> | <h4>Description</h4> |
|
||||
| :-------- | :------- |
|
||||
| [pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb](./pytorch-text-classification-vertex-ai-train-tune-deploy.ipynb) | Notebook to show training, hyper-parameter tuning and deploying a PyTorch model on Vertex AI |
|
||||
| [pytorch-text-classification-vertex-ai-pipelines.ipynb](./pytorch-text-classification-vertex-ai-pipelines.ipynb) | Notebook to show orchestration of PyTorch ML workflows on Vertex AI Pipelines using Kubeflow Pipelines SDK |
|
||||
|
||||
## Folders
|
||||
|
||||
|
||||
@@ -1,7 +1,6 @@
|
||||
|
||||
# Use pytorch GPU base image
|
||||
# FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
|
||||
FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest
|
||||
FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7
|
||||
|
||||
# set working directory
|
||||
WORKDIR /app
|
||||
|
||||
@@ -22,18 +22,15 @@ PROJECT_ID=$(gcloud config list --format 'value(core.project)')
|
||||
|
||||
# BUCKET_NAME: Change to your bucket name.
|
||||
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
|
||||
|
||||
# validate bucket name
|
||||
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
|
||||
then
|
||||
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
|
||||
exit 1
|
||||
fi
|
||||
BUCKET_NAME=cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77
|
||||
|
||||
# JOB_NAME: the name of your job running on AI Platform.
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr"
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-cstm-cntr-"
|
||||
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
|
||||
|
||||
# This can be a GCS location to a zipped and uploaded package
|
||||
PACKAGE_PATH=./trainer
|
||||
|
||||
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
|
||||
# or use the default '`us-central1`'. The region is where the job will be run.
|
||||
REGION="us-central1"
|
||||
@@ -44,8 +41,11 @@ JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/models/${JOB_NAME}
|
||||
# IMAGE_REPO_NAME: set a local repo name to distinquish our image
|
||||
IMAGE_REPO_NAME=pytorch_gpu_train_finetuned-bert-classifier
|
||||
|
||||
# IMAGE_TAG: an easily identifiable tag for your docker image
|
||||
IMAGE_TAG=latest
|
||||
|
||||
# IMAGE_URI: the complete URI location for Cloud Container Registry
|
||||
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}
|
||||
CUSTOM_TRAIN_IMAGE_URI=gcr.io/${PROJECT_ID}/${IMAGE_REPO_NAME}:${IMAGE_TAG}
|
||||
|
||||
# Build the docker image
|
||||
docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_package
|
||||
@@ -53,19 +53,11 @@ docker build --no-cache -f Dockerfile -t $CUSTOM_TRAIN_IMAGE_URI ../python_packa
|
||||
# Deploy the docker image to Cloud Container Registry
|
||||
docker push ${CUSTOM_TRAIN_IMAGE_URI}
|
||||
|
||||
# worker pool spec
|
||||
worker_pool_spec="\
|
||||
replica-count=1,\
|
||||
machine-type=n1-standard-8,\
|
||||
accelerator-type=NVIDIA_TESLA_V100,\
|
||||
accelerator-count=1,\
|
||||
container-image-uri=${CUSTOM_TRAIN_IMAGE_URI}"
|
||||
|
||||
# Submit Custom Job to Vertex AI
|
||||
gcloud beta ai custom-jobs create \
|
||||
--display-name=${JOB_NAME} \
|
||||
--region ${REGION} \
|
||||
--worker-pool-spec="${worker_pool_spec}" \
|
||||
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,container-image-uri=${CUSTOM_TRAIN_IMAGE_URI} \
|
||||
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
|
||||
|
||||
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
|
||||
|
||||
|
Before Width: | Height: | Size: 45 KiB |
|
Before Width: | Height: | Size: 37 KiB |
|
Before Width: | Height: | Size: 76 KiB |
|
Before Width: | Height: | Size: 74 KiB |
|
Before Width: | Height: | Size: 248 KiB |
|
Before Width: | Height: | Size: 38 KiB |
|
Before Width: | Height: | Size: 123 KiB |
@@ -2,13 +2,10 @@
|
||||
FROM pytorch/torchserve:latest-cpu
|
||||
|
||||
# install dependencies
|
||||
RUN python3 -m pip install --upgrade pip
|
||||
RUN pip3 install transformers
|
||||
|
||||
USER model-server
|
||||
|
||||
# copy model artifacts, custom handler and other dependencies
|
||||
COPY ./custom_handler.py /home/model-server/
|
||||
COPY ./custom_text_handler.py /home/model-server/
|
||||
COPY ./index_to_name.json /home/model-server/
|
||||
COPY ./model/finetuned-bert-classifier/ /home/model-server/
|
||||
|
||||
@@ -24,7 +21,7 @@ EXPOSE 7080
|
||||
EXPOSE 7081
|
||||
|
||||
# create model archive file packaging model artifacts and dependencies
|
||||
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
|
||||
RUN torch-model-archiver -f --model-name=finetuned-bert-classifier --version=1.0 --serialized-file=/home/model-server/pytorch_model.bin --handler=/home/model-server/custom_text_handler.py --extra-files "/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json" --export-path=/home/model-server/model-store
|
||||
|
||||
# run Torchserve HTTP serve to respond to prediction requests
|
||||
CMD ["torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "finetuned-bert-classifier=finetuned-bert-classifier.mar", "--model-store", "/home/model-server/model-store"]
|
||||
|
||||
@@ -1,37 +0,0 @@
|
||||
|
||||
FROM pytorch/torchserve:latest-cpu
|
||||
|
||||
USER root
|
||||
# run and update some basic packages software packages, including security libs
|
||||
RUN apt-get update && apt-get install -y software-properties-common && add-apt-repository -y ppa:ubuntu-toolchain-r/test && apt-get update && apt-get install -y gcc-9 g++-9 apt-transport-https ca-certificates gnupg curl
|
||||
|
||||
# Install gcloud tools for gsutil as well as debugging
|
||||
RUN echo "deb [signed-by=/usr/share/keyrings/cloud.google.gpg] http://packages.cloud.google.com/apt cloud-sdk main" | tee -a /etc/apt/sources.list.d/google-cloud-sdk.list && curl https://packages.cloud.google.com/apt/doc/apt-key.gpg | apt-key --keyring /usr/share/keyrings/cloud.google.gpg add - && apt-get update -y && apt-get install google-cloud-sdk -y
|
||||
|
||||
USER model-server
|
||||
|
||||
# install dependencies
|
||||
RUN python3 -m pip install --upgrade pip
|
||||
RUN pip3 install transformers
|
||||
|
||||
ARG MODEL_NAME=finetuned-bert-classifier
|
||||
ENV MODEL_NAME="${MODEL_NAME}"
|
||||
|
||||
# health and prediction listener ports
|
||||
ARG AIP_HTTP_PORT=7080
|
||||
ENV AIP_HTTP_PORT="${AIP_HTTP_PORT}"
|
||||
|
||||
ARG MODEL_MGMT_PORT=7081
|
||||
|
||||
# expose health and prediction listener ports from the image
|
||||
EXPOSE "${AIP_HTTP_PORT}"
|
||||
EXPOSE "${MODEL_MGMT_PORT}"
|
||||
EXPOSE 8080 8081 8082 7070 7071
|
||||
|
||||
# create torchserve configuration file
|
||||
USER root
|
||||
RUN echo "service_envelope=json\n" "inference_address=http://0.0.0.0:${AIP_HTTP_PORT}\n" "management_address=http://0.0.0.0:${MODEL_MGMT_PORT}" >> /home/model-server/config.properties
|
||||
USER model-server
|
||||
|
||||
# run Torchserve HTTP serve to respond to prediction requests
|
||||
CMD ["echo", "AIP_STORAGE_URI=${AIP_STORAGE_URI}", ";", "gsutil", "cp", "-r", "${AIP_STORAGE_URI}/${MODEL_NAME}.mar", "/home/model-server/model-store/", ";", "ls", "-ltr", "/home/model-server/model-store/", ";", "torchserve", "--start", "--ts-config=/home/model-server/config.properties", "--models", "${MODEL_NAME}=${MODEL_NAME}.mar", "--model-store", "/home/model-server/model-store"]
|
||||
@@ -52,8 +52,7 @@ class TransformersClassifierHandler(BaseHandler):
|
||||
with open(mapping_file_path) as f:
|
||||
self.mapping = json.load(f)
|
||||
else:
|
||||
logger.warning('Missing the index_to_name.json file. Inference output will default.')
|
||||
self.mapping = {"0": "Negative", "1": "Positive"}
|
||||
logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')
|
||||
|
||||
self.initialized = True
|
||||
|
||||
@@ -89,3 +88,4 @@ class TransformersClassifierHandler(BaseHandler):
|
||||
|
||||
def postprocess(self, inference_output):
|
||||
return inference_output
|
||||
|
||||
@@ -19,19 +19,13 @@ echo "Submitting Custom Job to Vertex AI to train PyTorch model"
|
||||
|
||||
# BUCKET_NAME: Change to your bucket name
|
||||
BUCKET_NAME="[your-bucket-name]" # <-- CHANGE TO YOUR BUCKET NAME
|
||||
|
||||
# validate bucket name
|
||||
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
|
||||
then
|
||||
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
|
||||
exit 1
|
||||
fi
|
||||
BUCKET_NAME="cloud-ai-platform-2f444b6a-a742-444b-b91a-c7519f51bd77"
|
||||
|
||||
# The PyTorch image provided by Vertex AI Training.
|
||||
IMAGE_URI="us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-7:latest"
|
||||
|
||||
# JOB_NAME: the name of your job running on Vertex AI.
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar"
|
||||
JOB_PREFIX="finetuned-bert-classifier-pytorch-pkg-ar-"
|
||||
JOB_NAME=${JOB_PREFIX}-$(date +%Y%m%d%H%M%S)-custom-job
|
||||
|
||||
# REGION: select a region from https://cloud.google.com/vertex-ai/docs/general/locations#available_regions
|
||||
@@ -41,21 +35,19 @@ REGION="us-central1"
|
||||
# JOB_DIR: Where to store prepared package and upload output model.
|
||||
JOB_DIR=gs://${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}
|
||||
|
||||
# worker pool spec
|
||||
worker_pool_spec="\
|
||||
replica-count=1,\
|
||||
machine-type=n1-standard-8,\
|
||||
accelerator-type=NVIDIA_TESLA_V100,\
|
||||
accelerator-count=1,\
|
||||
executor-image-uri=${IMAGE_URI},\
|
||||
python-module=trainer.task,\
|
||||
local-package-path=../python_package/"
|
||||
# validate bucket name
|
||||
if [ "${BUCKET_NAME}" = "[your-bucket-name]" ]
|
||||
then
|
||||
echo "[ERROR] INVALID VALUE: Please update the variable BUCKET_NAME with valid Cloud Storage bucket name. Exiting the script..."
|
||||
exit 1
|
||||
fi
|
||||
|
||||
# Submit Custom Job to Vertex AI
|
||||
gcloud beta ai custom-jobs create \
|
||||
--display-name=${JOB_NAME} \
|
||||
--region ${REGION} \
|
||||
--worker-pool-spec="${worker_pool_spec}" \
|
||||
--python-package-uris=${PACKAGE_PATH} \
|
||||
--worker-pool-spec=replica-count=1,machine-type='n1-standard-8',accelerator-type='NVIDIA_TESLA_V100',accelerator-count=1,executor-image-uri=${IMAGE_URI},python-module='trainer.task',local-package-path="../python_package/" \
|
||||
--args="--model-name","finetuned-bert-classifier","--job-dir",$JOB_DIR
|
||||
|
||||
echo "After the job is completed successfully, model files will be saved at $JOB_DIR/"
|
||||
|
||||
@@ -122,9 +122,6 @@ def run(args):
|
||||
# Train / Test the model
|
||||
trainer = train(args, text_classifier, train_dataset, test_dataset)
|
||||
|
||||
metrics = trainer.evaluate(eval_dataset=test_dataset)
|
||||
trainer.save_metrics("all", metrics)
|
||||
|
||||
# Export the trained model
|
||||
trainer.save_model(os.path.join("/tmp", args.model_name))
|
||||
|
||||
|
||||
@@ -63,20 +63,20 @@
|
||||
"- [Training](#Training)\n",
|
||||
" - [Run Training Locally in the Notebook](#Training-locally-in-the-notebook)\n",
|
||||
" - [Run Training Job on Vertex AI](#Training-on-Vertex-AI)\n",
|
||||
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-AI-Training-with-a-pre-built-container)\n",
|
||||
" - [Training with custom container](#Run-Custom-Job-on-Vertex-AI-Training-with-custom-container)\n",
|
||||
" - [Training with pre-built container](#Run-Custom-Job-on-Vertex-Training-with-a-pre-built-container)\n",
|
||||
" - [Training with custom container](#Run-Custom-Job-on-Vertex-Training-with-custom-container)\n",
|
||||
"- [Tuning](#Hyperparameter-Tuning) \n",
|
||||
" - [Run Hyperparameter Tuning job on Vertex AI](#Run-Hyperparameter-Tuning-Job-on-Vertex-AI)\n",
|
||||
"- [Deploying](#Deploying)\n",
|
||||
" - [Deploying model on Vertex AI Predictions with custom container](#Deploying-model-on-Vertex AI-Predictions-with-custom-container)\n",
|
||||
" - [Deploying model on Vertex Predictions with custom container](#Deploying-model-on-Vertex-Predictions-with-custom-container)\n",
|
||||
"\n",
|
||||
"### Costs \n",
|
||||
"\n",
|
||||
"This tutorial uses billable components of Google Cloud Platform (GCP):\n",
|
||||
"\n",
|
||||
"* [Vertex AI Workbench](https://cloud.google.com/vertex-ai-workbench)\n",
|
||||
"* [Vertex AI Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
|
||||
"* [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
|
||||
"* [Notebooks](https://cloud.google.com/notebooks)\n",
|
||||
"* [Vertex Training](https://cloud.google.com/vertex-ai/docs/training/custom-training)\n",
|
||||
"* [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions)\n",
|
||||
"* [Cloud Storage](https://cloud.google.com/storage)\n",
|
||||
"* [Container Registry](https://cloud.google.com/container-registry)\n",
|
||||
"* [Cloud Build](https://cloud.google.com/build) *[Optional]*\n",
|
||||
@@ -202,9 +202,9 @@
|
||||
"id": "e0c1dcadc2c8"
|
||||
},
|
||||
"source": [
|
||||
"We will be using [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
|
||||
"We will be using [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#python) to interact with Vertex AI services. The high-level `aiplatform` library is designed to simplify common data science workflows by using wrapper classes and opinionated defaults. \n",
|
||||
"\n",
|
||||
"#### Install Vertex AI SDK for Python"
|
||||
"#### Install Vertex SDK for Python"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -658,8 +658,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"dataset = load_dataset(\"imdb\")\n",
|
||||
"dataset"
|
||||
"datasets = load_dataset(\"imdb\")\n",
|
||||
"datasets"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -668,7 +668,7 @@
|
||||
"id": "RzfPtOMoIrIu"
|
||||
},
|
||||
"source": [
|
||||
"The `dataset` object itself is [`DatasetDict`](https://huggingface.co/docs/datasets/package_reference/main_classes.html#datasetdict), which contains one key for the training, validation and test set."
|
||||
"The `datasets` object itself is [`DatasetDict`](https://huggingface.co/docs/datasets/package_reference/main_classes.html#datasetdict), which contains one key for the training, validation and test set."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -681,12 +681,12 @@
|
||||
"source": [
|
||||
"print(\n",
|
||||
" \"Total # of rows in training dataset {} and size {:5.2f} MB\".format(\n",
|
||||
" dataset[\"train\"].shape[0], dataset[\"train\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" datasets[\"train\"].shape[0], datasets[\"train\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" )\n",
|
||||
")\n",
|
||||
"print(\n",
|
||||
" \"Total # of rows in test dataset {} and size {:5.2f} MB\".format(\n",
|
||||
" dataset[\"test\"].shape[0], dataset[\"test\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" datasets[\"test\"].shape[0], datasets[\"test\"].size_in_bytes / (1024 * 1024)\n",
|
||||
" )\n",
|
||||
")"
|
||||
]
|
||||
@@ -708,7 +708,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"dataset[\"train\"][0]"
|
||||
"datasets[\"train\"][0]"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -728,7 +728,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"label_list = dataset[\"train\"].unique(\"label\")\n",
|
||||
"label_list = datasets[\"train\"].unique(\"label\")\n",
|
||||
"label_list"
|
||||
]
|
||||
},
|
||||
@@ -779,7 +779,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"show_random_elements(dataset[\"train\"])"
|
||||
"show_random_elements(datasets[\"train\"])"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -883,7 +883,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"example = dataset[\"train\"][4]\n",
|
||||
"example = datasets[\"train\"][4]\n",
|
||||
"print(example)"
|
||||
]
|
||||
},
|
||||
@@ -920,7 +920,7 @@
|
||||
"source": [
|
||||
"# Dataset loading repeated here to make this cell idempotent\n",
|
||||
"# Since we are over-writing datasets variable\n",
|
||||
"dataset = load_dataset(\"imdb\")\n",
|
||||
"datasets = load_dataset(\"imdb\")\n",
|
||||
"\n",
|
||||
"# Mapping labels to ids\n",
|
||||
"# NOTE: We can extract this automatically but the `Unique` method of the datasets\n",
|
||||
@@ -948,7 +948,7 @@
|
||||
"\n",
|
||||
"\n",
|
||||
"# apply preprocessing function to input examples\n",
|
||||
"dataset = dataset.map(preprocess_function, batched=True, load_from_cache_file=True)"
|
||||
"datasets = datasets.map(preprocess_function, batched=True, load_from_cache_file=True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1091,8 +1091,8 @@
|
||||
"trainer = Trainer(\n",
|
||||
" model,\n",
|
||||
" args,\n",
|
||||
" train_dataset=dataset[\"train\"],\n",
|
||||
" eval_dataset=dataset[\"test\"],\n",
|
||||
" train_dataset=datasets[\"train\"],\n",
|
||||
" eval_dataset=datasets[\"test\"],\n",
|
||||
" data_collator=default_data_collator,\n",
|
||||
" tokenizer=tokenizer,\n",
|
||||
" compute_metrics=compute_metrics,\n",
|
||||
@@ -1199,7 +1199,7 @@
|
||||
"source": [
|
||||
"### Run predictions locally with sample examples\n",
|
||||
"\n",
|
||||
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex AI Predictions."
|
||||
"Using the trained model, we can predict the sentiment label for an input text after applying the preprocessing function that was used during the training. We will run the predictions locally in the notebook and later show how you can deploy the model to an endpoint using [TorchServe](https://pytorch.org/serve/) on Vertex Predictions."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1382,7 +1382,7 @@
|
||||
"id": "f7466d414a0e"
|
||||
},
|
||||
"source": [
|
||||
"### Run Custom Job on Vertex AI Training with a pre-built container"
|
||||
"### Run Custom Job on Vertex Training with a pre-built container"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1395,7 +1395,7 @@
|
||||
"\n",
|
||||
"In this notebook, we are using Hugging Face Datasets and fine tuning a transformer model from Hugging Face Transformers Library for sentiment analysis task using PyTorch. We will use [pre-built container for PyTorch](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers#pytorch) and package the training application code by adding standard Python dependencies - `transformers`, `datasets` and `tqdm` - in the `setup.py` file. \n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1569,7 +1569,7 @@
|
||||
"source": [
|
||||
"#### **Run custom training job on Vertex AI**\n",
|
||||
"\n",
|
||||
"We use [Vertex AI SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex AI training service."
|
||||
"We use [Vertex SDK for Python](https://cloud.google.com/vertex-ai/docs/start/client-libraries#client_libraries) to create and submit training job to the Vertex training service."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1578,7 +1578,7 @@
|
||||
"id": "5d2957ef04fd"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1598,7 +1598,7 @@
|
||||
"id": "6b0fed34b728"
|
||||
},
|
||||
"source": [
|
||||
"##### **Configure and submit Custom Job to Vertex AI Training service**"
|
||||
"##### **Configure and submit Custom Job to Vertex Training service**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1609,7 +1609,7 @@
|
||||
"source": [
|
||||
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [pre-built container](https://cloud.google.com/vertex-ai/docs/training/pre-built-containers) image for PyTorch and training code packaged as Python source distribution. \n",
|
||||
"\n",
|
||||
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex AI Training service."
|
||||
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job on Vertex Training service."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1686,7 +1686,7 @@
|
||||
"\n",
|
||||
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1798,7 +1798,7 @@
|
||||
"id": "c170d386492b"
|
||||
},
|
||||
"source": [
|
||||
"### Run Custom Job on Vertex AI Training with custom container"
|
||||
"### Run Custom Job on Vertex Training with custom container"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1807,7 +1807,7 @@
|
||||
"id": "035227b6e581"
|
||||
},
|
||||
"source": [
|
||||
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex AI Training service.\n",
|
||||
"To create a [training job with custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container?hl=hr), you define a `Dockerfile` to install or add the dependencies required for the training job. Then, you build and test your Docker image locally to verify, push the image to Container Registry and submit a Custom Job to Vertex Training service.\n",
|
||||
"\n",
|
||||
""
|
||||
]
|
||||
@@ -1834,7 +1834,7 @@
|
||||
"%%writefile ./custom_container/Dockerfile\n",
|
||||
"\n",
|
||||
"# Use pytorch GPU base image\n",
|
||||
"FROM us-docker.pkg.dev/vertex-ai/training/pytorch-gpu.1-10:latest\n",
|
||||
"FROM gcr.io/cloud-aiplatform/training/pytorch-gpu.1-7\n",
|
||||
"\n",
|
||||
"# set working directory\n",
|
||||
"WORKDIR /app\n",
|
||||
@@ -1968,7 +1968,7 @@
|
||||
"id": "a23e5e34bea9"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1988,11 +1988,11 @@
|
||||
"id": "abf1fa4085cb"
|
||||
},
|
||||
"source": [
|
||||
"##### **Configure and submit Custom Job to Vertex AI Training service**\n",
|
||||
"##### **Configure and submit Custom Job to Vertex Training service**\n",
|
||||
"\n",
|
||||
"Configure a [Custom Job](https://cloud.google.com/vertex-ai/docs/training/create-custom-job) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies\n",
|
||||
"\n",
|
||||
"**NOTE:** When using Vertex AI SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex AI Training."
|
||||
"**NOTE:** When using Vertex SDK for Python for submitting a training job, it creates a [Training Pipeline](https://cloud.google.com/vertex-ai/docs/training/create-training-pipeline) which launches the Custom Job to train on Vertex Training."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2044,7 +2044,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# submit the custom job to Vertex AI training service\n",
|
||||
"# submit the custom job to Vertex training service\n",
|
||||
"model = job.run(\n",
|
||||
" replica_count=1,\n",
|
||||
" machine_type=\"n1-standard-8\",\n",
|
||||
@@ -2065,7 +2065,7 @@
|
||||
"\n",
|
||||
"You can monitor the custom job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/training-pipelines/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2148,11 +2148,11 @@
|
||||
"id": "ba6122f929e3"
|
||||
},
|
||||
"source": [
|
||||
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex AI Training service.\n",
|
||||
"The training application code for fine-tuning a transformer model for sentiment analysis task uses hyperparameters such as learning rate and weight decay. These hyperparameters control the behavior of the training algorithm and can have a significant effect on the performance of the resulting model. This part of the notebook show how you can automate tuning these hyperparameters with Vertex Training service.\n",
|
||||
"\n",
|
||||
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex AI Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
|
||||
"We submit a [Hyperparameter Tuning job](https://cloud.google.com/vertex-ai/docs/training/hyperparameter-tuning-overview) to Vertex Training service by packaging the training application code and dependencies in a Docker container and push the container to Google Container Registry, similar to running a Custom Job on Vertex AI with Custom Container.\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2163,7 +2163,7 @@
|
||||
"source": [
|
||||
"### How hyperparameter tuning works in Vertex AI?\n",
|
||||
"\n",
|
||||
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex AI Training service:\n",
|
||||
"Following are the high level steps involved in running a Hyperparameter Tuning job on Vertex Training service:\n",
|
||||
"\n",
|
||||
"- You define the hyperparameters to tune the model along with the metric (or goal) to optimize\n",
|
||||
"- Vertex AI runs multiple trials of your training application with the hyperparameters and limits you specified - maximum number of trials to run and number of parallel trials. \n",
|
||||
@@ -2297,7 +2297,7 @@
|
||||
"source": [
|
||||
"### Run Hyperparameter Tuning Job on Vertex AI\n",
|
||||
"\n",
|
||||
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex AI Training service."
|
||||
"Before submitting the hyperparameter tuning job to Vertex AI, push the custom container image with training application to Google Cloud Container Registry and then submit the job to Vertex AI. We will be using the same image used for running Custom Job on Vertex Training service."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2326,7 +2326,7 @@
|
||||
"id": "f60fab07d67c"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2346,7 +2346,7 @@
|
||||
"id": "6652aa63ddff"
|
||||
},
|
||||
"source": [
|
||||
"##### **Configure and submit Hyperparameter Tuning Job to Vertex AI Training service**\n",
|
||||
"##### **Configure and submit Hyperparameter Tuning Job to Vertex Training service**\n",
|
||||
"\n",
|
||||
"Configure a [Hyperparameter Tuning Job](https://cloud.google.com/vertex-ai/docs/training/using-hyperparameter-tuning) with the [custom container](https://cloud.google.com/vertex-ai/docs/training/create-custom-container) image with training code and other dependencies.\n",
|
||||
"\n",
|
||||
@@ -2374,7 +2374,7 @@
|
||||
"id": "9d46db3a8b23"
|
||||
},
|
||||
"source": [
|
||||
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex AI"
|
||||
"Define the training arguments with `hp-tune` argument set to `y` so that training application code can report metrics to Vertex"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2548,7 +2548,7 @@
|
||||
"\n",
|
||||
"You can monitor the hyperparameter tuning job launched from Cloud Console following the link [here](https://console.cloud.google.com/vertex-ai/training/hyperparameter-tuning-jobs/) or use gcloud CLI command [`gcloud beta ai custom-jobs stream-logs`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/custom-jobs/stream-logs)\n",
|
||||
"\n",
|
||||
""
|
||||
""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2557,7 +2557,7 @@
|
||||
"id": "ba934b434f03"
|
||||
},
|
||||
"source": [
|
||||
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex AI Training service) as a Pandas dataframe"
|
||||
"After the job is finished, you can view and format the results of the hyperparameter tuning Trials (run by Vertex Training service) as a Pandas dataframe"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2612,7 +2612,7 @@
|
||||
"id": "5dbccb2b7d32"
|
||||
},
|
||||
"source": [
|
||||
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex AI Predictions"
|
||||
"Now from the results of Trials, you can pick the best performing Trial to deploy to Vertex Predictions"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2701,8 +2701,8 @@
|
||||
"JOB_NAME=${JOB_PREFIX}-pytorch-hptune-$(date +%Y%m%d%H%M%S)\n",
|
||||
"echo \"Launching hyperparameter tuning job with display name as \"$JOB_NAME\n",
|
||||
"\n",
|
||||
"# BUCKET_NAME is a required parameter to run the cell.\n",
|
||||
"BUCKET_NAME=$1\n",
|
||||
"# BUCKET_NAME: Change to your bucket name\n",
|
||||
"BUCKET_NAME=$1 # <-- CHANGE TO YOUR BUCKET NAME\n",
|
||||
"\n",
|
||||
"# APP_NAME: get application name\n",
|
||||
"APP_NAME=$2\n",
|
||||
@@ -2711,7 +2711,7 @@
|
||||
"JOB_DIR=${BUCKET_NAME}/${JOB_PREFIX}/model/${JOB_NAME}\n",
|
||||
"\n",
|
||||
"# custom container image URI\n",
|
||||
"CUSTOM_TRAIN_IMAGE_URI='gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
|
||||
"CUSTOM_TRAIN_IMAGE_URI=f'gcr.io/'${PROJECT_ID}'/pytorch_gpu_train_'${APP_NAME}\n",
|
||||
"\n",
|
||||
"# ========================================================\n",
|
||||
"# create hyperparameter tuning configuration file\n",
|
||||
@@ -2772,20 +2772,20 @@
|
||||
"source": [
|
||||
"## Deploying\n",
|
||||
"\n",
|
||||
"Deploying a PyTorch model on [Vertex AI Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex AI Predictions to classify sentiment of input texts. \n",
|
||||
"Deploying a PyTorch model on [Vertex Predictions](https://cloud.google.com/vertex-ai/docs/predictions/getting-predictions) requires to use a custom container that serves online predictions. You will deploy a container running [PyTorch's TorchServe](https://pytorch.org/serve/) tool in order to serve predictions from a fine-tuned transformer model from Hugging Face Transformers for sentiment analysis task. You can then use Vertex Predictions to classify sentiment of input texts. \n",
|
||||
"\n",
|
||||
"### Deploying model on Vertex AI Predictions with custom container\n",
|
||||
"### Deploying model on Vertex Predictions with custom container\n",
|
||||
"\n",
|
||||
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex AI Predictions.\n",
|
||||
"To use a custom container to serve predictions from a PyTorch model, you must provide Vertex AI with a Docker container image that runs an HTTP server, such as TorchServe in this case. Please refer to [documentation](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) that describes the container image requirements to be compatible with Vertex Predictions.\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"Essentially, to deploy a PyTorch model on Vertex AI Predictions following are the steps:\n",
|
||||
"Essentially, to deploy a PyTorch model on Vertex Predictions following are the steps:\n",
|
||||
"\n",
|
||||
"1. Package the trained model artifacts including [default](https://pytorch.org/serve/#default-handlers) or [custom](https://pytorch.org/serve/custom_service.html) handlers by creating an archive file using [Torch model archiver](https://github.com/pytorch/serve/tree/master/model-archiver)\n",
|
||||
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex AI Predictions to serve the model using Torchserve\n",
|
||||
"3. Upload the model with custom container image to serve predictions as a Vertex AI Model resource\n",
|
||||
"4. Create a Vertex AI Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
|
||||
"2. Build a [custom container](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements) compatible with Vertex Predictions to serve the model using Torchserve\n",
|
||||
"3. Upload the model with custom container image to serve predictions as a Vertex Model resource\n",
|
||||
"4. Create a Vertex Endpoint and [deploy the model](https://cloud.google.com/vertex-ai/docs/predictions/deploy-model-api) resource"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -2815,7 +2815,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"%%writefile predictor/custom_handler.py\n",
|
||||
"%%writefile predictor/custom_text_handler.py\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import json\n",
|
||||
@@ -2870,8 +2870,7 @@
|
||||
" with open(mapping_file_path) as f:\n",
|
||||
" self.mapping = json.load(f)\n",
|
||||
" else:\n",
|
||||
" logger.warning('Missing the index_to_name.json file. Inference output will default.')\n",
|
||||
" self.mapping = {\"0\": \"Negative\", \"1\": \"Positive\"}\n",
|
||||
" logger.warning('Missing the index_to_name.json file. Inference output will not include class name.')\n",
|
||||
"\n",
|
||||
" self.initialized = True\n",
|
||||
"\n",
|
||||
@@ -3048,13 +3047,10 @@
|
||||
"FROM pytorch/torchserve:latest-cpu\n",
|
||||
"\n",
|
||||
"# install dependencies\n",
|
||||
"RUN python3 -m pip install --upgrade pip\n",
|
||||
"RUN pip3 install transformers\n",
|
||||
"\n",
|
||||
"USER model-server\n",
|
||||
"\n",
|
||||
"# copy model artifacts, custom handler and other dependencies\n",
|
||||
"COPY ./custom_handler.py /home/model-server/\n",
|
||||
"COPY ./custom_text_handler.py /home/model-server/\n",
|
||||
"COPY ./index_to_name.json /home/model-server/\n",
|
||||
"COPY ./model/$APP_NAME/ /home/model-server/\n",
|
||||
"\n",
|
||||
@@ -3074,7 +3070,7 @@
|
||||
" --model-name=$APP_NAME \\\n",
|
||||
" --version=1.0 \\\n",
|
||||
" --serialized-file=/home/model-server/pytorch_model.bin \\\n",
|
||||
" --handler=/home/model-server/custom_handler.py \\\n",
|
||||
" --handler=/home/model-server/custom_text_handler.py \\\n",
|
||||
" --extra-files \"/home/model-server/config.json,/home/model-server/tokenizer.json,/home/model-server/training_args.bin,/home/model-server/tokenizer_config.json,/home/model-server/special_tokens_map.json,/home/model-server/vocab.txt,/home/model-server/index_to_name.json\" \\\n",
|
||||
" --export-path=/home/model-server/model-store\n",
|
||||
"\n",
|
||||
@@ -3133,7 +3129,7 @@
|
||||
"source": [
|
||||
"#### **Run the container locally** ***[Optional]***\n",
|
||||
"\n",
|
||||
"Before push the container image to Container Registry to use it with Vertex AI Predictions, you can run it as a container in your local environment to verify that the server works as expected"
|
||||
"Before push the container image to Container Registry to use it with Vertex Predictions, you can run it as a container in your local environment to verify that the server works as expected"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3271,9 +3267,9 @@
|
||||
"id": "69477b3a00c0"
|
||||
},
|
||||
"source": [
|
||||
"#### **Deploying the serving container to Vertex AI Predictions**\n",
|
||||
"#### **Deploying the serving container to Vertex Predictions**\n",
|
||||
"\n",
|
||||
"We create a model resource on Vertex AI and deploy the model to a Vertex AI Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
|
||||
"We create a model resource on Vertex AI and deploy the model to a Vertex Endpoints. You must deploy a model to an endpoint before using the model. The deployed model runs the custom container image to serve predictions. "
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3304,7 +3300,7 @@
|
||||
"id": "a3da91e19af4"
|
||||
},
|
||||
"source": [
|
||||
"##### **Initialize the Vertex AI SDK for Python**"
|
||||
"##### **Initialize the Vertex SDK for Python**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3441,7 +3437,7 @@
|
||||
"id": "bc4673478269"
|
||||
},
|
||||
"source": [
|
||||
"#### **Invoking the Endpoint with deployed Model using Vertex AI SDK to make predictions**"
|
||||
"#### **Invoking the Endpoint with deployed Model using Vertex SDK to make predictions**"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3491,7 +3487,7 @@
|
||||
"source": [
|
||||
"##### **Formatting input for online prediction**\n",
|
||||
"\n",
|
||||
"This notebook uses [Torchserve's KServe based inference API](https://pytorch.org/serve/inference_api.html#kserve-inference-api) which is also [Vertex AI Predictions compatible format](https://cloud.google.com/vertex-ai/docs/predictions/custom-container-requirements#prediction). For online prediction requests, format the prediction input instances as JSON with base64 encoding as shown here:\n",
|
||||
"For online prediction requests, the prediction input instances must be formatted as JSON with base64 encoding as shown here:\n",
|
||||
"\n",
|
||||
"```\n",
|
||||
"[\n",
|
||||
@@ -3564,9 +3560,9 @@
|
||||
},
|
||||
"source": [
|
||||
"##### ***[Optional]*** **Make prediction requests using gcloud CLI**\n",
|
||||
"You can also call the Vertex AI Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
|
||||
"You can also call the Vertex Endpoint to make predictions using [`gcloud beta ai endpoints predict`](https://cloud.google.com/sdk/gcloud/reference/beta/ai/endpoints/predict). \n",
|
||||
"\n",
|
||||
"The following cell shows how to make a prediction request to Vertex AI Endpoints using `gcloud` CLI: "
|
||||
"The following cell shows how to make a prediction request to Vertex Endpoints using `gcloud` CLI: "
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3657,12 +3653,12 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"delete_custom_job = False\n",
|
||||
"delete_hp_tuning_job = False\n",
|
||||
"delete_custom_job = True\n",
|
||||
"delete_hp_tuning_job = True\n",
|
||||
"delete_endpoint = True\n",
|
||||
"delete_model = False\n",
|
||||
"delete_bucket = False\n",
|
||||
"delete_image = False"
|
||||
"delete_model = True\n",
|
||||
"delete_bucket = True\n",
|
||||
"delete_image = True"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -3690,7 +3686,7 @@
|
||||
"\n",
|
||||
"client_options = {\"api_endpoint\": API_ENDPOINT}\n",
|
||||
"\n",
|
||||
"# Initialize Vertex AI SDK\n",
|
||||
"# Initialize Vertex SDK\n",
|
||||
"aiplatform.init(project=PROJECT_ID, staging_bucket=BUCKET_NAME)"
|
||||
]
|
||||
},
|
||||
@@ -3928,7 +3924,7 @@
|
||||
"if delete_bucket and \"BUCKET_NAME\" in globals():\n",
|
||||
" print(f\"Deleting all contents from the bucket {BUCKET_NAME}\")\n",
|
||||
"\n",
|
||||
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
|
||||
" shell_output=! gsutil du -as $BUCKET_NAME\n",
|
||||
" print(\n",
|
||||
" f\"Size of the bucket {BUCKET_NAME} before deleting = {shell_output[0].split()[0]} bytes\"\n",
|
||||
" )\n",
|
||||
@@ -3936,7 +3932,7 @@
|
||||
" # uncomment below line to delete contents of the bucket\n",
|
||||
" # ! gsutil rm -r $BUCKET_NAME\n",
|
||||
"\n",
|
||||
" shell_output = ! gsutil du -as $BUCKET_NAME\n",
|
||||
" shell_output=! gsutil du -as $BUCKET_NAME\n",
|
||||
" if float(shell_output[0].split()[0]) > 0:\n",
|
||||
" print(\n",
|
||||
" \"PLEASE UNCOMMENT LINE TO DELETE BUCKET. CONTENT FROM THE BUCKET NOT DELETED\"\n",
|
||||
|
||||
@@ -188,14 +188,11 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip3 install {USER_FLAG} google-cloud-aiplatform\n",
|
||||
"! pip3 install {USER_FLAG} google-cloud-pipeline-components\n",
|
||||
"! pip3 install {USER_FLAG} google-cloud-aiplatform==1.0.1\n",
|
||||
"! pip3 install {USER_FLAG} google-cloud-pipeline-components==0.1.3\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade kfp\n",
|
||||
"! pip3 install {USER_FLAG} numpy\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade tensorflow\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade pillow\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade tf-agents\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade fastapi"
|
||||
"! pip3 install {USER_FLAG} numpy==1.20.3\n",
|
||||
"! pip3 install {USER_FLAG} --upgrade tensorflow"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -290,7 +287,7 @@
|
||||
"\n",
|
||||
"# Get your Google Cloud project ID from gcloud\n",
|
||||
"if not os.getenv(\"IS_TESTING\"):\n",
|
||||
" shell_output = !gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" PROJECT_ID = shell_output[0]\n",
|
||||
" print(\"Project ID: \", PROJECT_ID)"
|
||||
]
|
||||
@@ -521,7 +518,6 @@
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"from google.cloud import aiplatform\n",
|
||||
"from google_cloud_pipeline_components import aiplatform as gcc_aip\n",
|
||||
"from kfp.v2 import compiler, dsl\n",
|
||||
"from kfp.v2.google.client import AIPlatformClient"
|
||||
@@ -561,30 +557,6 @@
|
||||
"You may use the default values below as is."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "895ac243c125"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Dataset parameters\n",
|
||||
"RAW_DATA_PATH = \"gs://[your-bucket-name]/raw_data/u.data\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "62bfb9a820f6"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Download the sample data into your RAW_DATA_PATH\n",
|
||||
"! gsutil cp \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" $RAW_DATA_PATH"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -593,6 +565,9 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Dataset parameters\n",
|
||||
"RAW_DATA_PATH = \"gs://cloud-samples-data/vertex-ai/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/u.data\" # Location of the MovieLens 100K dataset's \"u.data\" file.\n",
|
||||
"\n",
|
||||
"# Pipeline parameters\n",
|
||||
"PIPELINE_NAME = \"movielens-pipeline\" # Pipeline display name.\n",
|
||||
"ENABLE_CACHING = False # Whether to enable execution caching for the pipeline.\n",
|
||||
@@ -660,7 +635,7 @@
|
||||
"source": [
|
||||
"#### Run unit tests on the Generator component\n",
|
||||
"\n",
|
||||
"Before running the command, you should update the `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
|
||||
"Before running the command, fill in `RAW_DATA_PATH` in [`src/generator/test_generator_component.py`](src/generator/test_generator_component.py)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -738,12 +713,12 @@
|
||||
"TRAINING_ARTIFACTS_DIR = (\n",
|
||||
" f\"{BUCKET_NAME}/artifacts\" # Root directory for training artifacts.\n",
|
||||
")\n",
|
||||
"TRAINING_REPLICA_COUNT = 1 # Number of replica to run the custom training job.\n",
|
||||
"TRAINING_REPLICA_COUNT = \"1\" # Number of replica to run the custom training job.\n",
|
||||
"TRAINING_MACHINE_TYPE = (\n",
|
||||
" \"n1-standard-4\" # Type of machine to run the custom training job.\n",
|
||||
")\n",
|
||||
"TRAINING_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
|
||||
"TRAINING_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
|
||||
"TRAINING_ACCELERATOR_COUNT = \"0\" # Number of accelerators for the custom training job."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -794,12 +769,8 @@
|
||||
"TRAINED_POLICY_DISPLAY_NAME = (\n",
|
||||
" \"movielens-trained-policy\" # Display name of the uploaded and deployed policy.\n",
|
||||
")\n",
|
||||
"TRAFFIC_SPLIT = {\"0\": 100}\n",
|
||||
"ENDPOINT_DISPLAY_NAME = \"movielens-endpoint\" # Display name of the prediction endpoint.\n",
|
||||
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint.\n",
|
||||
"ENDPOINT_REPLICA_COUNT = 1 # Number of replicas of the prediction endpoint.\n",
|
||||
"ENDPOINT_ACCELERATOR_TYPE = \"ACCELERATOR_TYPE_UNSPECIFIED\" # Type of accelerators to run the custom training job.\n",
|
||||
"ENDPOINT_ACCELERATOR_COUNT = 0 # Number of accelerators for the custom training job."
|
||||
"ENDPOINT_MACHINE_TYPE = \"n1-standard-4\" # Type of machine of the prediction endpoint."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -929,17 +900,16 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from google_cloud_pipeline_components.experimental.custom_job import utils\n",
|
||||
"from kfp.components import load_component_from_url\n",
|
||||
"\n",
|
||||
"generate_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/generator/component.yaml\"\n",
|
||||
")\n",
|
||||
"ingest_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
")\n",
|
||||
"train_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"\n",
|
||||
@@ -1008,7 +978,7 @@
|
||||
" bigquery_location=bigquery_location,\n",
|
||||
" bigquery_table_id=bigquery_table_id,\n",
|
||||
" )\n",
|
||||
" \n",
|
||||
"\n",
|
||||
" # Run the Ingester component.\n",
|
||||
" ingest_task = ingest_op(\n",
|
||||
" project_id=project_id,\n",
|
||||
@@ -1018,16 +988,7 @@
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Run the Trainer component and submit custom job to Vertex AI.\n",
|
||||
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
|
||||
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
|
||||
" component_spec=train_op,\n",
|
||||
" replica_count=TRAINING_REPLICA_COUNT,\n",
|
||||
" machine_type=TRAINING_MACHINE_TYPE,\n",
|
||||
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" train_task = custom_job_training_op(\n",
|
||||
" train_task = train_op(\n",
|
||||
" training_artifacts_dir=training_artifacts_dir,\n",
|
||||
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
|
||||
" num_epochs=num_epochs,\n",
|
||||
@@ -1035,10 +996,28 @@
|
||||
" num_actions=num_actions,\n",
|
||||
" tikhonov_weight=tikhonov_weight,\n",
|
||||
" agent_alpha=agent_alpha,\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" location=REGION,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" worker_pool_specs = [\n",
|
||||
" {\n",
|
||||
" \"containerSpec\": {\n",
|
||||
" \"imageUri\": train_task.container.image,\n",
|
||||
" },\n",
|
||||
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
|
||||
" \"machineSpec\": {\n",
|
||||
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
|
||||
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" },\n",
|
||||
" },\n",
|
||||
" ]\n",
|
||||
" train_task.custom_job_spec = {\n",
|
||||
" \"displayName\": train_task.name,\n",
|
||||
" \"jobSpec\": {\n",
|
||||
" \"workerPoolSpecs\": worker_pool_specs,\n",
|
||||
" },\n",
|
||||
" }\n",
|
||||
"\n",
|
||||
" # Run the Deployer components.\n",
|
||||
" # Upload the trained policy as a model.\n",
|
||||
" model_upload_op = gcc_aip.ModelUploadOp(\n",
|
||||
@@ -1055,14 +1034,11 @@
|
||||
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
|
||||
" # has to occur after both model uploading and endpoint creation complete.)\n",
|
||||
" gcc_aip.ModelDeployOp(\n",
|
||||
" project=project_id,\n",
|
||||
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
|
||||
" model=model_upload_op.outputs[\"model\"],\n",
|
||||
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
|
||||
" traffic_split=TRAFFIC_SPLIT,\n",
|
||||
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
|
||||
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
|
||||
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
|
||||
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" )"
|
||||
]
|
||||
},
|
||||
@@ -1077,11 +1053,12 @@
|
||||
"# Compile the authored pipeline.\n",
|
||||
"compiler.Compiler().compile(pipeline_func=pipeline, package_path=PIPELINE_SPEC_PATH)\n",
|
||||
"\n",
|
||||
"# Createa Vertex AI client.\n",
|
||||
"api_client = AIPlatformClient(project_id=PROJECT_ID, region=REGION)\n",
|
||||
"\n",
|
||||
"# Create a pipeline run job.\n",
|
||||
"job = aiplatform.PipelineJob(\n",
|
||||
" display_name=f\"{PIPELINE_NAME}-startup\",\n",
|
||||
" template_path=PIPELINE_SPEC_PATH,\n",
|
||||
" pipeline_root=PIPELINE_ROOT,\n",
|
||||
"response = api_client.create_run_from_job_spec(\n",
|
||||
" job_spec_path=PIPELINE_SPEC_PATH,\n",
|
||||
" parameter_values={\n",
|
||||
" # Pipeline configs\n",
|
||||
" \"project_id\": PROJECT_ID,\n",
|
||||
@@ -1093,9 +1070,7 @@
|
||||
" \"bigquery_table_id\": BIGQUERY_TABLE_ID,\n",
|
||||
" },\n",
|
||||
" enable_caching=ENABLE_CACHING,\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"job.run()"
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1136,11 +1111,7 @@
|
||||
"SIMULATOR_SCHEDULE = \"*/5 * * * *\" # Cloud Scheduler cron job schedule for the Simulator. Eg. \"*/5 * * * *\" means every 5 mins.\n",
|
||||
"SIMULATOR_SCHEDULER_MESSAGE = (\n",
|
||||
" \"simulator-message\" # Cloud Scheduler message for the Simulator.\n",
|
||||
")\n",
|
||||
"# TF-Agents RL configs\n",
|
||||
"BATCH_SIZE = 8\n",
|
||||
"RANK_K = 20\n",
|
||||
"NUM_ACTIONS = 20"
|
||||
")"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1250,7 +1221,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"endpoints = ! gcloud ai endpoints list \\\n",
|
||||
"endpoints = ! gcloud beta ai endpoints list \\\n",
|
||||
" --region=$REGION \\\n",
|
||||
" --filter=display_name=$ENDPOINT_DISPLAY_NAME\n",
|
||||
"print(\"\\n\".join(endpoints), \"\\n\")\n",
|
||||
@@ -1453,11 +1424,13 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"from kfp.components import load_component_from_url\n",
|
||||
"\n",
|
||||
"ingest_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/ingester/component.yaml\"\n",
|
||||
")\n",
|
||||
"train_op = load_component_from_url(\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/62a2a7611499490b4b04d731d48a7ba87c2d636f/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
" \"https://raw.githubusercontent.com/GoogleCloudPlatform/vertex-ai-samples/68d6cf46ee22a9b9295d62ea71996150baf8db94/community-content/tf_agents_bandits_movie_recommendation_with_kfp_and_vertex_sdk/mlops_pipeline_tf_agents_bandits_movie_recommendation/src/trainer/component.yaml\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"\n",
|
||||
@@ -1508,16 +1481,7 @@
|
||||
" )\n",
|
||||
"\n",
|
||||
" # Run the Trainer component and submit custom job to Vertex AI.\n",
|
||||
" # Convert the train_op component into a Vertex AI Custom Job pre-built component\n",
|
||||
" custom_job_training_op = utils.create_custom_training_job_op_from_component(\n",
|
||||
" component_spec=train_op,\n",
|
||||
" replica_count=TRAINING_REPLICA_COUNT,\n",
|
||||
" machine_type=TRAINING_MACHINE_TYPE,\n",
|
||||
" accelerator_type=TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" accelerator_count=TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" train_task = custom_job_training_op(\n",
|
||||
" train_task = train_op(\n",
|
||||
" training_artifacts_dir=training_artifacts_dir,\n",
|
||||
" tfrecord_file=ingest_task.outputs[\"tfrecord_file\"],\n",
|
||||
" num_epochs=num_epochs,\n",
|
||||
@@ -1525,10 +1489,28 @@
|
||||
" num_actions=num_actions,\n",
|
||||
" tikhonov_weight=tikhonov_weight,\n",
|
||||
" agent_alpha=agent_alpha,\n",
|
||||
" project=PROJECT_ID,\n",
|
||||
" location=REGION,\n",
|
||||
" )\n",
|
||||
"\n",
|
||||
" worker_pool_specs = [\n",
|
||||
" {\n",
|
||||
" \"containerSpec\": {\n",
|
||||
" \"imageUri\": train_task.container.image,\n",
|
||||
" },\n",
|
||||
" \"replicaCount\": TRAINING_REPLICA_COUNT,\n",
|
||||
" \"machineSpec\": {\n",
|
||||
" \"machineType\": TRAINING_MACHINE_TYPE,\n",
|
||||
" \"acceleratorType\": TRAINING_ACCELERATOR_TYPE,\n",
|
||||
" \"acceleratorCount\": TRAINING_ACCELERATOR_COUNT,\n",
|
||||
" },\n",
|
||||
" },\n",
|
||||
" ]\n",
|
||||
" train_task.custom_job_spec = {\n",
|
||||
" \"displayName\": train_task.name,\n",
|
||||
" \"jobSpec\": {\n",
|
||||
" \"workerPoolSpecs\": worker_pool_specs,\n",
|
||||
" },\n",
|
||||
" }\n",
|
||||
"\n",
|
||||
" # Run the Deployer components.\n",
|
||||
" # Upload the trained policy as a model.\n",
|
||||
" model_upload_op = gcc_aip.ModelUploadOp(\n",
|
||||
@@ -1545,13 +1527,11 @@
|
||||
" # Deploy the uploaded, trained policy to the created endpoint. (This operation\n",
|
||||
" # has to occur after both model uploading and endpoint creation complete.)\n",
|
||||
" gcc_aip.ModelDeployOp(\n",
|
||||
" project=project_id,\n",
|
||||
" endpoint=endpoint_create_op.outputs[\"endpoint\"],\n",
|
||||
" model=model_upload_op.outputs[\"model\"],\n",
|
||||
" deployed_model_display_name=TRAINED_POLICY_DISPLAY_NAME,\n",
|
||||
" dedicated_resources_machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" dedicated_resources_accelerator_type=ENDPOINT_ACCELERATOR_TYPE,\n",
|
||||
" dedicated_resources_accelerator_count=ENDPOINT_ACCELERATOR_COUNT,\n",
|
||||
" dedicated_resources_min_replica_count=ENDPOINT_REPLICA_COUNT,\n",
|
||||
" machine_type=ENDPOINT_MACHINE_TYPE,\n",
|
||||
" )"
|
||||
]
|
||||
},
|
||||
|
||||
@@ -39,15 +39,14 @@ outputs:
|
||||
- {name: bigquery_table_id, type: String}
|
||||
implementation:
|
||||
container:
|
||||
image: python:3.7
|
||||
image: tensorflow/tensorflow:2.5.0
|
||||
command:
|
||||
- sh
|
||||
- -c
|
||||
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
|
||||
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|
||||
|| PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
|
||||
'google-cloud-bigquery==2.20.0' 'pillow' 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|
||||
--user) && "$0" "$@"
|
||||
'google-cloud-bigquery==2.20.0' 'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1
|
||||
python3 -m pip install --quiet --no-warn-script-location 'google-cloud-bigquery==2.20.0'
|
||||
'tensorflow==2.5.0' 'tf-agents==0.8.0' --user) && "$0" "$@"
|
||||
- sh
|
||||
- -ec
|
||||
- |
|
||||
@@ -297,8 +296,7 @@ implementation:
|
||||
|
||||
def _serialize_str(str_value: str) -> str:
|
||||
if not isinstance(str_value, str):
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
|
||||
str(str_value), str(type(str_value))))
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
|
||||
return str_value
|
||||
|
||||
import argparse
|
||||
|
||||
@@ -20,7 +20,7 @@ outputs:
|
||||
- {name: tfrecord_file, type: String}
|
||||
implementation:
|
||||
container:
|
||||
image: python:3.7
|
||||
image: tensorflow/tensorflow:2.5.0
|
||||
command:
|
||||
- sh
|
||||
- -c
|
||||
@@ -187,8 +187,7 @@ implementation:
|
||||
|
||||
def _serialize_str(str_value: str) -> str:
|
||||
if not isinstance(str_value, str):
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
|
||||
str(str_value), str(type(str_value))))
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
|
||||
return str_value
|
||||
|
||||
import argparse
|
||||
|
||||
@@ -1,4 +1,3 @@
|
||||
google-cloud-bigquery==2.20.0
|
||||
tensorflow==2.7.2
|
||||
pillow==9.0.1
|
||||
tensorflow==2.5.2
|
||||
tf-agents==0.8.0
|
||||
|
||||
@@ -1,4 +1,2 @@
|
||||
google-cloud-pubsub==2.5.0
|
||||
pillow==9.0.1
|
||||
tf-agents==0.8.0
|
||||
tensorflow==2.7.2
|
||||
tensorflow==2.5.2
|
||||
|
||||
@@ -1,5 +0,0 @@
|
||||
dataclasses==0.6
|
||||
google-cloud-aiplatform==1.8.1
|
||||
tensorflow==2.7.2
|
||||
pillow==9.0.1
|
||||
tf-agents==0.8.0
|
||||
@@ -27,14 +27,14 @@ outputs:
|
||||
- {name: training_artifacts_dir, type: String}
|
||||
implementation:
|
||||
container:
|
||||
image: python:3.7
|
||||
image: tensorflow/tensorflow:2.5.0
|
||||
command:
|
||||
- sh
|
||||
- -c
|
||||
- (PIP_DISABLE_PIP_VERSION_CHECK=1 python3 -m pip install --quiet --no-warn-script-location
|
||||
'tensorflow==2.5.0' 'tf-agents==0.8.0' 'Pillow' || PIP_DISABLE_PIP_VERSION_CHECK=1
|
||||
python3 -m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0'
|
||||
'tf-agents==0.8.0' 'Pillow' --user) && "$0" "$@"
|
||||
'tensorflow==2.5.0' 'tf-agents==0.8.0' || PIP_DISABLE_PIP_VERSION_CHECK=1 python3
|
||||
-m pip install --quiet --no-warn-script-location 'tensorflow==2.5.0' 'tf-agents==0.8.0'
|
||||
--user) && "$0" "$@"
|
||||
- sh
|
||||
- -ec
|
||||
- |
|
||||
@@ -270,8 +270,7 @@ implementation:
|
||||
|
||||
def _serialize_str(str_value: str) -> str:
|
||||
if not isinstance(str_value, str):
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(
|
||||
str(str_value), str(type(str_value))))
|
||||
raise TypeError('Value "{}" has type "{}" instead of str.'.format(str(str_value), str(type(str_value))))
|
||||
return str_value
|
||||
|
||||
import argparse
|
||||
|
||||
@@ -22,13 +22,13 @@ from src.training import task
|
||||
|
||||
|
||||
# Paths and configurations
|
||||
DATA_PATH = "gs://[your-bucket-name]/artifacts/u.data" # FILL IN
|
||||
DATA_PATH = "gs://[your-bucket-name]/[your-dataset-dir]/u.data" # FILL IN
|
||||
ROOT_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
|
||||
ARTIFACTS_DIR = "gs://[your-bucket-name]/artifacts" # FILL IN
|
||||
PROFILER_DIR = "gs://[your-bucket-name]/profiler" # FILL IN
|
||||
HPTUNING_RESULT_DIR = "[your-hptuning-result-dir]/" # FILL IN
|
||||
HPTUNING_RESULT_PATH = os.path.join(HPTUNING_RESULT_DIR,
|
||||
"result.json") # FILL IN
|
||||
"[your-file-name].json") # FILL IN
|
||||
RAW_BUCKET_NAME = "[your-hptuning-result-bucket-name]" # FILL IN
|
||||
|
||||
# Hyperparameters
|
||||
|
||||
@@ -1 +1 @@
|
||||
tensorflow==2.7.2
|
||||
tensorflow==2.5.2
|
||||
@@ -1 +1 @@
|
||||
tensorflow==2.7.2
|
||||
tensorflow==2.5.2
|
||||
@@ -8,7 +8,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2022 Google LLC\n",
|
||||
"# Copyright 2021 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
@@ -113,8 +113,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gcloud ai custom-jobs local-run \\\n",
|
||||
" --executor-image-uri=$BASE_IMAGE_URI \\\n",
|
||||
"! gcloud beta ai custom-jobs local-run \\\n",
|
||||
" --base-image=$BASE_IMAGE_URI \\\n",
|
||||
" --script=$SCRIPT_PATH \\\n",
|
||||
" --output-image-uri=$OUTPUT_IMAGE_NAME \\\n",
|
||||
" -- \\\n",
|
||||
|
||||
@@ -1,5 +0,0 @@
|
||||
The [official](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/official) folder contains notebooks organized by Google Cloud product. These are tested weekly and maintained by Google.
|
||||
|
||||
The [community](https://github.com/GoogleCloudPlatform/vertex-ai-samples/tree/main/notebooks/community) folder contains notebooks that may be created by Google or external contributors. They are not necessary maintained.
|
||||
|
||||
Contributions to the repo should use the [notebook template](https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/notebook_template.ipynb) as a starting point.
|
||||
@@ -3,28 +3,16 @@
|
||||
# @global-owner1 and @global-owner2 will be requested for
|
||||
# review when someone opens a pull request.
|
||||
|
||||
/sdk/sdk_* @andrewferlitsch
|
||||
/gapic @andrewferlitsch
|
||||
/gapic/custom/showcase_custom_image_classification_online_explain_example_based_api.ipynb @inardini
|
||||
/ml_ops @andrewferlitsch
|
||||
/model_monitoring/* @mco-gh
|
||||
/sdk/sdk_* @aferlitsch
|
||||
/gapic @aferlitsch
|
||||
/ml_ops @aferlitsch
|
||||
/model_monitoring/* @mco
|
||||
/structured_data/rapid_prototyping_* @rafael-carvalho
|
||||
|
||||
/managed_notebooks/
|
||||
/bigquery_ml/ @polong
|
||||
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
|
||||
/managed_notebooks/ @notebooks-team
|
||||
/sdk/SDK_FBProphet_Forecasting_Online.ipynb @brianchunkang
|
||||
/pipelines/google_cloud_pipeline_components_TPU_model_train_upload_deploy.ipynb @brianchunkang
|
||||
/explainable_ai/SDK_Custom_Container_XAI.ipynb @brianchunkang
|
||||
/matching_engine/sdk_matching_engine_for_indexing.ipynb @ivanmkc
|
||||
/matching_engine/matching_engine_for_indexing.ipynb @yinghsienwu
|
||||
/sdk/pytorch_lightning_custom_container_training.ipynb @brianchunkang
|
||||
/tensorboard @yfang1
|
||||
/feature_store @nayaknishant @morgandu
|
||||
/prediction @googleapis/vertex-prediction-team
|
||||
/vertex_endpoints/tf_hub_obj_detection/deploy_tfhub_object_detection_on_vertex_endpoints.ipynb @entrpn
|
||||
/vertex_endpoints/nvidia-triton/nvidia-triton-custom-container-prediction.ipynb @RajeshThallam
|
||||
/vertex_endpoints/optimized_tensorflow_runtime @vlasenkoalexey
|
||||
/notebooks/community/ml_ops/stage2/get_started_with_visionapi_and_automl.ipynb @mansari
|
||||
/notebooks/community/neo4j/graph_paysim.ipynb @benofben @laeg
|
||||
/notebooks/community/ml_ops/stage1/get_started_with_visionapi_and_vertex_datasets.ipynb @mansari
|
||||
/notebooks/community/pipelines/google_cloud_pipeline_components_bqml_pipeline_demand_forecasting.ipynb @inardini
|
||||
/sdk/SDK_AutoML_Forecasting_Model_Training_Example.ipynb @thehardikv
|
||||
/sdk/sdk_automl_forecasting_evaluating_a_model.ipynb @thehardikv
|
||||
/matching_engine @yinghsienwu
|
||||
/neo4j @benofben @htappen
|
||||
|
Before Width: | Height: | Size: 83 KiB |
|
Before Width: | Height: | Size: 141 KiB |
|
Before Width: | Height: | Size: 230 KiB |
|
Before Width: | Height: | Size: 140 KiB |
|
Before Width: | Height: | Size: 140 KiB |
|
Before Width: | Height: | Size: 13 KiB After Width: | Height: | Size: 13 KiB |
|
Before Width: | Height: | Size: 44 KiB After Width: | Height: | Size: 44 KiB |
|
Before Width: | Height: | Size: 18 KiB After Width: | Height: | Size: 18 KiB |
|
Before Width: | Height: | Size: 10 KiB After Width: | Height: | Size: 10 KiB |
@@ -1,55 +1,29 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "503077811e70"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2022 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
"# You may obtain a copy of the License at\n",
|
||||
"#\n",
|
||||
"# https://www.apache.org/licenses/LICENSE-2.0\n",
|
||||
"#\n",
|
||||
"# Unless required by applicable law or agreed to in writing, software\n",
|
||||
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
|
||||
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
|
||||
"# See the License for the specific language governing permissions and\n",
|
||||
"# limitations under the License."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "e885ac09bc73"
|
||||
},
|
||||
"source": [
|
||||
"# Train a multi-class classification model for ads-targeting\n",
|
||||
"<table align=\"left\">\n",
|
||||
"\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/workbench/ads_targetting/training-multi-class-classification-model-for-ads-targeting-usecase.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/workbench/ads_targetting/training-multi-class-classification-model-for-ads-targeting-usecase.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/workbench/ads_targetting/training-multi-class-classification-model-for-ads-targeting-usecase.ipynb\">\n",
|
||||
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
|
||||
" Open in Vertex AI Workbench\n",
|
||||
" </a>\n",
|
||||
" </td> \n",
|
||||
"</table>"
|
||||
"## Table of contents\n",
|
||||
"\n",
|
||||
"* [Overview](#section-1)\n",
|
||||
"* [Dataset](#section-2)\n",
|
||||
"* [Objective](#section-3)\n",
|
||||
"* [Costs](#section-4)\n",
|
||||
"* [Tutorial](#section-5)\n",
|
||||
"\t- [Fetch the data from BigQuery](#section-5)\n",
|
||||
" - [Preprocess the data](#section-6)\n",
|
||||
" - [Train a TensorFlow model](#section-7)\n",
|
||||
" - [Run the model on test data](#section-8)\n",
|
||||
" - [Automating the execution of the notebook using executor](#section-9)\n",
|
||||
" - [Scheduled runs on executor](#section-10)\n",
|
||||
" - [Parameterizing the variables](#section-11)\n",
|
||||
"* [Save the model to a Cloud Storage path](#section-12)\n",
|
||||
"* [Clean up](#section-13)\n"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -59,19 +33,23 @@
|
||||
},
|
||||
"source": [
|
||||
"## Overview\n",
|
||||
"<a name=\"section-1\"></a>\n",
|
||||
"\n",
|
||||
"This tutorial demonstrates how to build a machine learning model for an ads-targeting use case. Ads-targeting is an advertisement technique where chosen or tailor-made ads are shown to the customers based on their past behavior and preferences. Targeted ads are meant to reach specific customers based on demographics, psychographics, behavior, and other second-order activities that are learned usually through data collected from the customers.\n",
|
||||
"\n",
|
||||
"*Note: If you are using [Vertex AI Workbench managed notebooks](https://cloud.google.com/vertex-ai/docs/workbench/managed/create-instance) instance use the `TensorFlow 2 (Local)` kernel. Some components of this notebook may not work in other notebook environments.*\n"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "1bea2b6e9b25"
|
||||
},
|
||||
"source": [
|
||||
"*Note: This notebook file was designed to run in a [Vertex AI Workbench managed notebooks](https://cloud.google.com/vertex-ai/docs/workbench/managed/create-instance) instance using the `TensorFlow 2 (Local)` kernel. Some components of this notebook may not work in other notebook environments.*\n",
|
||||
"\n",
|
||||
"## Dataset\n",
|
||||
"<a name=\"section-2\"></a>\n",
|
||||
"\n",
|
||||
"This tutorial uses the `looker-private-demo.ecomm` dataset in BigQuery. The dataset consists of information about various advertisement campaigns including the demographics of users who have clicked and made some purchases after seeing the ads. For this tutorial, the top three campaigns from the USA are selected from this dataset and user information for those who have made purchases shall be used to train a model with the campaigns as the classes. The idea is to see if the advertisement and the user data can be used to identify which campaign is best-suited for the user.\n",
|
||||
"\n",
|
||||
"The dataset can be accessed by pinning the `looker-private-demo` project in BigQuery. Instead of going to the BigQuery user interface, this process can be performed from the JupyterLab user interface on a Vertex AI Workbench managed notebooks instance. Vertex AI Workbench managed notebooks instances support browsing through the datasets and tables from BigQuery through its BigQuery integration. \n",
|
||||
"\n",
|
||||
"<img src=\"images/Bigquery_UI_new.PNG\"></img>\n",
|
||||
"\n",
|
||||
"## Objective\n",
|
||||
"<a name=\"section-3\"></a>\n",
|
||||
"\n",
|
||||
"This tutorial demonstrates how to collect data from BigQuery, preprocess it, and train a multi-class classification model on an E-commerce dataset. The steps performed include the following:\n",
|
||||
"\n",
|
||||
@@ -81,31 +59,10 @@
|
||||
"- Evaluate the loss for the trained model\n",
|
||||
"- Automate the notebook execution using the executor feature\n",
|
||||
"- Save the model to a Cloud Storage path\n",
|
||||
"- Clean up the created resources"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "34d623e6dfa3"
|
||||
},
|
||||
"source": [
|
||||
"## Dataset\n",
|
||||
"- Clean up the created resources\n",
|
||||
"\n",
|
||||
"This tutorial uses the `looker-private-demo.ecomm` dataset in BigQuery. The dataset consists of information about various advertisement campaigns including the demographics of users who have clicked and made some purchases after seeing the ads. For this tutorial, the top three campaigns from the USA are selected from this dataset and user information for those who have made purchases shall be used to train a model with the campaigns as the classes. The idea is to see if the advertisement and the user data can be used to identify which campaign is best-suited for the user.\n",
|
||||
"\n",
|
||||
"The dataset can be accessed by pinning the `looker-private-demo` project in BigQuery. If you are using Vertex AI Workbench managed notebooks instance, instead of going to the BigQuery user interface, this process can be performed from the JupyterLab user interface. Vertex AI Workbench managed notebooks instances support browsing through the datasets and tables from BigQuery through its BigQuery integration. \n",
|
||||
"\n",
|
||||
"<img src=\"images/Bigquery_UI_new.PNG\"></img>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "ee02650bb7fd"
|
||||
},
|
||||
"source": [
|
||||
"### Costs \n",
|
||||
"<a name=\"section-4\"></a>\n",
|
||||
"\n",
|
||||
"This tutorial uses billable components of Google Cloud:\n",
|
||||
"\n",
|
||||
@@ -121,121 +78,6 @@
|
||||
"to generate a cost estimate based on your projected usage."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "y320EIk-kXT7"
|
||||
},
|
||||
"source": [
|
||||
"### Set up your local development environment\n",
|
||||
"\n",
|
||||
"**If you are using Colab or Vertex AI Workbench Notebooks**, your environment already meets\n",
|
||||
"all the requirements to run this notebook. You can skip this step.\n",
|
||||
"\n",
|
||||
"**Otherwise**, make sure your environment meets this notebook's requirements.\n",
|
||||
"You need the following:\n",
|
||||
"\n",
|
||||
"* The Google Cloud SDK\n",
|
||||
"* Git\n",
|
||||
"* Python 3\n",
|
||||
"* virtualenv\n",
|
||||
"* Jupyter notebook running in a virtual environment with Python 3\n",
|
||||
"\n",
|
||||
"The Google Cloud guide to [Setting up a Python development\n",
|
||||
"environment](https://cloud.google.com/python/setup) and the [Jupyter\n",
|
||||
"installation guide](https://jupyter.org/install) provide detailed instructions\n",
|
||||
"for meeting these requirements. The following steps provide a condensed set of\n",
|
||||
"instructions:\n",
|
||||
"\n",
|
||||
"1. [Install and initialize the Cloud SDK.](https://cloud.google.com/sdk/docs/)\n",
|
||||
"\n",
|
||||
"1. [Install Python 3.](https://cloud.google.com/python/setup#installing_python)\n",
|
||||
"\n",
|
||||
"1. [Install\n",
|
||||
" virtualenv](https://cloud.google.com/python/setup#installing_and_using_virtualenv)\n",
|
||||
" and create a virtual environment that uses Python 3. Activate the virtual environment.\n",
|
||||
"\n",
|
||||
"1. To install Jupyter, run `pip3 install jupyter` on the\n",
|
||||
"command-line in a terminal shell.\n",
|
||||
"\n",
|
||||
"1. To launch Jupyter, run `jupyter notebook` on the command-line in a terminal shell.\n",
|
||||
"\n",
|
||||
"1. Open this notebook in the Jupyter Notebook Dashboard."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "1DouUvNOkXT8"
|
||||
},
|
||||
"source": [
|
||||
"### Install additional packages\n"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "Ayt1jhFXkXT9"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import os\n",
|
||||
"\n",
|
||||
"# The Vertex AI Workbench Notebook product has specific requirements\n",
|
||||
"IS_WORKBENCH_NOTEBOOK = os.getenv(\"DL_ANACONDA_HOME\")\n",
|
||||
"IS_USER_MANAGED_WORKBENCH_NOTEBOOK = os.path.exists(\n",
|
||||
" \"/opt/deeplearning/metadata/env_version\"\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"# Vertex AI Notebook requires dependencies to be installed with '--user'\n",
|
||||
"USER_FLAG = \"\"\n",
|
||||
"if IS_WORKBENCH_NOTEBOOK:\n",
|
||||
" USER_FLAG = \"--user\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "95826791kXT_"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip3 install {USER_FLAG} --upgrade pandas-gbq 'google-cloud-bigquery[bqstorage,pandas]' tensorflow sklearn protobuf==3.20.1 -q \\\n",
|
||||
" "
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "aNeMRbpukXUA"
|
||||
},
|
||||
"source": [
|
||||
"### Restart the kernel\n",
|
||||
"\n",
|
||||
"After you install the additional packages, you need to restart the notebook kernel so it can find the packages."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "dJ_yvi_9kXUB"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Automatically restart kernel after installs\n",
|
||||
"import os\n",
|
||||
"\n",
|
||||
"if not os.getenv(\"IS_TESTING\"):\n",
|
||||
" # Automatically restart kernel after installs\n",
|
||||
" import IPython\n",
|
||||
"\n",
|
||||
" app = IPython.Application.instance()\n",
|
||||
" app.kernel.do_shutdown(True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -255,67 +97,34 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "5bf9979b96ff"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if PROJECT_ID == \"\" or PROJECT_ID is None or PROJECT_ID == \"[your-project-id]\":\n",
|
||||
" # Get your GCP project id from gcloud\n",
|
||||
" shell_output = ! gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
"PROJECT_ID = \"\"\n",
|
||||
"\n",
|
||||
"# Get your Google Cloud project ID from gcloud\n",
|
||||
"if not os.getenv(\"IS_TESTING\"):\n",
|
||||
" shell_output=!gcloud config list --format 'value(core.project)' 2>/dev/null\n",
|
||||
" PROJECT_ID = shell_output[0]\n",
|
||||
" print(\"Project ID:\", PROJECT_ID)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "07-xo93jlC6l"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gcloud config set project $PROJECT_ID"
|
||||
" print(\"Project ID: \", PROJECT_ID)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "03d8d65b914d"
|
||||
"id": "d0058f55f8cf"
|
||||
},
|
||||
"source": [
|
||||
"#### Region\n",
|
||||
"\n",
|
||||
"You can also change the `REGION` variable, which is used for operations\n",
|
||||
"throughout the rest of this notebook. Below are regions supported for Vertex AI. We recommend that you choose the region closest to you.\n",
|
||||
"\n",
|
||||
"- Americas: `us-central1`\n",
|
||||
"- Europe: `europe-west4`\n",
|
||||
"- Asia Pacific: `asia-east1`\n",
|
||||
"\n",
|
||||
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
|
||||
"\n",
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
|
||||
"Otherwise, set your project ID here."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "3281bedf6d3c"
|
||||
"id": "19579640c063"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
|
||||
"\n",
|
||||
"if REGION == \"[your-region]\":\n",
|
||||
" REGION = \"us-central1\""
|
||||
"if PROJECT_ID == \"\" or PROJECT_ID is None:\n",
|
||||
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -342,74 +151,6 @@
|
||||
"TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "OoPGk5KOkXUG"
|
||||
},
|
||||
"source": [
|
||||
"### Authenticate your Google Cloud account\n",
|
||||
"\n",
|
||||
"**If you are using Vertex AI Workbench Notebooks**, your environment is already\n",
|
||||
"authenticated. Skip this step.\n",
|
||||
"\n",
|
||||
"**If you are using Colab**, run the cell below and follow the instructions\n",
|
||||
"when prompted to authenticate your account via oAuth.\n",
|
||||
"\n",
|
||||
"**Otherwise**, follow these steps:\n",
|
||||
"\n",
|
||||
"1. In the Cloud Console, go to the [**Create service account key**\n",
|
||||
" page](https://console.cloud.google.com/apis/credentials/serviceaccountkey).\n",
|
||||
"\n",
|
||||
"2. Click **Create service account**.\n",
|
||||
"\n",
|
||||
"3. In the **Service account name** field, enter a name, and\n",
|
||||
" click **Create**.\n",
|
||||
"\n",
|
||||
"4. In the **Grant this service account access to project** section, click the **Role** drop-down list. Type \"Vertex AI\"\n",
|
||||
"into the filter box, and select\n",
|
||||
" **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
|
||||
"\n",
|
||||
"5. Click *Create*. A JSON file that contains your key downloads to your\n",
|
||||
"local environment.\n",
|
||||
"\n",
|
||||
"6. Enter the path to your service account key as the\n",
|
||||
"`GOOGLE_APPLICATION_CREDENTIALS` variable in the cell below and run the cell."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "Teyy6LGqkXUG"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If on Vertex AI Workbench, then don't execute this code\n",
|
||||
"IS_COLAB = \"google.colab\" in sys.modules\n",
|
||||
"if not os.path.exists(\"/opt/deeplearning/metadata/env_version\") and not os.getenv(\n",
|
||||
" \"DL_ANACONDA_HOME\"\n",
|
||||
"):\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" from google.colab import auth as google_auth\n",
|
||||
"\n",
|
||||
" google_auth.authenticate_user()\n",
|
||||
"\n",
|
||||
" # If you are running this notebook locally, replace the string below with the\n",
|
||||
" # path to your service account key and run this cell to authenticate your GCP\n",
|
||||
" # account.\n",
|
||||
" elif not os.getenv(\"IS_TESTING\"):\n",
|
||||
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
@@ -420,8 +161,20 @@
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"When you submit a training job using the Cloud SDK, you upload a Python package\n",
|
||||
"containing your training code to a Cloud Storage bucket. Vertex AI runs\n",
|
||||
"the code from this package. In this tutorial, Vertex AI also saves the\n",
|
||||
"trained model that results from your job in the same bucket. Using this model artifact, you can then\n",
|
||||
"create Vertex AI model and endpoint resources in order to serve\n",
|
||||
"online predictions.\n",
|
||||
"\n",
|
||||
"Set the name of your Cloud Storage bucket below. It must be unique across all\n",
|
||||
"Cloud Storage buckets.\n"
|
||||
"Cloud Storage buckets.\n",
|
||||
"\n",
|
||||
"You may also change the `REGION` variable, which is used for operations\n",
|
||||
"throughout the rest of this notebook. Make sure to [choose a region where Vertex AI services are\n",
|
||||
"available](https://cloud.google.com/vertex-ai/docs/general/locations#available_regions). You may\n",
|
||||
"not use a Multi-Regional Storage bucket for training with Vertex AI."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -432,8 +185,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
|
||||
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
|
||||
"BUCKET_NAME = \"gs://[your-bucket-name]\" # @param {type:\"string\"}\n",
|
||||
"REGION = \"[your-region]\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -444,9 +197,8 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
|
||||
" BUCKET_URI = f\"gs://{BUCKET_NAME}\""
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME is None or BUCKET_NAME == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = \"gs://\" + PROJECT_ID + \"aip-\" + TIMESTAMP"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -466,7 +218,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil mb -l $REGION $BUCKET_URI"
|
||||
"! gsutil mb -l $REGION $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -486,36 +238,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "bmnMD2MjkXUJ"
|
||||
},
|
||||
"source": [
|
||||
"### Import libraries and define constants"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "oqtZRqDEkXUJ"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import warnings\n",
|
||||
"\n",
|
||||
"import pandas as pd\n",
|
||||
"from sklearn.model_selection import train_test_split\n",
|
||||
"from sklearn.preprocessing import StandardScaler\n",
|
||||
"from tensorflow.keras import Sequential\n",
|
||||
"from tensorflow.keras.layers import Dense\n",
|
||||
"from tensorflow.keras.utils import to_categorical\n",
|
||||
"\n",
|
||||
"warnings.filterwarnings(\"ignore\")"
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -526,16 +249,8 @@
|
||||
"source": [
|
||||
"## Tutorial\n",
|
||||
"\n",
|
||||
"### Fetch the data from BigQuery \n"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5c07be8840ae"
|
||||
},
|
||||
"source": [
|
||||
"If you are using ***Vertex AI Workbench managed notebooks instance***, below cell which starts with \"#@bigquery\" will be a SQL Query. If you are using Vertex AI Workbench user managed notebooks instance or Colab it will be a markdown cell."
|
||||
"### Fetch the data from BigQuery \n",
|
||||
"<a name=\"section-5\"></a>"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -616,7 +331,7 @@
|
||||
"id": "923fdd823683"
|
||||
},
|
||||
"source": [
|
||||
"If you are using Vertex AI Workbench managed notebooks instance, once the results from BigQuery are displayed in the above cell, click the **Query and load as DataFrame** button and execute the generated code stub to fetch the data into the current notebook as a dataframe.\n",
|
||||
"Once the results from BigQuery are displayed in the above cell, click the **Query and load as DataFrame** button and execute the generated code stub to fetch the data into the current notebook as a dataframe.\n",
|
||||
"\n",
|
||||
"*Note: By default the data is loaded into a `df` variable, though this can be changed before executing the cell if required.*"
|
||||
]
|
||||
@@ -633,7 +348,7 @@
|
||||
"# Comment out otherwise for speed-up.\n",
|
||||
"from google.cloud.bigquery import Client\n",
|
||||
"\n",
|
||||
"client = Client(project=PROJECT_ID)\n",
|
||||
"client = Client()\n",
|
||||
"\n",
|
||||
"query = \"\"\"WITH traindata AS (\n",
|
||||
"SELECT b.* except(ad_event_id, user_id), c.* except(id), d.* except(keyword_id, ad_id), a.amount, a.device_type, e.name\n",
|
||||
@@ -664,6 +379,44 @@
|
||||
},
|
||||
"source": [
|
||||
"### Preprocess the data\n",
|
||||
"<a name=\"section-6\"></a>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "e8503e799eec"
|
||||
},
|
||||
"source": [
|
||||
"Import the required libraries."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "5b11973ccf76"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import warnings\n",
|
||||
"\n",
|
||||
"import pandas as pd\n",
|
||||
"from sklearn.model_selection import train_test_split\n",
|
||||
"from sklearn.preprocessing import StandardScaler\n",
|
||||
"from tensorflow.keras import Sequential\n",
|
||||
"from tensorflow.keras.layers import Dense\n",
|
||||
"from tensorflow.keras.utils import to_categorical\n",
|
||||
"\n",
|
||||
"warnings.filterwarnings(\"ignore\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "e48d156d8bb6"
|
||||
},
|
||||
"source": [
|
||||
"Select the necessary columns from the E-commerce data and divide them based on their type (numerical/categorical)."
|
||||
]
|
||||
},
|
||||
@@ -688,22 +441,13 @@
|
||||
"num_cols = [\"age\", \"cpc_bid_amount\", \"quality_score\", \"amount\"]"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9bd71de0d37e"
|
||||
},
|
||||
"source": [
|
||||
"#### Select top three campaigns"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "ace612851261"
|
||||
},
|
||||
"source": [
|
||||
"From the current dataset, only the top three campaigns will be chosen to target the users. All the relevant information about the advertisement and the user who purchased an item after seeing the advertisement is available in the dataframe already. "
|
||||
"From the current dataset, only the top three camapigns will be chosen to target the users. All the relevant information about the advertisement and the user who purchased an item after seeing the advertisement is available in the dataframe already. "
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -737,22 +481,13 @@
|
||||
"df[\"name\"] = df[\"name\"].map({\"Tops & Tees\": 0, \"Active\": 1, \"Accessories\": 2})"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "c2d5338b1b95"
|
||||
},
|
||||
"source": [
|
||||
"#### One-hot encode the categorical variables"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "8902f763d1ca"
|
||||
},
|
||||
"source": [
|
||||
"After one-hot encoding, the first level-column is dropped to avoid the [dummy-variable trap](https://en.wikipedia.org/wiki/Dummy_variable_(statistics)) scenario. This process is called *dummy-encoding*."
|
||||
"One-hot encode the categorical variables. After one-hot encoding, the first level-column is dropped to avoid the [dummy-variable trap](https://en.wikipedia.org/wiki/Dummy_variable_(statistics)) scenario. This process is called *dummy-encoding*."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -786,7 +521,7 @@
|
||||
"id": "3abf027eda2d"
|
||||
},
|
||||
"source": [
|
||||
"#### Split the data into train and test."
|
||||
"Split the data into train and test."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -811,7 +546,7 @@
|
||||
"id": "d1a32b9d9640"
|
||||
},
|
||||
"source": [
|
||||
"#### Scale the data."
|
||||
"Scale the data."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -834,7 +569,16 @@
|
||||
},
|
||||
"source": [
|
||||
"### Train a TensorFlow model\n",
|
||||
"#### Convert the target column to a categorical encoded colum (one-hot encoded)."
|
||||
"<a name=\"section-7\"></a>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "3e7656556a48"
|
||||
},
|
||||
"source": [
|
||||
"Convert the target column to a categorical encoded colum (one-hot encoded)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -855,7 +599,7 @@
|
||||
"id": "3dd0014a7e1d"
|
||||
},
|
||||
"source": [
|
||||
"#### Define hyperparameters for model training. \n",
|
||||
"Define hyperparameters for model training. \n",
|
||||
"\n",
|
||||
"*Note: Comment or remove the parameters from the following cell if they are provided already as an input parameter through the executor feature.*"
|
||||
]
|
||||
@@ -880,7 +624,7 @@
|
||||
"id": "406b731f576b"
|
||||
},
|
||||
"source": [
|
||||
"#### Define the architecture and compile the model."
|
||||
"Define the architecture and compile the model."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -920,7 +664,7 @@
|
||||
"id": "4ab12c34f258"
|
||||
},
|
||||
"source": [
|
||||
"#### Fit the model."
|
||||
"Fit the model."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -940,7 +684,8 @@
|
||||
"id": "51a2d0b52df3"
|
||||
},
|
||||
"source": [
|
||||
"### Run the model on test data\n"
|
||||
"### Run the model on test data\n",
|
||||
"<a name=\"section-8\"></a>"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -949,7 +694,7 @@
|
||||
"id": "f08445f2cd02"
|
||||
},
|
||||
"source": [
|
||||
"#### Evaluate the model on test data."
|
||||
"Evaluate the model on test data."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -964,24 +709,16 @@
|
||||
"print(f\"Test results - Loss: {test_results}\")"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "81ef0e081340"
|
||||
},
|
||||
"source": [
|
||||
"**Please note that executor feature is available only in Vertex AI Workbench managed notebooks**"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9769168778e8"
|
||||
},
|
||||
"source": [
|
||||
"### Automating the execution of the notebook using executor in Vertex AI Workbench managed notebooks instance\n",
|
||||
"### Automating the execution of the notebook using executor\n",
|
||||
"<a name=\"section-9\"></a>\n",
|
||||
"\n",
|
||||
"If you are using Vertex AI Workbench managed notebooks instance, the executor can help you run a notebook file from start to end, with your choice of the environment, machine type, input parameters, and other characteristics. After setting up an execution, the notebook is executed as a job in Vertex AI custom training. Your jobs can be monitored from the <b>Notebook Executor</b> pane in the menu on the left.\n",
|
||||
"The executor can help you run a notebook file from start to end, with your choice of the environment, machine type, input parameters, and other characteristics. After setting up an execution, the notebook is executed as a job in Vertex AI custom training. Your jobs can be monitored from the <b>Notebook Executor</b> pane in the menu on the left.\n",
|
||||
"\n",
|
||||
"<img src=\"images/executor.png\"></img>\n",
|
||||
"\n",
|
||||
@@ -994,9 +731,10 @@
|
||||
"id": "cf486c351581"
|
||||
},
|
||||
"source": [
|
||||
"### Scheduled runs on executor in Vertex AI Workbench managed notebooks instance\n",
|
||||
"### Scheduled runs on executor\n",
|
||||
"<a name=\"section-10\"></a>\n",
|
||||
"\n",
|
||||
"Vertex AI Workbench managed noteboook runs can also be scheduled recurringly with the executor. To do so, select <b>Schedule-based recurring executions</b> as the run type instead of <b>One-time execution</b>. The frequency of the job and the time when it executes is provided when you create the execution.\n",
|
||||
"Notebook runs can also be scheduled recurringly with the executor. To do so, select <b>Schedule-based recurring executions</b> as the run type instead of <b>One-time execution</b>. The frequency of the job and the time when it executes is provided when you create the execution.\n",
|
||||
"\n",
|
||||
"<img src=\"images/executor_scheduled_runs2.png\"></img>"
|
||||
]
|
||||
@@ -1008,8 +746,9 @@
|
||||
},
|
||||
"source": [
|
||||
"### Parameterizing the variables\n",
|
||||
"<a name=\"section-11\"></a>\n",
|
||||
"\n",
|
||||
"If you are using Vertex AI Workbench managed notebooks instance, executor lets you run a notebook with different sets of input parameters. If required, constants in the notebook can be treated as arguments to a function, and when you submit the execution, you can provide those constants as input parameters.\n",
|
||||
"Executor lets you run a notebook with different sets of input parameters. If required, constants in the notebook can be treated as arguments to a function, and when you submit the execution, you can provide those constants as input parameters.\n",
|
||||
"\n",
|
||||
"<img src=\"images/executor_input_parameters.png\"></img>\n",
|
||||
"\n",
|
||||
@@ -1023,6 +762,7 @@
|
||||
},
|
||||
"source": [
|
||||
"### Save the model to a Cloud Storage path\n",
|
||||
"<a name=\"section-12\"></a>\n",
|
||||
"\n",
|
||||
"TensorFlow's `model.save()` method supports Cloud Storage paths as well as the local file paths while writing the model object to a file. It needs to be ensured that the service account being used to run this notebook has `write` permissions to the specified Cloud Storage path."
|
||||
]
|
||||
@@ -1035,7 +775,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"GCS_PATH = BUCKET_URI + \"/path-to-save/\"\n",
|
||||
"GCS_PATH = \"gs://\" + BUCKET_NAME + \"/[path-to-save]/\"\n",
|
||||
"model.save(GCS_PATH)"
|
||||
]
|
||||
},
|
||||
@@ -1046,6 +786,7 @@
|
||||
},
|
||||
"source": [
|
||||
"## Clean up\n",
|
||||
"<a name=\"section-13\"></a>\n",
|
||||
"\n",
|
||||
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
|
||||
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
|
||||
@@ -1061,11 +802,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Delete the Cloud Storage bucket\n",
|
||||
"\n",
|
||||
"delete_bucket = False\n",
|
||||
"if delete_bucket or os.getenv(\"IS_TESTING\"):\n",
|
||||
" ! gsutil -m rm -r $BUCKET_URI"
|
||||
"! gsutil -m rm -r [cloud-storage-folder-path-to-delete]"
|
||||
]
|
||||
}
|
||||
],
|
||||
@@ -1,80 +1,21 @@
|
||||
{
|
||||
"cells": [
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "c8c4e360024a"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Copyright 2022 Google LLC\n",
|
||||
"#\n",
|
||||
"# Licensed under the Apache License, Version 2.0 (the \"License\");\n",
|
||||
"# you may not use this file except in compliance with the License.\n",
|
||||
"# You may obtain a copy of the License at\n",
|
||||
"#\n",
|
||||
"# https://www.apache.org/licenses/LICENSE-2.0\n",
|
||||
"#\n",
|
||||
"# Unless required by applicable law or agreed to in writing, software\n",
|
||||
"# distributed under the License is distributed on an \"AS IS\" BASIS,\n",
|
||||
"# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.\n",
|
||||
"# See the License for the specific language governing permissions and\n",
|
||||
"# limitations under the License."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "d6728c7e34d2"
|
||||
},
|
||||
"source": [
|
||||
"<table align=\"left\">\n",
|
||||
"# Taxi fare prediction using chicago taxi-cab dataset\n",
|
||||
"\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://colab.research.google.com/github/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/workbench/chicago_taxi_fare_prediction/chicago_taxi_fare_prediction.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/colab-logo-32px.png\" alt=\"Colab logo\"> Run in Colab\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/workbench/chicago_taxi_fare_prediction/chicago_taxi_fare_prediction.ipynb\">\n",
|
||||
" <img src=\"https://cloud.google.com/ml-engine/images/github-logo-32px.png\" alt=\"GitHub logo\">\n",
|
||||
" View on GitHub\n",
|
||||
" </a>\n",
|
||||
" </td>\n",
|
||||
" <td>\n",
|
||||
" <a href=\"https://console.cloud.google.com/vertex-ai/workbench/deploy-notebook?download_url=https://github.com/GoogleCloudPlatform/vertex-ai-samples/blob/main/notebooks/official/workbench/chicago_taxi_fare_prediction/chicago_taxi_fare_prediction.ipynb\">\n",
|
||||
" <img src=\"https://lh3.googleusercontent.com/UiNooY4LUgW_oTvpsNhPpQzsstV5W8F7rYgxgGBD85cWJoLmrOzhVs_ksK_vgx40SHs7jCqkTkCk=e14-rj-sc0xffffff-h130-w32\" alt=\"Vertex AI logo\">\n",
|
||||
" Open in Vertex AI Workbench\n",
|
||||
" </a>\n",
|
||||
" </td> \n",
|
||||
"</table>"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "28451b7c3d4b"
|
||||
},
|
||||
"source": [
|
||||
"# Taxi fare prediction using the Chicago Taxi Trips dataset"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "eaf8ba4eeea8"
|
||||
},
|
||||
"source": [
|
||||
"## Table of contents\n",
|
||||
"\n",
|
||||
"* [Overview](#section-1)\n",
|
||||
"* [Dataset](#section-2)\n",
|
||||
"* [Objective](#section-3)\n",
|
||||
"* [Costs](#section-4)\n",
|
||||
"* [Data analysis](#section-5)\n",
|
||||
"* [Fit a simple linear regression model](#section-6)\n",
|
||||
"* [Save the model and upload to a Cloud Storage bucket](#section-7)\n",
|
||||
"* [Save the model and upload to a GCS bucket](#section-7)\n",
|
||||
"* [Deploy the model on Vertex AI with support for Vertex Explainable AI](#section-8)\n",
|
||||
"* [Get explanations from the deployed model](#section-9)\n",
|
||||
"* [Clean up](#section-10)\n",
|
||||
@@ -82,23 +23,23 @@
|
||||
"## Overview\n",
|
||||
"<a name=\"section-1\"></a>\n",
|
||||
"\n",
|
||||
"This notebook demonstrates analysis, feature selection, model building, and deployment with Explainable AI configured on Vertex AI, using a subset of the Chicago Taxi Trips dataset for taxi-fare prediction.\n",
|
||||
"This notebooks demonstrates analysis, feature selection, model building and deployment with Vertex Explainable AI configured on Vertex AI on a subset of the Chicago Taxi-cab dataset for Taxi-fare prediction problem.\n",
|
||||
"\n",
|
||||
"*Note: This notebook is developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python (Local) kernel. Some components of this notebook may not work in other notebook environments.*\n",
|
||||
"Note: This notebook file was developed to run in a [Vertex AI Workbench managed notebooks](https://console.cloud.google.com/vertex-ai/workbench/list/managed) instance using the Python(Local) kernel. Some components of this notebook may not work in other notebook environments.\n",
|
||||
"\n",
|
||||
"## Dataset\n",
|
||||
"<a name=\"section-2\"></a>\n",
|
||||
"\n",
|
||||
"The Chicago Taxi Trips dataset includes taxi trips from 2013 to the present, reported to the city of Chicago in its role as a regulatory agency. To protect privacy but allow for aggregate analyses, the taxi ID is consistent for any given taxi medallion number but does not show the number, census tracts are suppressed in some cases, and times are rounded to the nearest 15 minutes. Due to the data reporting process, not all trips are reported but the city believes that most are. This dataset is publicly available on BigQuery as a public dataset with the table ID `bigquery-public-data.chicago_taxi_trips.taxi_trips` and also as a public dataset on Kaggle at [Chicago Taxi Trips](https://www.kaggle.com/chicago/chicago-taxi-trips-bq).\n",
|
||||
"The Chicago Taxi-cab dataset includes taxi trips from 2013 to the present, reported to the City of Chicago in its role as a regulatory agency. To protect privacy but allow for aggregate analyses, the Taxi ID is consistent for any given taxi medallion number but does not show the number, Census Tracts are suppressed in some cases, and times are rounded to the nearest 15 minutes. Due to the data reporting process, not all trips are reported but the City believes that most are. This dataset is publicly available on Bigquery under the public datasets with the Table ID : `bigquery-public-data.chicago_taxi_trips.taxi_trips` and also as public dataset on Kaggle Datasets at : [Chicago Taxi Trips Dataset](https://www.kaggle.com/chicago/chicago-taxi-trips-bq).\n",
|
||||
"\n",
|
||||
"For more information about this dataset and how it was created, see the [Chicago Digital website](http://digital.cityofchicago.org/index.php/chicago-taxi-data-released).\n",
|
||||
" For more information about this dataset and how it was created, please refer [Chicago Digital website](http://digital.cityofchicago.org/index.php/chicago-taxi-data-released).\n",
|
||||
"\n",
|
||||
"## Objective\n",
|
||||
"<a name=\"section-3\"></a>\n",
|
||||
"\n",
|
||||
"The goal of this notebook is to provide an overview on the latest Vertex AI features like **Explainable AI** and **BigQuery in Notebooks** by trying to solve a taxi fare prediction problem. The steps followed in this notebook include: \n",
|
||||
"The goal of this notebook is to provide an overview on the latest Vertex AI features like Explainable AI and Bigquery in Notebook by trying to solve a Taxi-fare prediction problem. The steps followed in this notebook include : \n",
|
||||
"\n",
|
||||
"- Loading the dataset using \"BigQuery in Notebooks\".\n",
|
||||
"- Loading the dataset using `Bigquery in Notebooks`.\n",
|
||||
"- Performing exploratory data analysis on the dataset.\n",
|
||||
"- Feature selection and preprocessing.\n",
|
||||
"- Building a linear regression model using scikit-learn.\n",
|
||||
@@ -113,173 +54,22 @@
|
||||
"This tutorial uses the following billable components of Google Cloud:\n",
|
||||
"\n",
|
||||
"- Vertex AI\n",
|
||||
"- BigQuery\n",
|
||||
"- Bigquery\n",
|
||||
"- Cloud Storage\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"Learn about [Vertex AI\n",
|
||||
"pricing](https://cloud.google.com/vertex-ai/pricing), [BigQuery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
|
||||
"pricing](https://cloud.google.com/vertex-ai/pricing), [Bigquery pricing](https://cloud.google.com/bigquery/pricing) and [Cloud Storage\n",
|
||||
"pricing](https://cloud.google.com/storage/pricing), and use the [Pricing\n",
|
||||
"Calculator](https://cloud.google.com/products/calculator/)\n",
|
||||
"to generate a cost estimate based on your projected usage."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5178273783dd"
|
||||
},
|
||||
"source": [
|
||||
"### Set up your local development environment\n",
|
||||
"\n",
|
||||
"**If you are using Colab or Google Cloud Notebooks**, your environment already meets\n",
|
||||
"all the requirements to run this notebook. You can skip this step."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "f5494c42606e"
|
||||
},
|
||||
"source": [
|
||||
"**Otherwise**, make sure your environment meets this notebook's requirements.\n",
|
||||
"You need the following:\n",
|
||||
"\n",
|
||||
"* The Google Cloud SDK\n",
|
||||
"* Git\n",
|
||||
"* Python 3\n",
|
||||
"* virtualenv\n",
|
||||
"* Jupyter notebook running in a virtual environment with Python 3\n",
|
||||
"\n",
|
||||
"The Google Cloud guide to [Setting up a Python development\n",
|
||||
"environment](https://cloud.google.com/python/setup) and the [Jupyter\n",
|
||||
"installation guide](https://jupyter.org/install) provide detailed instructions\n",
|
||||
"for meeting these requirements. The following steps provide a condensed set of\n",
|
||||
"instructions:\n",
|
||||
"\n",
|
||||
"1. [Install and initialize the Cloud SDK.](https://cloud.google.com/sdk/docs/)\n",
|
||||
"\n",
|
||||
"1. [Install Python 3.](https://cloud.google.com/python/setup#installing_python)\n",
|
||||
"\n",
|
||||
"1. [Install\n",
|
||||
" virtualenv](https://cloud.google.com/python/setup#installing_and_using_virtualenv)\n",
|
||||
" and create a virtual environment that uses Python 3. Activate the virtual environment.\n",
|
||||
"\n",
|
||||
"1. To install Jupyter, run `pip3 install jupyter` on the\n",
|
||||
"command-line in a terminal shell.\n",
|
||||
"\n",
|
||||
"1. To launch Jupyter, run `jupyter notebook` on the command-line in a terminal shell.\n",
|
||||
"\n",
|
||||
"1. Open this notebook in the Jupyter Notebook Dashboard."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "23976b1be293"
|
||||
},
|
||||
"source": [
|
||||
"### Install additional packages"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "1fd00fa70a2a"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import os\n",
|
||||
"\n",
|
||||
"# The Google Cloud Notebook product has specific requirements\n",
|
||||
"IS_GOOGLE_CLOUD_NOTEBOOK = os.path.exists(\"/opt/deeplearning/metadata/env_version\")\n",
|
||||
"\n",
|
||||
"# Google Cloud Notebook requires dependencies to be installed with '--user'\n",
|
||||
"USER_FLAG = \"\"\n",
|
||||
"if IS_GOOGLE_CLOUD_NOTEBOOK:\n",
|
||||
" USER_FLAG = \"--user\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a50fd443a6ce"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! pip install {USER_FLAG} --upgrade google-cloud-bigquery \\\n",
|
||||
" google-cloud-aiplatform \\\n",
|
||||
" google-cloud-storage \\\n",
|
||||
" seaborn \\\n",
|
||||
" sklearn \\\n",
|
||||
" pandas \\\n",
|
||||
" fsspec \\\n",
|
||||
" pyarrow"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "d3a26cb9b19d"
|
||||
},
|
||||
"source": [
|
||||
"### Restart the kernel\n",
|
||||
"\n",
|
||||
"After you install the additional packages, you need to restart the notebook kernel so it can find the packages."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "c1464805870e"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Automatically restart kernel after installs\n",
|
||||
"import os\n",
|
||||
"\n",
|
||||
"if not os.getenv(\"IS_TESTING\"):\n",
|
||||
" # Automatically restart kernel after installs\n",
|
||||
" import IPython\n",
|
||||
"\n",
|
||||
" app = IPython.Application.instance()\n",
|
||||
" app.kernel.do_shutdown(True)"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5ed1f5e85640"
|
||||
},
|
||||
"source": [
|
||||
"## Before you begin\n",
|
||||
"\n",
|
||||
"### Set up your Google Cloud project\n",
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"1. [Select or create a Google Cloud project](https://console.cloud.google.com/cloud-resource-manager). When you first create an account, you get a $300 free credit towards your compute/storage costs.\n",
|
||||
"\n",
|
||||
"1. [Make sure that billing is enabled for your project](https://cloud.google.com/billing/docs/how-to/modify-project).\n",
|
||||
"\n",
|
||||
"1. [Enable the Vertex AI API](https://console.cloud.google.com/flows/enableapi?apiid=aiplatform.googleapis.com).\n",
|
||||
"\n",
|
||||
"1. If you are running this notebook locally, you will need to install the [Cloud SDK](https://cloud.google.com/sdk).\n",
|
||||
"\n",
|
||||
"1. Enter your project ID in the cell below. Then run the cell to make sure the\n",
|
||||
"Cloud SDK uses the right project for all the commands in this notebook.\n",
|
||||
"\n",
|
||||
"**Note**: Jupyter runs lines prefixed with `!` as shell commands, and it interpolates Python variables prefixed with `$` into these commands."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "5aee4379e8e5"
|
||||
},
|
||||
"source": [
|
||||
"#### Set your project ID\n",
|
||||
"\n",
|
||||
@@ -294,8 +84,6 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import os\n",
|
||||
"\n",
|
||||
"PROJECT_ID = \"\"\n",
|
||||
"\n",
|
||||
"# Get your Google Cloud project ID from gcloud\n",
|
||||
@@ -326,175 +114,17 @@
|
||||
" PROJECT_ID = \"[your-project-id]\" # @param {type:\"string\"}"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "30e64c0eda41"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gcloud config set project $PROJECT_ID"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "7d43ac19ea91"
|
||||
"id": "fed4b24ea061"
|
||||
},
|
||||
"source": [
|
||||
"### Region\n",
|
||||
"## Select or Create Cloud Storage Bucket for storing the model\n",
|
||||
"\n",
|
||||
"You can also change the `REGION` variable, which is used for operations\n",
|
||||
"throughout the rest of this notebook. Below are regions supported for Vertex AI. We recommend that you choose the region closest to you.\n",
|
||||
"When you create a model resource on Vertex AI using the Cloud SDK, you need to give a Cloud Storage bucket uri of the model where the model is stored. Using the model saved, you can then create Vertex AI model and endpoint resources in order to serve online predictions.\n",
|
||||
"\n",
|
||||
"- Americas: `us-central1`\n",
|
||||
"- Europe: `europe-west4`\n",
|
||||
"- Asia Pacific: `asia-east1`\n",
|
||||
"\n",
|
||||
"You may not use a multi-regional bucket for training with Vertex AI. Not all regions provide support for all Vertex AI services.\n",
|
||||
"\n",
|
||||
"Learn more about [Vertex AI regions](https://cloud.google.com/vertex-ai/docs/general/locations)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "3281bedf6d3c"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"REGION = \"[your-region]\" # @param {type: \"string\"}\n",
|
||||
"\n",
|
||||
"if REGION == \"[your-region]\":\n",
|
||||
" REGION = \"us-central1\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "0c9906f72b18"
|
||||
},
|
||||
"source": [
|
||||
"### UUID\n",
|
||||
"\n",
|
||||
"If you are in a live tutorial session, you might be using a shared test account or project. To avoid name collisions between users on resources created, you create a uuid for each instance session, and append it onto the name of resources you create in this tutorial."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "8940c46120e6"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import random\n",
|
||||
"import string\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"# Generate a uuid of length 8\n",
|
||||
"def generate_uuid():\n",
|
||||
" return \"\".join(random.choices(string.ascii_lowercase + string.digits, k=8))\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"UUID = generate_uuid()"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "648aa9824ac6"
|
||||
},
|
||||
"source": [
|
||||
"### Authenticate your Google Cloud account\n",
|
||||
"\n",
|
||||
"**If you are using Google Cloud Notebooks**, your environment is already\n",
|
||||
"authenticated. Skip this step."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "fc52bba17ee3"
|
||||
},
|
||||
"source": [
|
||||
"**If you are using Colab**, run the cell below and follow the instructions\n",
|
||||
"when prompted to authenticate your account via oAuth.\n",
|
||||
"\n",
|
||||
"**Otherwise**, follow these steps:\n",
|
||||
"\n",
|
||||
"1. In the Cloud Console, go to the [**Create service account key**\n",
|
||||
" page](https://console.cloud.google.com/apis/credentials/serviceaccountkey).\n",
|
||||
"\n",
|
||||
"2. Click **Create service account**.\n",
|
||||
"\n",
|
||||
"3. In the **Service account name** field, enter a name, and\n",
|
||||
" click **Create**.\n",
|
||||
"\n",
|
||||
"4. In the **Grant this service account access to project** section, click the **Role** drop-down list. Type \"Vertex AI\"\n",
|
||||
"into the filter box, and select\n",
|
||||
" **Vertex AI Administrator**. Type \"Storage Object Admin\" into the filter box, and select **Storage Object Admin**.\n",
|
||||
"\n",
|
||||
"5. Click *Create*. A JSON file that contains your key downloads to your\n",
|
||||
"local environment.\n",
|
||||
"\n",
|
||||
"6. Enter the path to your service account key as the\n",
|
||||
"`GOOGLE_APPLICATION_CREDENTIALS` variable in the cell below and run the cell."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "535223fa4b84"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"import os\n",
|
||||
"import sys\n",
|
||||
"\n",
|
||||
"# If you are running this notebook in Colab, run this cell and follow the\n",
|
||||
"# instructions to authenticate your GCP account. This provides access to your\n",
|
||||
"# Cloud Storage bucket and lets you submit training jobs and prediction\n",
|
||||
"# requests.\n",
|
||||
"\n",
|
||||
"# The Google Cloud Notebook product has specific requirements\n",
|
||||
"IS_GOOGLE_CLOUD_NOTEBOOK = os.path.exists(\"/opt/deeplearning/metadata/env_version\")\n",
|
||||
"\n",
|
||||
"# If on Google Cloud Notebooks, then don't execute this code\n",
|
||||
"if not IS_GOOGLE_CLOUD_NOTEBOOK:\n",
|
||||
" if \"google.colab\" in sys.modules:\n",
|
||||
" from google.colab import auth as google_auth\n",
|
||||
"\n",
|
||||
" google_auth.authenticate_user()\n",
|
||||
"\n",
|
||||
" # If you are running this notebook locally, replace the string below with the\n",
|
||||
" # path to your service account key and run this cell to authenticate your GCP\n",
|
||||
" # account.\n",
|
||||
" elif not os.getenv(\"IS_TESTING\"):\n",
|
||||
" %env GOOGLE_APPLICATION_CREDENTIALS ''"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "0474cb91d91f"
|
||||
},
|
||||
"source": [
|
||||
"### Create a Cloud Storage bucket\n",
|
||||
"\n",
|
||||
"**The following steps are required, regardless of your notebook environment.**\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"When you create a model in Vertex AI using the Cloud SDK, you give a Cloud Storage path where the trained model is saved. \n",
|
||||
"In this tutorial, Vertex AI saves the trained model to a Cloud Storage bucket. Using this model artifact, you can then\n",
|
||||
"create Vertex AI model and endpoint resources in order to serve\n",
|
||||
"online predictions.\n",
|
||||
"\n",
|
||||
"Set the name of your Cloud Storage bucket below. It must be unique across all\n",
|
||||
"Cloud Storage buckets."
|
||||
"Set the name of your Cloud Storage bucket below. It must be unique across all Cloud Storage buckets.You may also change the REGION variable, which is used for operations throughout the rest of this notebook. Make sure to choose a region where Vertex AI services are available."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -505,8 +135,9 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"BUCKET_NAME = \"[your-bucket-name]\" # @param {type:\"string\"}\n",
|
||||
"BUCKET_URI = f\"gs://{BUCKET_NAME}\""
|
||||
"BUCKET_NAME = \"[your-bucket-name]\"\n",
|
||||
"BUCKET_URI = f\"gs://{BUCKET_NAME}\"\n",
|
||||
"LOCATION = \"us-central1\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -517,8 +148,11 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"if BUCKET_URI == \"\" or BUCKET_URI is None or BUCKET_URI == \"gs://[your-bucket-name]\":\n",
|
||||
" BUCKET_NAME = PROJECT_ID + \"aip-\" + UUID\n",
|
||||
"# Set a default bucketname in case bucket name is not given\n",
|
||||
"if BUCKET_NAME == \"\" or BUCKET_NAME == \"[your-bucket-name]\" or BUCKET_NAME is None:\n",
|
||||
"\n",
|
||||
" TIMESTAMP = datetime.now().strftime(\"%Y%m%d%H%M%S\")\n",
|
||||
" BUCKET_NAME = PROJECT_ID + \"aip-\" + TIMESTAMP\n",
|
||||
" BUCKET_URI = \"gs://\" + BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
@@ -531,6 +165,15 @@
|
||||
"<b>Only if your bucket doesn't already exist</b>: Run the following cell to create your Cloud Storage bucket."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "95702536e547"
|
||||
},
|
||||
"source": [
|
||||
"## Import the required libraries and define constants"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
@@ -539,7 +182,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil mb -l $REGION $BUCKET_URI"
|
||||
"! gsutil mb -l $REGION $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -559,16 +202,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"! gsutil ls -al $BUCKET_URI"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "2e52fd6d4854"
|
||||
},
|
||||
"source": [
|
||||
"### Import libraries"
|
||||
"! gsutil ls -al $BUCKET_NAME"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -597,14 +231,12 @@
|
||||
"id": "5166f42557ad"
|
||||
},
|
||||
"source": [
|
||||
"The original dataset considered for this tutorial is a large and noisy one and so data from a specific date range will be used. Based on various online resources, the data from around May 2018 gave some really good results compared to the other date ranges. While there are also some complicated models proposed for the same problem, like considering the weather data, holidays and seasons, the current notebook only explores a simple linear regression model. Our main objective is to demonstrate the model deployment with Vertex Explainable AI configured on Vertex AI.\n",
|
||||
"The dataset is quite a large and noisy one and so data from a specific date range will be used. Based on various blogs and resources that are available online, many of them seem to have used the data from around May-2018 which gave some really good results compared to the other date ranges. While there are also some complicated research models propsed for the same problem like considering the weather data, holidays and seasons etc., the current notebook only explores a simple linear regression model as our main objective is to demonstrate the model deployment with Vertex Explainable AI configured on Vertex AI.\n",
|
||||
"\n",
|
||||
"## Accessing the data through BigQuery Integration\n",
|
||||
"\n",
|
||||
"The **BigQuery Integration for Notebooks** feature of Vertex AI Workbench managed notebooks lets you use BigQuery and its features from the notebook itself eliminating the need to switch between tabs everytime. For every cell in the notebook, there is an option for the BigQuery integration at the top right, and selecting it enables you to compose an SQL query that can be executed in BigQuery. \n",
|
||||
"\n",
|
||||
"The chosen dataset consists of the following fields:\n",
|
||||
"## Accessing the data through Bigquery in Notebooks\n",
|
||||
"`Bigquery in Notebooks` feature of Vertex AI's managed notebooks allows us to use Bigquery and its features from the notebook itself eliminating the need to switch between tabs everytime. For every cell in the notebook, there is an option for Bigquery integration at the top right selecting which would enable us to compose a SQL query that can be executed in Bigquery. \n",
|
||||
"\n",
|
||||
"The chosen dataset consists of the following fields :\n",
|
||||
"- `unique_key` : Unique identifier for the trip.\n",
|
||||
"- `taxi_id` : A unique identifier for the taxi.\n",
|
||||
"- `trip_start_timestamp`: When the trip started, rounded to the nearest 15 minutes.\n",
|
||||
@@ -629,14 +261,12 @@
|
||||
"- `dropoff_longitude`: The longitude of the center of the dropoff census tract or the community area if the census tract has been hidden for privacy.\n",
|
||||
"- `dropoff_location`: The location of the center of the dropoff census tract or the community area if the census tract has been hidden for privacy.\n",
|
||||
"\n",
|
||||
"Among the available fields in the dataset, only the fields that seem common and relevant for analysis and modeling like `taxi_id`, `trip_start_timestamp`, `trip_seconds`, `trip_miles`, `payment_type` and `trip_total` are selected. Further, the field `trip_total` is treated as the target variable that would be predicted by the machine learning model. Apparently, this field is a summation of the `fare`,`tips`,`tolls` and `extras` fields and so because of their correlation with the target variable, they are being excluded for modeling. Due to the volume of the data, a subset of the dataset over the course of one week, 12-May-2018 to 18-May-2018 is being considered. Within this date range itself, the datapoints can be noisy and so a few conditions like the following are considered: \n",
|
||||
"Among the available fields in the dataset, only the fields that seem common and relevant for analysis and modeling like `taxi_id`, `trip_start_timestamp`, `trip_seconds`, `trip_miles`, `payment_type` and `trip_total` are selected. Further, the field `trip_total` is treated as the target variable that would be predicted by the machine learning model. Apparently, this field is a summation of `fare`,`tips`,`tolls` and `extras` fields and so because of their correlation with the target variable, they are being excluded for modeling. Due to the volume of the data, a subset of the dataset over the course of one week i.e., 12-May-2018 to 18-May-2018 is being considered. Within this date range itself, the datapoints can be noisy and so a few conditions like the following are considered : \n",
|
||||
"\n",
|
||||
"- Time taken for the trip > 0.\n",
|
||||
"- Distance covered during the trip > 0.\n",
|
||||
"- Total trip charges > 0 and\n",
|
||||
"- Pickup and dropoff areas are valid (not empty).\n",
|
||||
"\n",
|
||||
"Note: The below cell is a Bigquery Integration cell and can only execute on Vertex AI Workbench's managed instances. If your notebook environment is different, you can skip it."
|
||||
"- Pickup and dropoff areas are valid(not empty)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -671,7 +301,7 @@
|
||||
"id": "781341730c28"
|
||||
},
|
||||
"source": [
|
||||
"The BigQuery integration also lets you load the queried data into a pandas dataframe using the `Query and load as DataFrame` button. Clicking the button adds a new cell below that provides a code snippet to load the data into a dataframe."
|
||||
"The Bigquery integration also allows us to load the queried data into a pandas dataframe using the `Query and load as DataFrame` button. Clicking the button adds a new cell below that provides a code snippet to load the data into a dataframe."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -686,7 +316,7 @@
|
||||
"# Comment out otherwise for speed-up.\n",
|
||||
"from google.cloud.bigquery import Client\n",
|
||||
"\n",
|
||||
"client = Client(project=PROJECT_ID)\n",
|
||||
"client = Client()\n",
|
||||
"\n",
|
||||
"query = \"\"\"select \n",
|
||||
"taxi_id, trip_start_timestamp, \n",
|
||||
@@ -698,7 +328,7 @@
|
||||
"where \n",
|
||||
"trip_start_timestamp >= '2018-05-12' and \n",
|
||||
"trip_end_timestamp <= '2018-05-18' and\n",
|
||||
"trip_seconds > 60 and trip_seconds < 6*60*60 and\n",
|
||||
"trip_seconds > 0 and trip_seconds < 6*60*60 and\n",
|
||||
"trip_miles > 0 and\n",
|
||||
"trip_total > 3 and\n",
|
||||
"pickup_community_area is not NULL and \n",
|
||||
@@ -713,7 +343,7 @@
|
||||
"id": "96d61011e159"
|
||||
},
|
||||
"source": [
|
||||
"Check the fields in the data and their shape."
|
||||
"Check the fields in the data and the shape."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -796,7 +426,7 @@
|
||||
"id": "f0feadc628e4"
|
||||
},
|
||||
"source": [
|
||||
"Depending on the percentage of null values in the data, one can choose to either drop them or impute them with mean/median (for numerical values) and mode (for categorical values). In the current data, there doesn't seem to be any null values."
|
||||
"Depending on the percentage of null values in the data, one can choose to either drop them or impute them with mean/median(for numerical values) and mode(for categorical values). In the current data, there doesn't seem to be any null values."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -850,7 +480,7 @@
|
||||
"## Analyze numerical data\n",
|
||||
"<a name=\"section-5\"></a>\n",
|
||||
"\n",
|
||||
"To further anaylyze the data, there are various plots that can be used on numerical and categorical fields. In case of numerical data, you can use histograms and box plots. Bar charts are suited for categorical data to better understand the distribution of the data and the outliers in the data."
|
||||
"To further anaylyze the data, there are various plots that can be used on numerical and categorical fields. In case of numerical data, one can use histograms and box-plots while bar charts are suited for categorical data to better understand the distribution of the data and the outliers in the data."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -859,7 +489,7 @@
|
||||
"id": "fa2d6258b509"
|
||||
},
|
||||
"source": [
|
||||
"Plot histograms and box plots on the numerical fields."
|
||||
"Plot Histograms and Box-plots on the numerical fields."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -885,7 +515,7 @@
|
||||
"id": "c3672976d67b"
|
||||
},
|
||||
"source": [
|
||||
"The field `trip_seconds` describes the time taken for the trip in seconds. For ease of our analysis, let us convert it into hours."
|
||||
"The field `trip_seconds` describes the time taken for the trip in seconds. Optionally, it can be converted into hours for an easier understanding."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -927,7 +557,7 @@
|
||||
"id": "58d57879aa8a"
|
||||
},
|
||||
"source": [
|
||||
"So far you've only looked at the univariate plots. To better understand the relationship between the variables, a pair-plot can be plotted."
|
||||
"So far we've only considered to look at the univariate plots. To better understand the relationship between the variables, a pair-plot can be plotted."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -938,7 +568,6 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# generate a pairplot for 10K samples\n",
|
||||
"sns.pairplot(\n",
|
||||
" data=df[[\"trip_seconds\", \"trip_miles\", \"trip_total\", \"trip_speed\"]].sample(10000)\n",
|
||||
")\n",
|
||||
@@ -951,7 +580,7 @@
|
||||
"id": "b69e8094ba39"
|
||||
},
|
||||
"source": [
|
||||
"From the box plots and the histograms visualized so far, it is evident that there are some outliers causing skewness in the data which perhaps could be removed. Also, you can see some linear relationships between the independent variables considered in the pair-plot. For example, `trip_seconds` and `trip_miles` and the dependant variable `trip_total`."
|
||||
"From the box-plots and the histograms plotted so far, it is evident that there are some outliers causing skewness in the data which perhaps could be removed. Also, we can certainly see some linear relationship between the independent variables considered in the pair-plot i.e., `trip_seconds` and `trip_miles` and the dependant variable `trip_total`."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -998,7 +627,7 @@
|
||||
"id": "341b581e2155"
|
||||
},
|
||||
"source": [
|
||||
"## Analyze categorical data\n",
|
||||
"## Analyze Categorical data\n",
|
||||
"\n",
|
||||
"Further, explore the categorical data by plotting the distribution of all the levels in each field."
|
||||
]
|
||||
@@ -1024,9 +653,9 @@
|
||||
"id": "a40a4b2d9d6a"
|
||||
},
|
||||
"source": [
|
||||
"From the above analysis, one can see that almost 99% of the transaction types are Cash and Credit Card. While there are also other type of transactions, their distribution is negligible. In such a case, the lower distribution levels can be dropped. On the other hand, the total number of pickup and dropoff community areas both seem to have the same levels which make sense. In this case also, one can choose to omit the lower distribution levels but you'd have to make sure that both the fields have the same levels afterward. In the current notebook, keep them as is and proceed with the modeling.\n",
|
||||
"From the above analysis, one can see that almost 99% of the transaction types are Cash and Credit Card. While there are also other type of transactions, their distribution is very less. In such a case, the lower distribution levels can be dropped. On the other hand, total number of pickup and dropoff community areas both seem to have the same levels which make sense. In this case also, one can choose to omit the lower distribution levels but it has to be made sure that both the fields have the same levels afterwards. In the current notebook, we'd keep them as is and proceed with the modeling.\n",
|
||||
"\n",
|
||||
"The relationships between the target variable and the categorical fields can be represented through box plots. For each level, the corresponding distribution of the target variable can be identified."
|
||||
"The relationships between the target variable and the categorical fields can be represented through boxplots. For each level, the corresponding distribution of the target variable can be identified."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1051,7 +680,7 @@
|
||||
"id": "f49125a8a866"
|
||||
},
|
||||
"source": [
|
||||
"There seems to be one case where the `trip_total` is over 3000 and has the same pickup and dropoff community area: 28 is clearly an outlier compared to the rest of the points. This datapoint can be removed."
|
||||
"There seems to be one case where the `trip_total` is over 3000 and has the same pickup and dropoff community area i.e., 28 which is clearly an outlier compared to the rest of the points. This datapoint can be removed."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1096,7 +725,7 @@
|
||||
"id": "58a1d9f0a122"
|
||||
},
|
||||
"source": [
|
||||
"There are also useful timestamp fields in the data. `trip_start_timestamp` represents the start timestamp of the taxi trip and fields like what day of week it was and what hour it was can be derived from it."
|
||||
"There are also timestamp fields in the data that can prove to be useful. `trip_start_timestamp` represents the start timestamp of the taxi-trip and fields like what day of week it was and what hour it was can be dervied from it."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1118,7 +747,7 @@
|
||||
"id": "30ae02a15aa1"
|
||||
},
|
||||
"source": [
|
||||
"Since the current dataset is limited to only a week, if there isn't much variation in the newly derived fields with respect to the target variable, they can be dropped.\n",
|
||||
"Since the current dataset is considered only for a week, if there isn't much variation in the newly dervied fields with respect to the target variable, they can be dropped.\n",
|
||||
"\n",
|
||||
"Plot sum and average of the `trip_total` with respect to the `dayofweek`."
|
||||
]
|
||||
@@ -1175,9 +804,9 @@
|
||||
"id": "739e985af704"
|
||||
},
|
||||
"source": [
|
||||
"As these plots don't seem to have constant figures with respect to the target variable across their levels, they can be considered for training. In fact, to simplify things these derived features can be bucketed into fewer levels.\n",
|
||||
"As these plots don't seem to have constant figures with respect to the target variable across their levels, they can be considered for training. In fact, to simplify things these dervied features can be bucketed into less number of levels.\n",
|
||||
"\n",
|
||||
"The `dayofweek` field can be bucketed into a binary field considering whether or not it was a weekend. If it is a weekday, the record can be assigned 1, else 0. Similarly, the `hour` field can also be bucketed and encoded. The normal working hours in Chicago can be assumed to be between *8AM*-*10PM* and if the value falls in between the working hours, it can be encoded as 1, else 0."
|
||||
"`dayofweek` field can be bucketed into a binary field considering whether or not it was a weekend. If it is a weekday, the record can be assigned 1, else 0. Similarly, `hour` field can also be bucketed and encoded. The normal working hours in Chicago can be assumed to be between *8AM*-*10PM* and if the value falls in between the working hours, it can be encoded as 1, else 0."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1219,7 +848,7 @@
|
||||
"id": "fe87612faa94"
|
||||
},
|
||||
"source": [
|
||||
"## Divide the data into train and test sets\n",
|
||||
"## Divide the data in Train and Test sets\n",
|
||||
"\n",
|
||||
"Split the preprocessed dataset into train and test sets so that the linear regression model can be validated on the test set."
|
||||
]
|
||||
@@ -1258,10 +887,10 @@
|
||||
"id": "5b7e470de1da"
|
||||
},
|
||||
"source": [
|
||||
"## Fit a simple linear regression model\n",
|
||||
"## Fit a Simple Linear Regression model\n",
|
||||
"<a name=\"section-6\"></a>\n",
|
||||
"\n",
|
||||
"Fit a linear regression model using scikit-learn's LinearRegression method on the train data."
|
||||
"Fit a linear regression model using Sklearn's LinearRegression method on the train data."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1311,7 +940,7 @@
|
||||
"id": "2ef6b44f0f93"
|
||||
},
|
||||
"source": [
|
||||
"A low RMSE error and a train and test R2 score of 0.93 suggests that the model is fitted well. Further, the coefficients learned by the model for each of its independent variables can also be checked by checking the `coef_` attribute of the sklearn model. \n",
|
||||
"A low RMSE error and a train and test R2 score of 0.93 suggests that the model has fitted well on the data. Further, the coefficients learned by the model for each of its independent variables can also be checked by checking the `coef_` attribute of the sklearn model. \n",
|
||||
"\n",
|
||||
"Check the coefficients learned by the model."
|
||||
]
|
||||
@@ -1334,7 +963,7 @@
|
||||
"id": "bcaed0b52e60"
|
||||
},
|
||||
"source": [
|
||||
"## Save the model and upload to a Cloud Storage bucket\n",
|
||||
"## Save the model and upload to a GCS bucket.\n",
|
||||
"<a name=\"section-7\"></a>\n",
|
||||
"\n",
|
||||
"To deploy the model on Vertex AI, the model needs to be stored in a Cloud Storage bucket first."
|
||||
@@ -1370,21 +999,10 @@
|
||||
"id": "9f8ecfa6a19b"
|
||||
},
|
||||
"source": [
|
||||
"## Deploy the model on Vertex AI with support for Vertex Explainable AI\n",
|
||||
"## Deploy the Model on Vertex AI with support for Vertex Explainable AI\n",
|
||||
"<a name=\"section-8\"></a>\n",
|
||||
"\n",
|
||||
"Configure Vertex Explainable AI before deploying the model. For further details, see [Configuring Vertex Explainable AI in Vertex AI models](https://cloud.google.com/vertex-ai/docs/explainable-ai/configuring-explanations#scikit-learn-and-xgboost-pre-built-containers)."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "a130721a5375"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"MODEL_DISPLAY_NAME = \"[your-model-display-name]\" # @param {type: \"string\"}"
|
||||
"Configure the Vertex Explainable AI before deploying the model. For further details, see [Configuring Vertex Explainable AI in Vertex AI models](https://cloud.google.com/vertex-ai/docs/explainable-ai/configuring-explanations#scikit-learn-and-xgboost-pre-built-containers)."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1395,11 +1013,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If the model display name is not set, choose the default one\n",
|
||||
"if MODEL_DISPLAY_NAME == \"[your-model-display-name]\":\n",
|
||||
" MODEL_DISPLAY_NAME = \"taxi_fare_prediction_model\"\n",
|
||||
"\n",
|
||||
"\n",
|
||||
"MODEL_DISPLAY_NAME = \"taxi_fare_prediction_model\"\n",
|
||||
"ARTIFACT_GCS_PATH = f\"{BUCKET_URI}/{BLOB_PATH}\"\n",
|
||||
"\n",
|
||||
"# Feature-name(Inp_feature) and Output-name(Model_output) can be arbitrary\n",
|
||||
@@ -1429,7 +1043,7 @@
|
||||
"\n",
|
||||
"# Create a Vertex AI model resource with support for Vertex Explainable AI\n",
|
||||
"\n",
|
||||
"aiplatform.init(project=PROJECT_ID, location=REGION)\n",
|
||||
"aiplatform.init(project=PROJECT, location=LOCATION)\n",
|
||||
"\n",
|
||||
"model = aiplatform.Model.upload(\n",
|
||||
" display_name=MODEL_DISPLAY_NAME,\n",
|
||||
@@ -1453,20 +1067,7 @@
|
||||
"id": "1ed1bd9f0957"
|
||||
},
|
||||
"source": [
|
||||
"### Create an Endpoint resource for the model\n",
|
||||
"\n",
|
||||
"Set a display name for the endpoint and create the endpoint resource."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "f0e5cea786b4"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"ENDPOINT_DISPLAY_NAME = \"[your-endpoint-display-name]\" # @param {type: \"string\"}"
|
||||
"Create an Endpoint resource for the model."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1477,12 +1078,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If the display name is not set, choose the default one\n",
|
||||
"if ENDPOINT_DISPLAY_NAME == \"[your-endpoint-display-name]\":\n",
|
||||
" ENDPOINT_DISPLAY_NAME = \"taxi_fare_prediction_endpoint\"\n",
|
||||
"ENDPOINT_DISPLAY_NAME = \"taxi_fare_prediction_endpoint\"\n",
|
||||
"\n",
|
||||
"endpoint = aiplatform.Endpoint.create(\n",
|
||||
" display_name=ENDPOINT_DISPLAY_NAME, project=PROJECT_ID, location=REGION\n",
|
||||
" display_name=ENDPOINT_DISPLAY_NAME, project=PROJECT, location=LOCATION\n",
|
||||
")\n",
|
||||
"\n",
|
||||
"print(endpoint.display_name)\n",
|
||||
@@ -1492,23 +1091,30 @@
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9eaab1c54d66"
|
||||
"id": "2a1b280dbec6"
|
||||
},
|
||||
"source": [
|
||||
"### Deploy the model to the created endpoint with the required machine type\n",
|
||||
"\n",
|
||||
"Set a name for the deployment and deploy the model to the created endpoint."
|
||||
"Save the Endpoint Id for inference."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "6fd9517c3403"
|
||||
"id": "6516bfdd5066"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"DEPLOYED_MODEL_NAME = \"[your-deployed-model-name]\" # @param {type: \"string\"}"
|
||||
"ENDPOINT_ID = \"\""
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "9eaab1c54d66"
|
||||
},
|
||||
"source": [
|
||||
"Deploy the model to the created endpoint with the required machine-type."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1519,14 +1125,10 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# If the deployment name is not set, choose the default one\n",
|
||||
"if DEPLOYED_MODEL_NAME == \"[your-deployed-model-name]\":\n",
|
||||
" DEPLOYED_MODEL_NAME = \"taxi_fare_prediction_deployment\"\n",
|
||||
"\n",
|
||||
"# Set the machine type to n1-standard2\n",
|
||||
"DEPLOYED_MODEL_NAME = \"taxi_fare_prediction_deployment\"\n",
|
||||
"MACHINE_TYPE = \"n1-standard-2\"\n",
|
||||
"\n",
|
||||
"# Deploy the model to the endpoint\n",
|
||||
"# deploy the model to the endpoint\n",
|
||||
"model.deploy(\n",
|
||||
" endpoint=endpoint,\n",
|
||||
" deployed_model_display_name=DEPLOYED_MODEL_NAME,\n",
|
||||
@@ -1545,18 +1147,18 @@
|
||||
"id": "686cfdcbaef8"
|
||||
},
|
||||
"source": [
|
||||
"To ensure the model is deployed, the ID of the deployed model can be checked using the `endpoint.list_models()` method."
|
||||
"Save the ID of the deployed model. The ID of the deployed model can also checked using the `endpoint.list_models()` method."
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "code",
|
||||
"execution_count": null,
|
||||
"metadata": {
|
||||
"id": "bab07adf5339"
|
||||
"id": "018f0fdb1d60"
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"endpoint.list_models()"
|
||||
"DEPLOYED_MODEL_ID = \"\""
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1565,7 +1167,7 @@
|
||||
"id": "b751978ff665"
|
||||
},
|
||||
"source": [
|
||||
"## Get explanations from the deployed model\n",
|
||||
"## Get explanations from the deployed model.\n",
|
||||
"<a name=\"section-9\"></a>\n",
|
||||
"\n",
|
||||
"For testing the deployed online model, select two instances from the test data as payload."
|
||||
@@ -1589,7 +1191,7 @@
|
||||
"id": "01532047a99e"
|
||||
},
|
||||
"source": [
|
||||
"Call the endpoint with the payload request and parse the response for explanations. The explanations consists of attributions on the independent variables used for training the model which are based on the configured attribution method. In this case, we've used the `Sampled Shapely` method which assigns credit for the outcome to each feature, and considers different permutations of the features. This method provides a sampling approximation of exact Shapely values. Further information on the attribution methods for explanations can be found at [Overview of Explainable AI](https://cloud.google.com/vertex-ai/docs/explainable-ai/overview)."
|
||||
"Call the endpoint with the payload request and parse the response for explanations. The explanations consists of attributions on the independent variables used for training the model which are based on the configured attribution method. In this case, we've used the `Sampled Shapely` method which assigns credit for the outcome to each feature, and considers different permutations of the features. This method provides a sampling approximation of exact Shapley values. Further information on the attribution methods for explantions can be found at [Overview of ExplainableAI](https://cloud.google.com/vertex-ai/docs/explainable-ai/overview) page."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1625,7 +1227,7 @@
|
||||
" \"\"\"\n",
|
||||
" aiplatform.init(project=project, location=location)\n",
|
||||
"\n",
|
||||
" # endpoint = aiplatform.Endpoint(endpoint_id)\n",
|
||||
" endpoint = aiplatform.Endpoint(endpoint_id)\n",
|
||||
"\n",
|
||||
" response = endpoint.explain(instances=instances)\n",
|
||||
" print(\"#\" * 10 + \"Explanations\" + \"#\" * 10)\n",
|
||||
@@ -1655,7 +1257,7 @@
|
||||
"\n",
|
||||
"\n",
|
||||
"test_json = [X_test.iloc[0].tolist(), X_test.iloc[1].tolist()]\n",
|
||||
"prediction = explain_tabular_sample(PROJECT_ID, REGION, endpoint, test_json)"
|
||||
"prediction = explain_tabular_sample(PROJECT, LOCATION, ENDPOINT_ID, test_json)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1664,9 +1266,9 @@
|
||||
"id": "87cf259efb64"
|
||||
},
|
||||
"source": [
|
||||
"## Next steps\n",
|
||||
"## Next Steps\n",
|
||||
"\n",
|
||||
"Since the Chicago Taxi Trips dataset is continuously updating, one can preform the same kind of analysis and model training every time a new set of data is available. The date range can also be increased from a week to a month or more depending on the quality of the data. Most of the steps followed in this notebook would still be valid and can be applied over the new data unless the data is too noisy. In fact, the notebook itself can be scheduled to run at the specified times to retrain the model using the scheduling option of [Vertex AI Workbench's executor](https://console.cloud.google.com/vertex-ai/workbench/list/executions). "
|
||||
"Since the Chicago-Taxicab dataset is continuously updating, one can preform the same kind of analysis and model training every time a new set of data is available. The date range can also be increased from a week to a month or more depending on the quality of data. Most of the steps followed in this notebook would still be valid and can be applied over the new data unless the data is too noisy. Perhaps, the notebook itself can be scheduled to run at the specified times to retrain the model using the scheduling option of the [Vertex AI workbench's Executor](https://console.cloud.google.com/vertex-ai/workbench/list/executions) feature. "
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1675,25 +1277,12 @@
|
||||
"id": "eae8d94e3641"
|
||||
},
|
||||
"source": [
|
||||
"## Clean up\n",
|
||||
"## Clean Up\n",
|
||||
"<a name=\"section-10\"></a>\n",
|
||||
"\n",
|
||||
"To clean up all Google Cloud resources used in this project, you can [delete the Google Cloud\n",
|
||||
"project](https://cloud.google.com/resource-manager/docs/creating-managing-projects#shutting_down_projects) you used for the tutorial.\n",
|
||||
"Delete the resources created in this notebook.\n",
|
||||
"\n",
|
||||
"Otherwise, you can delete the individual resources you created in this tutorial:\n",
|
||||
"\n",
|
||||
"- Model\n",
|
||||
"- Endpoint\n",
|
||||
"- Cloud Storage Bucket"
|
||||
]
|
||||
},
|
||||
{
|
||||
"cell_type": "markdown",
|
||||
"metadata": {
|
||||
"id": "f28a9843a13e"
|
||||
},
|
||||
"source": [
|
||||
"Undeploy the model"
|
||||
"Undeploy the model by specifying the `DEPLOYED_MODEL_ID`."
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1704,7 +1293,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"endpoint.undeploy_all()"
|
||||
"endpoint.undeploy(deployed_model_id=DEPLOYED_MODEL_ID)"
|
||||
]
|
||||
},
|
||||
{
|
||||
@@ -1764,11 +1353,7 @@
|
||||
},
|
||||
"outputs": [],
|
||||
"source": [
|
||||
"# Set this to true only if you'd like to delete your bucket\n",
|
||||
"delete_bucket = False\n",
|
||||
"\n",
|
||||
"if delete_bucket or os.getenv(\"IS_TESTING\"):\n",
|
||||
" ! gsutil -m rm -r $BUCKET_URI"
|
||||
"! gsutil -m rm -r $BUCKET_URI"
|
||||
]
|
||||
}
|
||||
],
|
||||
|
Before Width: | Height: | Size: 66 KiB After Width: | Height: | Size: 66 KiB |